Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D03916g34433916730.0
KLLA0C10318g3333296584e-84
Sklu_1023.23523356571e-83
Scas_690.373323466263e-79
Kwal_47.181843373296045e-76
AAL062W3273345592e-69
YHR034C3443635238e-64
Sklu_2049.2277108636.2
CAGL0J07326g808126646.4
Scas_717.44335122629.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D03916g
         (339 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D03916g complement(391089..392123) similar to sp|P38768 Sac...   649   0.0  
KLLA0C10318g complement(885031..886032) similar to sp|P38768 Sac...   258   4e-84
Sklu_1023.2 YHR034C, Contig c1023 1165-2223                           257   1e-83
Scas_690.37                                                           245   3e-79
Kwal_47.18184                                                         237   5e-76
AAL062W [125] [Homologous to ScYHR034C - SH] complement(238295.....   219   2e-69
YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein...   206   8e-64
Sklu_2049.2 YER142C, Contig c2049 2164-2997 reverse complement         29   6.2  
CAGL0J07326g 706430..708856 similar to sp|P53866 Saccharomyces c...    29   6.4  
Scas_717.44                                                            28   9.4  

>CAGL0D03916g complement(391089..392123) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c, hypothetical start
          Length = 344

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/339 (95%), Positives = 323/339 (95%)

Query: 1   MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60
           MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA
Sbjct: 1   MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60

Query: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120
           PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY
Sbjct: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120

Query: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEATQN 180
           QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEATQN
Sbjct: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEATQN 180

Query: 181 DKGNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANETKGRSLIQEIDDLTL 240
           DKGNDPSSLLQIRR                ITAHGLPPLFPKANETKGRSLIQEIDDLTL
Sbjct: 181 DKGNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPPLFPKANETKGRSLIQEIDDLTL 240

Query: 241 KEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQIDSITGKSDLNIFYDPTNNDIVLR 300
           KEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQIDSITGKSDLNIFYDPTNNDIVLR
Sbjct: 241 KEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQIDSITGKSDLNIFYDPTNNDIVLR 300

Query: 301 NLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYVNKTGT 339
           NLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYVNKTGT
Sbjct: 301 NLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYVNKTGT 339

>KLLA0C10318g complement(885031..886032) similar to sp|P38768
           Saccharomyces cerevisiae YHR034c singleton, start by
           similarity
          Length = 333

 Score =  258 bits (658), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 150/329 (45%), Positives = 206/329 (62%), Gaps = 26/329 (7%)

Query: 1   MDFLLRPI---ASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHD 57
           M FLLRP+   +S + N V  + PEP FV+KSK++N          L + +KIF+N+CH+
Sbjct: 1   MSFLLRPLNDSSSNNSNNVIRISPEPCFVVKSKVIN-----PGTTSLSSNAKIFINICHN 55

Query: 58  PQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFV 117
            Q P PEI F+P IVYPLIINN+WEIPIV SSIR D DKKG VCYV DCC+ + CV W  
Sbjct: 56  DQIPLPEIDFNPAIVYPLIINNQWEIPIVTSSIREDVDKKGNVCYVSDCCINTKCVSWIQ 115

Query: 118 EDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEA 177
            D QL+EIVVEWCLE+ ELR  +EISRD ISFPK++KKGD+IP+LEI   +L  ++  E 
Sbjct: 116 HDLQLREIVVEWCLESCELRAELEISRDNISFPKLKKKGDTIPELEILREDL--TENYEE 173

Query: 178 TQNDKGN----DPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANETKGRSLIQ 233
           T ND  N    +P S+++ RR                 +   LPPL P    ++ + LI+
Sbjct: 174 TINDLVNREQKEPVSIIEKRRDFLAEDEP---------STGELPPLIPIDQSSRRKPLIE 224

Query: 234 EIDDLTLKEKPKNAAKKVQ-KNIEYNVVMKKIENHKYKLRLDIQIDS-ITGKSDLNIFYD 291
           EI+DL+L E  K   +++Q K+I Y + M K ++    L L I++ S +    D NI YD
Sbjct: 225 EIEDLSLHETKKPKVEEIQKKSISYELSMGKPKDTSEFL-LKIEVTSELNSSLDYNIKYD 283

Query: 292 PTNNDIVLRNLNTDLYDQKDFKIPLPNIF 320
             +N ++++N N  +Y +K  K+PLP+IF
Sbjct: 284 AKSNKLIIKNTNLGIYPEKKLKVPLPDIF 312

>Sklu_1023.2 YHR034C, Contig c1023 1165-2223
          Length = 352

 Score =  257 bits (657), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 143/335 (42%), Positives = 211/335 (62%), Gaps = 21/335 (6%)

