Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D03894g48547822580.0
Scas_588.1442347113300.0
YDR300C (PRO1)42847313101e-179
YHR033W42347612701e-173
CAGL0H01441g42747112601e-171
Kwal_47.1818742147412361e-168
KLLA0C10296g41847012311e-167
Scas_690.3642447811441e-154
AAL061C42047110821e-145
Scas_715.44528101790.12
YER052C (HOM3)527101750.39
ADR106W79837720.97
CAGL0J02882g53040701.6
KLLA0F27599g52240701.7
Kwal_47.1816352240682.8
Sklu_2260.352379682.9
CAGL0C04048g620117664.8
Sklu_2398.332091655.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D03894g
         (478 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...   874   0.0  
Scas_588.14                                                           516   0.0  
YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamat...   509   e-179
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...   493   e-173
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...   489   e-171
Kwal_47.18187                                                         480   e-168
KLLA0C10296g 883644..884900 highly similar to sp|P32264 Saccharo...   478   e-167
Scas_690.36                                                           445   e-154
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...   421   e-145
Scas_715.44                                                            35   0.12 
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...    33   0.39 
ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH] complement...    32   0.97 
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...    32   1.6  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...    32   1.7  
Kwal_47.18163                                                          31   2.8  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement         31   2.9  
CAGL0C04048g complement(399734..401596) similar to sp|P40549 Sac...    30   4.8  
Sklu_2398.3 YKL218C, Contig c2398 4746-5708 reverse complement         30   5.6  

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/478 (90%), Positives = 433/478 (90%)

Query: 1   MSQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAME 60
           MSQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHK            LNAME
Sbjct: 1   MSQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKVVIVSSGGIAVGLNAME 60

Query: 61  MDKKPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTI 120
           MDKKPTD                  WSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTI
Sbjct: 61  MDKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTI 120

Query: 121 LQLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRT 180
           LQLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRT
Sbjct: 121 LQLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRT 180

Query: 181 NPDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDA 240
           NPDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDA
Sbjct: 181 NPDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDA 240

Query: 241 PSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLL 300
           PSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLL
Sbjct: 241 PSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLL 300

Query: 301 SLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNE 360
           SLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNE
Sbjct: 301 SLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNE 360

Query: 361 SGDEEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKL 420
           SGDEEHVSEAY               HGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKL
Sbjct: 361 SGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKL 420

Query: 421 DPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPPSASS 478
           DPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPPSASS
Sbjct: 421 DPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPPSASS 478

>Scas_588.14
          Length = 423

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/471 (55%), Positives = 330/471 (70%), Gaps = 56/471 (11%)

Query: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEMDK 63
           T+VIKLG+SSLVDEKT+EPKL+IM+ +VETV++L+R GHK            L  + +DK
Sbjct: 8   TLVIKLGSSSLVDEKTKEPKLAIMSLLVETVVKLRRLGHKVIIVSSGGIAVGLRTLNLDK 67

Query: 64  KPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123
           +P                    W +LF Q+G++IAQILITRNDI+ WTQYKNAQNTI +L
Sbjct: 68  RPKHLAEVQAIAAVGQGRLIGRWDLLFSQFGQRIAQILITRNDIVDWTQYKNAQNTINEL 127

Query: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183
           L+MGVVPIVNENDTLSISEIKFGDNDTLSAIT+ALV AD+LFLLTDVDCLYT+NPRTNP+
Sbjct: 128 LKMGVVPIVNENDTLSISEIKFGDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPE 187

Query: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243
           AKPI++VP++ +G+PGV+TS+  +GS VGTGGM TKLIAADLATNAGV+TIIMKSD P N
Sbjct: 188 AKPILVVPDLAKGLPGVNTSSG-SGSDVGTGGMETKLIAADLATNAGVHTIIMKSDIPGN 246

