Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D01650g33533017570.0
Scas_667.2033832613150.0
YPR056W (TFB4)33833312831e-179
Kwal_27.1259033833112281e-170
Sklu_1926.434533312141e-168
ADL323C34132711821e-163
KLLA0B08569g33733910901e-149
KLLA0F09526g33751710.61
YMR282C (AEP2)58061654.0
Kwal_27.1196439164636.8
YOR254C (SEC63)663174629.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D01650g
         (330 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D01650g complement(172035..173042) highly similar to tr|Q12...   681   0.0  
Scas_667.20                                                           511   0.0  
YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II t...   498   e-179
Kwal_27.12590                                                         477   e-170
Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement        472   e-168
ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH] (127631..12...   459   e-163
KLLA0B08569g complement(756558..757571) similar to sgd|S0006260 ...   424   e-149
KLLA0F09526g 875250..876263 weakly similar to sp|P53012 Saccharo...    32   0.61 
YMR282C (AEP2) [4236] chr13 complement(833355..835097) Protein r...    30   4.0  
Kwal_27.11964                                                          29   6.8  
YOR254C (SEC63) [5042] chr15 complement(805031..807022) Componen...    28   9.9  

>CAGL0D01650g complement(172035..173042) highly similar to tr|Q12004
           Saccharomyces cerevisiae YPR056w TFB4, start by
           similarity
          Length = 335

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/330 (100%), Positives = 330/330 (100%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF
Sbjct: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE 120
           LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE
Sbjct: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE 120

Query: 121 TLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCGS 180
           TLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCGS
Sbjct: 121 TLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCGS 180

Query: 181 SREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTNG 240
           SREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTNG
Sbjct: 181 SREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTNG 240

Query: 241 IIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPGN 300
           IIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPGN
Sbjct: 241 IIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPGN 300

Query: 301 KCPACDSQFDERVIAKLKKKPVVPKSTLKK 330
           KCPACDSQFDERVIAKLKKKPVVPKSTLKK
Sbjct: 301 KCPACDSQFDERVIAKLKKKPVVPKSTLKK 330

>Scas_667.20
          Length = 338

 Score =  511 bits (1315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/326 (72%), Positives = 281/326 (86%), Gaps = 1/326 (0%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAIADP FQ TK+RS+ TE+ PSLLTV++DI+P+LWAE D    EK ++  VLKSL+VF
Sbjct: 1   MDAIADPTFQHTKVRSSITEETPSLLTVIVDITPKLWAELDEEINEKGNLINVLKSLLVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE 120
           LN+HLAFNS+NQVAVIAA SQGI+YL+P++S + +      KDLSII+  MYRRFRNVDE
Sbjct: 61  LNAHLAFNSSNQVAVIAAHSQGIKYLFPKNSISVKGVNSGKKDLSIINKDMYRRFRNVDE 120

Query: 121 TLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCGS 180
           TL++E Y L++ E   ++   QKSTLSGAM+A LTY NR+TKE E+ISL+SRL+V+TCG 
Sbjct: 121 TLVDELYALFEEELKQVNTVTQKSTLSGAMSAGLTYINRVTKELEAISLKSRLMVLTCGG 180

Query: 181 SRE-KDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTN 239
             E KDEIFQYIPIMNCIFSATK+KCPIDV+KIGG+K+STFLQQTTDATNG Y+H+EST 
Sbjct: 181 KGESKDEIFQYIPIMNCIFSATKIKCPIDVVKIGGSKESTFLQQTTDATNGAYLHVESTK 240

Query: 240 GIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPG 299
           G+IQYL+TAM IDPSLRQIIV+P  GSVDFRTSCYLTGKVVA+G+ICSVCLCVLSIIPPG
Sbjct: 241 GLIQYLATAMFIDPSLRQIIVKPNHGSVDFRTSCYLTGKVVAVGFICSVCLCVLSIIPPG 300

Query: 300 NKCPACDSQFDERVIAKLKKKPVVPK 325
           NKCPACDS+FDE VIAKLKKKPVVP+
Sbjct: 301 NKCPACDSEFDEHVIAKLKKKPVVPR 326

>YPR056W (TFB4) [5486] chr16 (671121..672137) RNA polymerase II
           transcription initiation factor TFIIH (factor b), 37 kDa
           subunit [1017 bp, 338 aa]
          Length = 338

 Score =  498 bits (1283), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 232/333 (69%), Positives = 278/333 (83%), Gaps = 3/333 (0%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAI+DP F+  + R   TE+ PSLLTV+++I+P+LW  FD    EK S+  VL++LIVF
Sbjct: 1   MDAISDPTFKHARSRKQVTEESPSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDT---SEQNAGNSKDLSIISSHMYRRFRN 117
           LN+HLAFNSAN+VAVIAA+SQGI+YLYP S+     SE       DL II+S MYRRFRN
Sbjct: 61  LNAHLAFNSANKVAVIAAYSQGIKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRN 120