Query: 2   DFLLRPIASGDDN-QVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60
           +FLLRPI S +    V +L P+P FVIKSK+    +      +L  G+KIF+N+C D Q 
Sbjct: 4   NFLLRPINSTESTASVLLLEPQPGFVIKSKL----DSCSPPTELAIGTKIFINVCFDNQV 59

Query: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120
           PKP   F+P+IVYPLI+NN+WEIPI+ S++R D DKKG +CYV DCC+ ++C+ W  +DY
Sbjct: 60  PKPNTEFNPSIVYPLIMNNQWEIPIITSNVREDKDKKGAICYVWDCCINTECMSWVNKDY 119

Query: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDG---SDIKEA 177
           QL+EI+VEWCLE+ ELR+ +EISRD+I+FPK+++KGD IP LEI +++L+     +I   
Sbjct: 120 QLREILVEWCLESCELRQSVEISRDRIAFPKLKRKGDKIPTLEILNSDLNQDFRKEIDSI 179

Query: 178 TQNDKGNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFP------KANETKGRSL 231
            + D+  DP+S+L+++R                     LPPLFP        N T+ + L
Sbjct: 180 VEKDR-TDPTSILEMQRDLVFGETLGGRKNNGDEDTGTLPPLFPTTATTTTNNTTQKKPL 238

Query: 232 IQEIDDLTLKEKPKNAAKKVQ----KNIEYNVVMKKI-ENHKYKLRLDIQIDSITGKSDL 286
           I+EI DL+++EK     K       K +EY   M K  ++ K+KL+++I I  +    D 
Sbjct: 239 IEEIQDLSIREKQAETRKPRAIVEPKTLEYQATMVKTKDDKKFKLKIEI-ISELDSSLDY 297

Query: 287 NIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPNIFE 321
           +I YD  N+ + ++N+N  LY++K  +IPLP IFE
Sbjct: 298 SIKYDVKNSVLAIKNINLHLYNEKKLEIPLPKIFE 332

>Scas_690.37
          Length = 332

 Score =  245 bits (626), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/346 (40%), Positives = 201/346 (58%), Gaps = 39/346 (11%)

Query: 2   DFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQAP 61
           DFL+RPI++  D  +T+ HP P FVIKSK+                SK+F+N+C D   P
Sbjct: 7   DFLIRPISTAQDPIITI-HPTPKFVIKSKLT------------PTNSKLFINVCQDANVP 53

Query: 62  KPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDYQ 121
            P IPF PN+VYPLI+ ++WEIPI+ S +R DTDKKG  C+V DC +   C++W  +D Q
Sbjct: 54  SPSIPFQPNVVYPLIMRDEWEIPILTSPMRQDTDKKGSPCHVCDCIINDQCMQWIAKDLQ 113

Query: 122 LKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGD-SIPDLEIFSNELD---GSDIKEA 177
           L+EI++EWCLEA ELRE + + RD +  PK+  KG   +P LEI   EL+     DI   
Sbjct: 114 LREILIEWCLEAVELREAVTVDRDAVKLPKLTCKGSLPLPVLEIPKRELERDFKRDIASI 173

Query: 178 TQNDKGNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANETKGRSLIQEID- 236
            + +  ++P  +LQ++R                     LPPLFP++   +G  LI+EID 
Sbjct: 174 IEENTVDEPVKVLQLKRTQNDDPD------------DTLPPLFPQSGNVQG-PLIEEIDV 220

Query: 237 -----DLTLKEKPKNAAKKVQKNIEYNVVMKKIEN-HKYKLRLDIQIDSITGKSDLNIFY 290
                 +T +E   +    + K++ +  VM+K  N  +YKLR+DI    I    DL++ Y
Sbjct: 221 DMDDLKITKQEPTSSRTSPLLKDLHFETVMRKTNNTQRYKLRIDIT-SEIDSSLDLHLAY 279

Query: 291 DPTNNDIVLRNLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYVNK 336
           D TNN+++L+NLNT  + +K  KIPLPNIF  ++I   SE F++ K
Sbjct: 280 DRTNNELILQNLNTVEFIEKKIKIPLPNIFTYENI-KQSECFFIKK 324

>Kwal_47.18184
          Length = 337

 Score =  237 bits (604), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 132/329 (40%), Positives = 200/329 (60%), Gaps = 25/329 (7%)

Query: 1   MDFLLRPIASG--DDNQVTVLHPEPLFVIKSKIVN-IDNRPKKLLKLEAGSKIFVNLCHD 57
           M FLLR I +G  D + V  + P+P FV+KSK+V+  D R         G+K+FVN+CH+
Sbjct: 1   MAFLLRAIDNGNNDADSVVRVEPQPGFVVKSKLVSSYDGR------YSLGAKVFVNVCHE 54