Query: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303
           +  IV+Y+                    +   LD  K   Y           + DL SLQ
Sbjct: 247 ILKIVEYM--------------------QAQDLDTNKKQKY-----------QGDLSSLQ 275

Query: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363
           D EL  ++  +VPLHT F+A D  HHLKNREFWILHGLVT+G +IID+ AYN LT ++  
Sbjct: 276 DKELATLQSLHVPLHTTFIANDNLHHLKNREFWILHGLVTRGSVIIDQGAYNALTRKN-- 333

Query: 364 EEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423
                                   GLLP  +I+++G+FHELECVD+K+GKRLPNG+LDP+
Sbjct: 334 ----------------------KAGLLPVGIIDIEGTFHELECVDLKLGKRLPNGELDPN 371

Query: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
            PL+ VGRARCN+TS+EL+RIKGL  +++++ LGY  SEY AH++NLAFPP
Sbjct: 372 TPLQTVGRARCNYTSLELSRIKGLQSEQIEEELGYADSEYAAHRENLAFPP 422

>YDR300C (PRO1) [1128] chr4 complement(1061497..1062783) Glutamate
           5-kinase, carries out first step in proline biosynthesis
           pathway [1287 bp, 428 aa]
          Length = 428

 Score =  509 bits (1310), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/473 (54%), Positives = 325/473 (68%), Gaps = 54/473 (11%)

Query: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEM 61
           S TIVIKLG+SSLVDEKT+EPKL+IM+ +VETV++L+R GHK            L  M M
Sbjct: 9   SYTIVIKLGSSSLVDEKTKEPKLAIMSLIVETVVKLRRMGHKVIIVSSGGIAVGLRTMRM 68

Query: 62  DKKPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121
           +K+P                    W +LF Q+ ++IAQIL+TRNDIL WTQYKNAQNTI 
Sbjct: 69  NKRPKHLAEVQAIAAIGQGRLIGRWDLLFSQFDQRIAQILLTRNDILDWTQYKNAQNTIN 128

Query: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181
           +LL MGV+PIVNENDTLS+ EIKFGDNDTLSAIT+AL+ AD+LFLLTDVDCLYT+NPRTN
Sbjct: 129 ELLNMGVIPIVNENDTLSVREIKFGDNDTLSAITSALIHADYLFLLTDVDCLYTDNPRTN 188

Query: 182 PDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAP 241
           PDA PI++VP++ +G+PGV+T+   +GS VGTGGM TKL+AADLATNAGV+T+IMKSD P
Sbjct: 189 PDAMPILVVPDLSKGLPGVNTAGG-SGSDVGTGGMETKLVAADLATNAGVHTLIMKSDTP 247

Query: 242 SNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLS 301
           +N+  IV+Y+       L D+NK  +  +                           DL  
Sbjct: 248 ANIGRIVEYMQTLE---LDDENKVKQAYNG--------------------------DLTD 278

Query: 302 LQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNES 361
           LQ  E +++K  NVPLHT F+A D  HHLKNREFWILHGLV+KG ++ID+ AY  LT ++
Sbjct: 279 LQKREFEKLKALNVPLHTKFIANDNKHHLKNREFWILHGLVSKGAVVIDQGAYAALTRKN 338

Query: 362 GDEEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLD 421
                                     GLLP  VI+V+G+FHELECVDIKVGK+LP+G LD
Sbjct: 339 ------------------------KAGLLPAGVIDVQGTFHELECVDIKVGKKLPDGTLD 374

Query: 422 PDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
           PD PL+ VG+ARCN+TS EL +IKGL  D++++ LGY+ SEYVAH++NLAFPP
Sbjct: 375 PDFPLQTVGKARCNYTSSELTKIKGLHSDQIEEELGYNDSEYVAHRENLAFPP 427

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score =  493 bits (1270), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/476 (53%), Positives = 318/476 (66%), Gaps = 61/476 (12%)