Query: 118 VDETLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVIT 177
           VDETL+EE YKL++ E+  I++  Q+STL+GAM+A LTY NR++KE  + SL+SRLLV+T
Sbjct: 121 VDETLVEEIYKLFELEKKQIEQNSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLT 180

Query: 178 CGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLES 237
           CGS   KDEIFQYIPIMNCIFSATK+KCPIDV+KIGG+K+STFLQQTTDATNGVY+H+ES
Sbjct: 181 CGSGSSKDEIFQYIPIMNCIFSATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVES 240

Query: 238 TNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIP 297
           T G+IQYL+TAM IDPSLR IIV+P  GSVDFRTSCYLTG+VVA+G+ICSVCLCVLSIIP
Sbjct: 241 TEGLIQYLATAMFIDPSLRPIIVKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIP 300

Query: 298 PGNKCPACDSQFDERVIAKLKKKPVVPKSTLKK 330
           PGNKCPACDSQFDE VIAKLK+KPVVP+   KK
Sbjct: 301 PGNKCPACDSQFDEHVIAKLKRKPVVPRLKAKK 333

>Kwal_27.12590
          Length = 338

 Score =  477 bits (1228), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 223/331 (67%), Positives = 272/331 (82%), Gaps = 1/331 (0%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAI+DP+FQ TK +    E++PSLLTV++D  P++WAE D    ++ S+ + L+SLIVF
Sbjct: 1   MDAISDPSFQNTKSKIAVAEELPSLLTVIVDTMPKVWAELDKEGSQEGSLISALQSLIVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMYRRFRNVDE 120
           LN+HL+FNSANQVAVIAA S GI+YL+P    + E+ A  S DLSII+S+MYR+FRNVDE
Sbjct: 61  LNAHLSFNSANQVAVIAAHSTGIKYLFPTPPSSQEEPAAKSPDLSIINSNMYRQFRNVDE 120

Query: 121 TLIEEFYKLYQREESL-IDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRSRLLVITCG 179
           T++EE YKL Q E+   I    QKSTLSGAM+A  TY NR+ KE  + SL++RL+V+TCG
Sbjct: 121 TVLEELYKLLQDEKKRKIPSGFQKSTLSGAMSAGFTYINRVIKEQSTASLKARLMVMTCG 180

Query: 180 SSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLESTN 239
           SS  KDEIFQYIPIMNCIFSATKLKCPIDV+KIGG+++STFLQQ TDATNGVY+H+ ST 
Sbjct: 181 SSGGKDEIFQYIPIMNCIFSATKLKCPIDVVKIGGSQESTFLQQATDATNGVYLHVPSTE 240

Query: 240 GIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSIIPPG 299
           G+IQYL+TAM IDPSLR I+V+P QGSVDFRTSCYLTGKVVA+G++CSVCLCVLSIIPPG
Sbjct: 241 GLIQYLTTAMFIDPSLRPIVVKPNQGSVDFRTSCYLTGKVVAVGFVCSVCLCVLSIIPPG 300

Query: 300 NKCPACDSQFDERVIAKLKKKPVVPKSTLKK 330
           NKCPACDS+FDE V  KLK++PVVP    KK
Sbjct: 301 NKCPACDSEFDEHVTTKLKRRPVVPGIAAKK 331

>Sklu_1926.4 YPR056W, Contig c1926 2998-4035 reverse complement
          Length = 345

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 220/333 (66%), Positives = 276/333 (82%), Gaps = 9/333 (2%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAI+D  FQ TK +++ TE+ PSLLTVV+D +P+LWAE D  S  K ++ + L+SLIVF
Sbjct: 1   MDAISDSTFQNTKSKTSITEENPSLLTVVVDTTPKLWAELDKESNSKGNLISALQSLIVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAG------NSKDLSIISSHMYRR 114
           LN+HLAFN++NQVAVIAA S G++YLYP+++ T    A         KDLSII++ MYR+
Sbjct: 61  LNAHLAFNNSNQVAVIAAHSTGLKYLYPKTATTEGTGASSSSVVSGRKDLSIINNDMYRQ 120

Query: 115 FRNVDETLIEEFYKLYQREE---SLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRS 171
           FRNVDET++EE YKL+Q+E+   +     V +STLSGA++A LTY NR+ KE E+I+L+S
Sbjct: 121 FRNVDETVVEELYKLFQQEKEENNSTSNGVGRSTLSGAISAGLTYINRVNKENENITLKS 180

Query: 172 RLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGV 231
           RLLV TCGSS  +DEIFQYIPIMNCIF+ATK+KCPIDV+KIGG ++STFLQQ TDATNGV
Sbjct: 181 RLLVTTCGSSGGRDEIFQYIPIMNCIFTATKMKCPIDVVKIGGVQESTFLQQATDATNGV 240

Query: 232 YIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLC 291
           Y+H++ST G+IQYL TAM IDPSLR +IV+P QGSVDFRTSC+LTG+VVA+G++CSVCLC
Sbjct: 241 YLHVDSTEGLIQYLCTAMFIDPSLRHVIVKPNQGSVDFRTSCFLTGRVVAVGFVCSVCLC 300