Query: 58  PQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFV 117
            Q P+PEIPF+P++VYPLI+ N+WEIPI+AS++R D DKKG +CYV DCC+ S C++W  
Sbjct: 55  DQVPQPEIPFNPSVVYPLIMTNQWEIPIIASALRQDRDKKGDLCYVCDCCINSACMQWAR 114

Query: 118 EDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEA 177
            + QL+EI+VEWCLE+ ELR+ IEISR+ ++FPK+R KG SI  LE+ + +L   D +  
Sbjct: 115 TELQLREILVEWCLESCELRQRIEISREHLAFPKLRMKGASILPLEVLTTDLHA-DFRHE 173

Query: 178 TQN--DKGNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANETKGRSLIQEI 235
            ++   +  +P+S+L+++R                I +  LPPLFP  ++T  R LIQEI
Sbjct: 174 MRDLAKREAEPASILELKR-----ELIDADLDSTSIDSSALPPLFP--SKTPTRLLIQEI 226

Query: 236 DDL-TLKEKPKNAAKKVQKNIE--YNVVMKK--IENHKYKLRLDIQIDSITGKSDLNIFY 290
           D   T  + P           +  +++ M K   +N + KLR+DI +  +  +SD  I Y
Sbjct: 227 DSTSTSSQAPAKTVSTTPPTTDPAFDISMGKPSAQNSQAKLRIDI-VSLLPAESDYLISY 285

Query: 291 DPTNNDIVLRNLNTDLYDQKDFKIPLPNI 319
           +   N + + + NT  +  K+  I LP++
Sbjct: 286 NSNENTLTISHTNTTHFLPKEITIALPHV 314

>AAL062W [125] [Homologous to ScYHR034C - SH]
           complement(238295..239278) [984 bp, 327 aa]
          Length = 327

 Score =  219 bits (559), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 187/334 (55%), Gaps = 26/334 (7%)

Query: 1   MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSKIFVNLCHDPQA 60
           MDFLLRPI S + + +T + P P FVIKSK+ +      K   L  G+K FVN+CH  Q 
Sbjct: 1   MDFLLRPIDSKECSVITFV-PTPGFVIKSKLEH-----GKDATLVVGTKTFVNVCHHTQV 54

Query: 61  PKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVASDCVKWFVEDY 120
           P P++PFD +IVYPLI+ NKWEIPIV S++R D DKKGQ CYV DCC+ S+C++W  +DY
Sbjct: 55  PLPDVPFDASIVYPLIMENKWEIPIVTSAVRRDADKKGQECYVWDCCINSECMQWIEKDY 114

Query: 121 QLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNELDGSDIKEATQN 180
           QL+EI+VEWCLE+ ELR+ + ISR+ + FP+M+ KG ++P +E+   +L      E  +N
Sbjct: 115 QLREILVEWCLESCELRQSVGISREAVVFPRMKSKG-ALPAVEVLQQDLTHDYKHEIAEN 173

Query: 181 DK--GNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANETKGRSLIQEIDDL 238
                +DP  +L +R                      LP LFP+   T  R LI+E++  
Sbjct: 174 SSLGMDDPRQILHMRGALDEEASGDDGT---------LPSLFPERPAT--RPLIEEVNTG 222

Query: 239 TLK---EKPKNAAKKVQKNIEYNVVMKKIEN-HKYKLRLDIQIDSITGKSDLNIFYDPTN 294
                 E PK         +E+ V M +  N   YK+++ +   ++      ++ YD   
Sbjct: 223 RHSASVEAPKTLPACGLPRLEFAVTMGRPRNDANYKIKVQVA-SALNSGHAYSVHYDGKE 281

Query: 295 NDIVLRNLNTDLYDQKDFKIPLPNIFEGKDIMNS 328
           N +++ +  +  Y+ K+  IPLP +  G   M +
Sbjct: 282 NSLLVTS-TSQAYEPKEICIPLPGVVAGTRSMRA 314

>YHR034C (YHR034C) [2321] chr8 complement(176957..177991) Protein of
           unknown function, has low similarity to uncharacterized
           C. albicans Orf6.8994p [1035 bp, 344 aa]
          Length = 344

 Score =  206 bits (523), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 195/363 (53%), Gaps = 51/363 (14%)

Query: 2   DFLLRPI------------ASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKLEAGSK 49
           DFLLRPI                D  V+ + P   FVIK+K+++  N P+KL   + G K
Sbjct: 3   DFLLRPIKQRHRNEDKYVSVDAADGSVSKIEPIADFVIKTKLLSA-NGPEKL---QDGRK 58

Query: 50  IFVNLCHDPQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCYVIDCCVA 109
           +F+N+CH P  PKPE+ F+  IV+PLII N+WEIPI+ S  R D DKKGQ CYV DCC+ 
Sbjct: 59  VFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCIN 118