Query: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEM 61
           + TIVIKLG+SSLVDE T+EPKLSIMT +VETV  LKR GHK            L+A+ +
Sbjct: 4   AYTIVIKLGSSSLVDESTKEPKLSIMTLIVETVTNLKRMGHKVIIVSSGGIAVGLDALNI 63

Query: 62  DKKPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121
             KP                    W+MLF QYGE+ AQIL+TRNDIL W QY NA+NTI 
Sbjct: 64  PHKPKQLSEVQAIAAVGQGRLIARWNMLFSQYGEQTAQILLTRNDILRWNQYNNARNTIN 123

Query: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181
           +LL MGV+PIVNENDTLSISEI+FGDNDTLSAITAALV AD LFLLTDVDCLYT+NPRTN
Sbjct: 124 ELLAMGVIPIVNENDTLSISEIEFGDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTN 183

Query: 182 PDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAP 241
           PDA+PIV+VP + +G+PGV+TS+  +GS VGTGGMRTKLIAADLA+NAG+ TI+MKSD P
Sbjct: 184 PDARPIVLVPELSEGLPGVNTSSG-SGSEVGTGGMRTKLIAADLASNAGIETIVMKSDRP 242

Query: 242 SNVKHIVDYL---VKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEED 298
             V  IVDY+    + P+ +                          G G       +++ 
Sbjct: 243 EYVPKIVDYIQHHFRPPRHI--------------------------GNG-------TQQQ 269

Query: 299 LLSLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLT 358
            L LQD EL++++  +VP+HT FLA D  H LKNREFWILHGL+TKG +IIDE++Y+ L 
Sbjct: 270 FLDLQDTELEQLRRYDVPMHTKFLANDNKHKLKNREFWILHGLITKGAIIIDENSYDKLL 329

Query: 359 NESGDEEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNG 418
           ++                            L P  VIEV+ +FHELECVD+K+G+RLPNG
Sbjct: 330 SKD------------------------MASLTPNAVIEVRDNFHELECVDLKIGQRLPNG 365

Query: 419 KLDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
           +LD   P++ VG  R N+TS+EL +IKGLP +++ DVLGY VSEYVAH++N+AFPP
Sbjct: 366 ELDISKPIQSVGCVRSNYTSLELAKIKGLPSEKIHDVLGYSVSEYVAHRENIAFPP 421

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score =  489 bits (1260), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 248/471 (52%), Positives = 319/471 (67%), Gaps = 56/471 (11%)

Query: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEMDK 63
           TIVIKLGTSSLVDEKT+EP+L+IM+ +VETV++L+R GH             L+ + M+K
Sbjct: 12  TIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVKLRRLGHNVVIVSSGSIGVGLHILGMEK 71

Query: 64  KPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123
           +P                    W  LF  +G+ IAQIL+TRNDIL W+QY+NAQNT+ +L
Sbjct: 72  RPKHLSEVQAIAAIGQSKLIGRWDSLFAHFGQSIAQILLTRNDILDWSQYRNAQNTVEEL 131

Query: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183
           L+MGVVPI+NENDTLS+ EIKFGDNDTLSAITA L+ AD+LFLLTDVDCLYT +PR++PD
Sbjct: 132 LKMGVVPIINENDTLSVQEIKFGDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPD 191

Query: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243
           AKPI+IVP++ +G+PGVDTS+  +GS VGTGGM+TKL+AA+LATNAGV+TIIMKSDAPSN
Sbjct: 192 AKPILIVPDLSKGLPGVDTSSG-SGSDVGTGGMQTKLVAAELATNAGVHTIIMKSDAPSN 250

Query: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303
           +  IV Y+     + L+D  + ++                            E DL+ LQ
Sbjct: 251 IYKIVKYI-----QSLHDTGEDNK--------------------------VFEGDLMKLQ 279

Query: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363
             E +++    VP HT FLA  I  HL+N+EFWILHGLVT G +IIDE AY  LT ++  
Sbjct: 280 LEEYEKLDRMGVPFHTKFLANSISRHLRNKEFWILHGLVTSGAVIIDEGAYKALTRKN-- 337

Query: 364 EEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423
                                   GLLP  VIE++GSFHE+ECVD+KVGKRLPNG+LDPD
Sbjct: 338 ----------------------KAGLLPVGVIEIEGSFHEMECVDLKVGKRLPNGELDPD 375

Query: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
            PL  VGRARCN+ S+E+++IKG   D +++ LGY  SEY+AH++N+AFPP
Sbjct: 376 YPLTIVGRARCNYPSLEISKIKGQQSDEIENELGYCNSEYIAHRENMAFPP 426

>Kwal_47.18187
          Length = 421

 Score =  480 bits (1236), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 247/474 (52%), Positives = 311/474 (65%), Gaps = 62/474 (13%)

Query: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEMDK 63
           TIVIKLG+SSLVDEKT+EPKL+ M  VVETV++L+R GH+            L  + +DK
Sbjct: 6   TIVIKLGSSSLVDEKTKEPKLATMAMVVETVVRLRRMGHRVVLVSSGGIAVGLKTLNLDK 65

Query: 64  KPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123
           +P                    W  LF Q+ ++IAQILITRNDI+ WTQYKNAQNTI +L
Sbjct: 66  RPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQNTIHEL 125

Query: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183
           L+MGVVPIVNENDTLS+SEIKFGDNDTLSAITAAL  AD+LFLLTDVDCLYT+NPRTNP+
Sbjct: 126 LQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNPRTNPN 185

Query: 184 AKPIVIVP---NMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDA 240
           AKPI++VP    M +G  GV TS+  +GS VGTGGM TKLIAA+LATNAGVNTIIMKS  
Sbjct: 186 AKPILVVPATSQMSEGTLGVKTSSG-SGSDVGTGGMTTKLIAAELATNAGVNTIIMKSAE 244

Query: 241 PSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLL 300
           PSN+  +V Y+                 Q+ E ++                   + +++ 
Sbjct: 245 PSNISKVVSYM-----------------QNCESIT-----------------GAAADNVE 270

Query: 301 SLQDAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNE 360
            LQ+ E+  ++E  VPLHT F+A +   HL NREFW+LHGLV+KG ++ID+ AY  LT +
Sbjct: 271 HLQEQEMLRLQENCVPLHTRFVADESQMHLSNREFWMLHGLVSKGAIVIDQGAYAALTRK 330

Query: 361 SGDEEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKL 420
           +                          GLLP  +IEV+G+FHE EC+D+KVG RL  G+L
Sbjct: 331 N------------------------KAGLLPAGLIEVEGNFHEHECIDLKVGSRLATGEL 366

Query: 421 DPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
           DP  P+  +GRARCN+TSVEL +IKGL  D++++VLGY  SEYVAH+ NLAFPP
Sbjct: 367 DPAMPVTTIGRARCNYTSVELCKIKGLQSDQIENVLGYADSEYVAHRGNLAFPP 420

>KLLA0C10296g 883644..884900 highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, start by similarity
          Length = 418

 Score =  478 bits (1231), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/470 (52%), Positives = 309/470 (65%), Gaps = 59/470 (12%)

Query: 5   IVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEMDKK 64
           IVIKLG+SSLVDE+T+EPKLSIM+ +VETV++L+R+GHK            L  M M  +
Sbjct: 7   IVIKLGSSSLVDEETKEPKLSIMSLIVETVVKLRRRGHKVIIVSSGGIAVGLKTMNMKGR 66

Query: 65  PTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQLL 124
           P                    W  LF ++ ++IAQILITRNDI+ WTQYKNAQNTI +LL
Sbjct: 67  PKKLSKVQAIAAVGQGRLIGRWDSLFSEFDQRIAQILITRNDIVDWTQYKNAQNTISELL 126