Query: 110 SDCVKWFVEDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIPDLEIFSNEL 169
           SDC +W  +D QL+EI+VEWCLE+ E+R+ + + RD+I+FPKM+KKG  +P LE+ ++EL
Sbjct: 119 SDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVLNDEL 178

Query: 170 DGSDIKEATQ---NDKGNDPSSLLQIRRXXXXXXXXXXXXXXXXITAHGLPPLFPKANET 226
              D K        ++  DP S+L+                        LPPLFP  N+ 
Sbjct: 179 -HQDYKAKMHKIIEEEAGDPMSILR--------GRNDDGDDNNDPDDGTLPPLFPIENKI 229

Query: 227 KGRSLIQEID-------DLTLKEKPKNAAKKVQKNI-EYNVVMKKIENHKYKLRLDIQID 278
            G + I+EID       +L     P  A  + Q+++ EY V MK+ +   YKLR+ I+  
Sbjct: 230 SG-AKIEEIDKNEIAHRNLKQAPAPAPAPHEQQEDVPEYEVKMKRFKGAAYKLRILIENK 288

Query: 279 SITGKSDLNIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPN--IFEGKDIMNSSEIFYVNK 336
           +   K D    + P+ N     N+   LY      IPLP   +    DI    +IF++ K
Sbjct: 289 APNSKPDR---FSPSYN--FAENI---LYINGKLSIPLPRDIVVNAADI----KIFHIRK 336

Query: 337 TGT 339
             T
Sbjct: 337 ERT 339

>Sklu_2049.2 YER142C, Contig c2049 2164-2997 reverse complement
          Length = 277

 Score = 28.9 bits (63), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 22/108 (20%)

Query: 153 RKKGDSIPDLEIFSNELDGSDIKEATQNDKGNDPSSLLQIRRXXXXXXXXXXXXXXXXIT 212
           RK+ +SIP+L     +    D  EA Q+    DPS L                     IT
Sbjct: 6   RKRDESIPELPQAFKQRHTEDFNEACQHILKVDPSLL-------------------ATIT 46

Query: 213 AHGLPPLFPKANE--TKGRSLIQEIDDLTLKEKPKNAAKKVQKN-IEY 257
           +H  P    K  E  T     ++    +  ++   NAAK ++K  +EY
Sbjct: 47  SHDFPLFLVKEQEQLTLNHHFVKLASSIIAQQISGNAAKSIKKRVVEY 94

>CAGL0J07326g 706430..708856 similar to sp|P53866 Saccharomyces
           cerevisiae YNL224c, start by similarity
          Length = 808

 Score = 29.3 bits (64), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 19/126 (15%)

Query: 217 PPLFPKANETK--GRSLIQEIDDLTLKEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLD 274
           P  F KAN T    R LI ++ + +  ++ K   +   K  EY    +K          D
Sbjct: 128 PIEFIKANCTYDPSRDLILQLANRSKNQESKEPEEDANKCSEYAEHSEK----------D 177

Query: 275 IQIDSITGKSDLNIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPNIFEGKDI--MNSSEIF 332
           ++ID+   ++D NI YD ++ D  + N N  + + K       NI E  DI  +   E+F
Sbjct: 178 MEIDTAATENDANISYDESDTDQEIGNFNHSIENSKHNN----NISEC-DITAVTDQELF 232

Query: 333 YVNKTG 338
           +V++ G
Sbjct: 233 FVDEEG 238

>Scas_717.44
          Length = 335

 Score = 28.5 bits (62), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 9/122 (7%)

Query: 217 PPLFPKANETKGRSLIQEIDDLTLKEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQ 276
            P F   NE +   LI      TLK   +    K+ K+I  +  +  I  +   + LD Q
Sbjct: 27  APQFSDPNEIESYKLIHSAYFNTLKTHSRRIYGKINKSISSSFPVMNIGTYLRTVALDSQ 86

Query: 277 IDSITGKSD-LNIFYDPTNNDIVLRNL-----NTDLYDQKDFKIPLPNIFEGKDIMNSSE 330
           I++   K+D + I      +D+ +  L     N   Y   DFK    +I+   DI+ ++E
Sbjct: 87  IETFLQKNDKVQIINLGCGSDLRMFQLLNKYDNLTKYLDLDFK---DSIYFKNDILWNTE 143

Query: 331 IF 332
           +F
Sbjct: 144 LF 145

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,799,955
Number of extensions: 539707
Number of successful extensions: 1745
Number of sequences better than 10.0: 29
Number of HSP's gapped: 1752
Number of HSP's successfully gapped: 30
Length of query: 339
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 237
Effective length of database: 13,065,073
Effective search space: 3096422301
Effective search space used: 3096422301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)