Query: 125 EMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDA 184
            MGVVPIVNENDTLS+SEIKFGDNDTLSAITAAL  AD+LFLLTDVDCLYT+NPR NPDA
Sbjct: 127 SMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALTGADYLFLLTDVDCLYTDNPRANPDA 186

Query: 185 KPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSNV 244
           KPI++VP++ QG+PGV+T +  +GS VGTGGM+TKLIAA+LATNAGV+TIIMKSD P N+
Sbjct: 187 KPILVVPDISQGLPGVNT-DGGSGSDVGTGGMKTKLIAAELATNAGVHTIIMKSDTPENI 245

Query: 245 KHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQD 304
             IV Y+               R+     L+                     +DL  LQ 
Sbjct: 246 SKIVLYM-------------QERDDGVNELT---------------------QDLADLQL 271

Query: 305 AELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGDE 364
            E++ +   +VPLHT F+A    HHLKNR+FW+LHGLV++G +IID  AY  LT ++   
Sbjct: 272 TEMQSLVNNHVPLHTRFIANSNHHHLKNRQFWMLHGLVSQGAVIIDIGAYEALTRKN--- 328

Query: 365 EHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPDA 424
                                  GLLP  VIEV+GSFHE EC+DIK+G R  +G LD   
Sbjct: 329 ---------------------KAGLLPAGVIEVQGSFHEHECIDIKLGVRDSDGNLDKSV 367

Query: 425 PLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
            L+ VGRARCN+TS EL++IKGL  D+++D+LGY  SEYVAH++NLAFPP
Sbjct: 368 ALKTVGRARCNYTSTELSKIKGLQSDQIEDILGYADSEYVAHRENLAFPP 417

>Scas_690.36
          Length = 424

 Score =  445 bits (1144), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 244/478 (51%), Positives = 305/478 (63%), Gaps = 64/478 (13%)

Query: 2   SQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEM 61
           S TIVIKLG+SSLVDE TREPKLS MTQ+VE V  LKR GHK            L+AM +
Sbjct: 4   SNTIVIKLGSSSLVDEVTREPKLSTMTQIVEIVSCLKRLGHKVVIVSSGGIAVGLDAMNL 63

Query: 62  DKKPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTIL 121
            KKP+                   W MLF+QY E+IAQIL+TR DI GWTQ+KNAQNTI 
Sbjct: 64  KKKPSQLSEIQAIAAIGQGKLIGRWEMLFRQYNEQIAQILLTRKDIFGWTQFKNAQNTIN 123

Query: 122 QLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTN 181
            LL+MGVVPIVNENDTLS+SEIKFGDNDTLSAIT+ALV+AD+LFLLTDVDCLYT+NP+ N
Sbjct: 124 ALLKMGVVPIVNENDTLSVSEIKFGDNDTLSAITSALVNADYLFLLTDVDCLYTDNPKVN 183

Query: 182 PDAKPIVIVPNM--DQGVPGVDT--SNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMK 237
            DAKPI+ V +M  D     +DT  S +D+GS++GTGGMRTK+ AADLATN G++TIIM 
Sbjct: 184 KDAKPILTVFDMHEDSISKVLDTCPSLSDSGSNIGTGGMRTKITAADLATNVGIHTIIMS 243

Query: 238 SDAPSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEE 297
           S  P+N+  I++Y+                   +  L +D         GGV S      
Sbjct: 244 SQTPANILKIIEYM------------------ETSNLKVD---------GGVCSN----- 271

Query: 298 DLLSLQDAELKEIKERNVPLHTVFLA-KDIDHHLKNREFWILHGLVTKGVLIIDEDAYNT 356
                 D ELK +   +VPLHT F+A ++ + +LKNREFWILHGLVTKG +IID+++Y  
Sbjct: 272 -----NDLELKNLIAHDVPLHTKFIANENSETYLKNREFWILHGLVTKGSIIIDKNSYKD 326

Query: 357 LTNESGDEEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLP 416
           L  +                           GLLP  +I+ +  FHELECV++KVG+RLP
Sbjct: 327 LLRKK----------------------EKCKGLLPISIIDTEDQFHELECVELKVGERLP 364

Query: 417 NGKLDPDAPLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
           NGK++  A L+ VGRARCN+TS E+N+IKGL  D++ + LGY  S YV H +NLA  P
Sbjct: 365 NGKVNRKAGLKVVGRARCNYTSYEINKIKGLKSDQIFETLGYGDSAYVVHNENLALTP 422

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 233/471 (49%), Positives = 298/471 (63%), Gaps = 60/471 (12%)

Query: 4   TIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKXXXXXXXXXXXXLNAMEMDK 63
           TIV+KLG+SSLVDE T EPKLSIM+ +VETV++L+R GHK            L  +  D+
Sbjct: 9   TIVLKLGSSSLVDESTLEPKLSIMSHIVETVVKLRRMGHKVVIVSSGCIAVGLKTVGTDR 68

Query: 64  KPTDXXXXXXXXXXXXXXXXXXWSMLFQQYGEKIAQILITRNDILGWTQYKNAQNTILQL 123
           +P                    W  LF+ + EKIAQIL+TRNDI+ W+QYKNAQNT  +L
Sbjct: 69  RPKKLSQLQAIAAVGQGRLIARWDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHEL 128

Query: 124 LEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPD 183
           L MGV PIVNENDTLSIS +KFGDNDTLSAITA L+ AD+LFL+TDVDCLYT+NPRTNPD
Sbjct: 129 LAMGVTPIVNENDTLSISGVKFGDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPD 188

Query: 184 AKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRTKLIAADLATNAGVNTIIMKSDAPSN 243
           AKPI++VP++ QG+P    +++ +GS VGTGGM TK++AADLATNAGV+TIIMKS+ P +
Sbjct: 189 AKPILVVPDLSQGLP-GVNTSSGSGSGVGTGGMATKILAADLATNAGVHTIIMKSERPVD 247

Query: 244 VKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQ 303
           +  IV+++               REQ +                          D  +LQ
Sbjct: 248 MVRIVEFM-------------EWREQCT----------------------AVSADAETLQ 272

Query: 304 DAELKEIKERNVPLHTVFLAKDIDHHLKNREFWILHGLVTKGVLIIDEDAYNTLTNESGD 363
             EL  ++E  VPLHT F+A      L  REFWILHGLV+ G +IID+ AY  LT ++  
Sbjct: 273 TDELNLLQEHGVPLHTRFIANVWQPSLNKREFWILHGLVSCGTVIIDKGAYKALTRKN-- 330

Query: 364 EEHVSEAYXXXXXXXXXXXXXXXHGLLPKDVIEVKGSFHELECVDIKVGKRLPNGKLDPD 423
                                   GLLP  VI V+GSFHELE VD+K+G R  +G LD  
Sbjct: 331 ----------------------KAGLLPAGVIAVEGSFHELEAVDLKIGVRKADGSLDES 368

Query: 424 APLEYVGRARCNFTSVELNRIKGLPVDRVQDVLGYDVSEYVAHKDNLAFPP 474
            PL+ VGRARCN++SVE+++IKGL   +++ VLGY  SEY+AH++NLAFPP
Sbjct: 369 EPLQTVGRARCNYSSVEVDKIKGLQSGQIETVLGYIDSEYIAHRENLAFPP 419

>Scas_715.44
          Length = 528

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 86  WSMLFQQYGEKIAQILITRNDILG-WTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIK 144
           ++ LFQ + EK+   + ++  ++  +T +         L+ MG++  V            
Sbjct: 184 YTFLFQAFKEKLQPFIESKERVIPVFTGF-------FGLVPMGLLNGVGR---------- 226

Query: 145 FGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185
            G  D  +A+ A  V+AD L +  +VD ++T +PR  P A+
Sbjct: 227 -GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score = 33.5 bits (75), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 86  WSMLFQQYGEKIAQILITRNDILG-WTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIK 144
           ++ L Q   EK+A  +  +  I+  +T +             G+VP      T  ++ + 
Sbjct: 188 YTFLVQALKEKLAPFVSAKERIVPVFTGF------------FGLVP------TGLLNGVG 229

Query: 145 FGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185
            G  D  +A+ A  V+AD L +  +VD ++T +PR  P+A+
Sbjct: 230 RGYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPEAR 270

>ADR106W [1847] [Homologous to ScYDL132W (CDC53) - SH]
           complement(894781..897177) [2397 bp, 798 aa]
          Length = 798

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 23/37 (62%)

Query: 123 LLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALV 159
           L +M ++ + NENDTLS  +I+ G N T   I  +++
Sbjct: 622 LFQMAILLMFNENDTLSFEQIQEGTNLTTQHIILSML 658

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 231 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 270

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 228 GYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQAR 267

>Kwal_47.18163
          Length = 522

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 146 GDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185
           G  D  +A+ A  ++AD L +  +VD ++T +PR  P A+
Sbjct: 228 GYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQAR 267

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 113 YKNAQNTILQLLEMG--VVPIVNENDTLS----ISEIKFGDNDTLSAITAALVSADHLFL 166
           +K A   +L+   +G  VVP++     L     ++ +  G  D  +A+ A  ++AD L +
Sbjct: 189 FKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVGLNADELQV 248

Query: 167 LTDVDCLYTENPRTNPDAK 185
             +VD ++T +PR  P A+
Sbjct: 249 WKEVDGIFTADPRKVPQAR 267

>CAGL0C04048g complement(399734..401596) similar to sp|P40549
           Saccharomyces cerevisiae YIL014w MNT3, hypothetical
           start
          Length = 620

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 213 TGGMRTKLIAADLATNAGVNTIIMKSDA--PSNVKHIVDYLVKYPKKVLYDDNKSSREQS 270
           T G++    A+ ++  + VN  ++ S+    S VK ++ +L K PK  L D N SS+ Q 
Sbjct: 47  TSGLKH---ASPVSPFSYVNNYLLNSEKTRSSTVKKLLPFLNK-PKDGLVDWNSSSKYQK 102

Query: 271 SEPLSLDQLKNHPYGKGGVISPPKSEEDLLSLQDAELKEIKERNVPLHTVFLAKDID 327
              L     K HP+     I      E   S++D  L+   ER       FL  DI+
Sbjct: 103 CLLLVKSMYKAHPHWSNRDIMTAYDNE---SVEDLNLQLAGERIKIYKQCFLDNDIE 156

>Sklu_2398.3 YKL218C, Contig c2398 4746-5708 reverse complement
          Length = 320

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 12/91 (13%)

Query: 233 TIIMKSDAPS-NVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSLDQLKNHPYGKGGVIS 291
           TI+M +DAP+  V+    Y       V YD     REQ    L+ +        KG  + 
Sbjct: 97  TIVMPNDAPAAKVRATAGYGANI---VRYDRYTEDREQIGRALAEE--------KGLTLV 145

Query: 292 PPKSEEDLLSLQDAELKEIKERNVPLHTVFL 322
           PP    D+++ Q    KE+ E    L  +F+
Sbjct: 146 PPYDHPDVIAGQGTAAKELIEEVGELDLLFV 176

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,727,702
Number of extensions: 633708
Number of successful extensions: 1426
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1397
Number of HSP's successfully gapped: 32
Length of query: 478
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 373
Effective length of database: 12,961,219
Effective search space: 4834534687
Effective search space used: 4834534687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 63 (28.9 bits)