Query: 292 VLSIIPPGNKCPACDSQFDERVIAKLKKKPVVP 324
           VLSIIPPGNKCPACD++FDERVI KLK+KPVVP
Sbjct: 301 VLSIIPPGNKCPACDAEFDERVITKLKRKPVVP 333

>ADL323C [1418] [Homologous to ScYPR056W (TFB4) - SH]
           (127631..128656) [1026 bp, 341 aa]
          Length = 341

 Score =  459 bits (1182), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 215/327 (65%), Positives = 267/327 (81%), Gaps = 4/327 (1%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEKQSVTTVLKSLIVF 60
           MDAIAD  FQ  K +    E+ PSLLT+V+D +P+LWAEFD   G+K  +  VLKS IVF
Sbjct: 1   MDAIADSTFQINKSKVQLVEETPSLLTLVIDTNPKLWAEFDREVGKKGQLMQVLKSTIVF 60

Query: 61  LNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDT-SEQNAGNSKDLSIISSHMYRRFRNVD 119
           LN+HL+FN++NQV+VIAA S+GI+YLYP++ D         S+D SII+ +MYR FRNVD
Sbjct: 61  LNAHLSFNNSNQVSVIAACSRGIKYLYPQADDKEGSTKKKKSEDRSIINRNMYRGFRNVD 120

Query: 120 ETLIEEFYKLYQREESLIDKPVQ---KSTLSGAMAAALTYTNRLTKEFESISLRSRLLVI 176
           E ++EE Y+++Q+E   ++  V    +STLSGAM+A LTY NR+T E E +SL+SRLLVI
Sbjct: 121 EAVVEELYRVFQQESKQLEDGVPQPFRSTLSGAMSAGLTYINRITHETEGVSLKSRLLVI 180

Query: 177 TCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGVYIHLE 236
           TCGSS  KDE+FQYIPIMNCIFSATK+KCPIDV+K+GG K+STFLQQ TDATNG Y+H+ 
Sbjct: 181 TCGSSASKDEVFQYIPIMNCIFSATKMKCPIDVVKVGGVKESTFLQQATDATNGNYLHVA 240

Query: 237 STNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLCVLSII 296
           +T+G+IQYLSTAM IDPSLRQ +V+P Q SVDFRTSCYLTGKVVAIG++CSVCLCVLSII
Sbjct: 241 NTDGLIQYLSTAMFIDPSLRQWVVKPNQSSVDFRTSCYLTGKVVAIGFVCSVCLCVLSII 300

Query: 297 PPGNKCPACDSQFDERVIAKLKKKPVV 323
           PPGNKCPACDS+FDE+V+AKL +KPV+
Sbjct: 301 PPGNKCPACDSEFDEKVVAKLSRKPVI 327

>KLLA0B08569g complement(756558..757571) similar to sgd|S0006260
           Saccharomyces cerevisiae YPR056w TFB4 component of RNA
           polymerase transcription initiation TFIIH factor, start
           by similarity
          Length = 337

 Score =  424 bits (1090), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 204/339 (60%), Positives = 259/339 (76%), Gaps = 17/339 (5%)

Query: 1   MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRSGEK--------QSVTT 52
           MDAIAD  FQ TK ++   ED PSLLTVV+D S   W +   +            + +  
Sbjct: 1   MDAIADTVFQGTKSKTQEIEDTPSLLTVVVDTSIHSWVQLTKQQSGSGSEGSSGEKQLIE 60

Query: 53  VLKSLIVFLNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMY 112
            LKS++VFLN+HLAFNS NQV +IAA S+G++YLYP        +A +   +S++SS MY
Sbjct: 61  ALKSIVVFLNAHLAFNSGNQVCLIAAHSEGMKYLYP--------SADSKPSMSMVSSDMY 112

Query: 113 RRFRNVDETLIEEFYKLYQRE-ESLIDKPVQKSTLSGAMAAALTYTNRLTKEFESISLRS 171
           R FRNVDE ++E++Y+L++ E E    K   KS+LSGAM++ALTY NR+ KE E+ SLRS
Sbjct: 113 RGFRNVDEIVVEQWYRLFKEELEGQESKVSMKSSLSGAMSSALTYVNRILKENENTSLRS 172

Query: 172 RLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQTTDATNGV 231
           RLLVITCG+S+ KDEIFQYIPIMNCIFSATK+KC IDV+KIGG  +STFLQQ TDAT+GV
Sbjct: 173 RLLVITCGTSQGKDEIFQYIPIMNCIFSATKMKCSIDVVKIGGGIESTFLQQATDATSGV 232

Query: 232 YIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLTGKVVAIGYICSVCLC 291
           Y+H+E+T G+IQYLSTAM IDPSLR +I++P QGSVDFRTSC+LTGKVVA+G++CSVCLC
Sbjct: 233 YLHVENTRGLIQYLSTAMFIDPSLRNVIIKPNQGSVDFRTSCFLTGKVVAVGFVCSVCLC 292

Query: 292 VLSIIPPGNKCPACDSQFDERVIAKLKKKPVVPKSTLKK 330
           VLS+IPPG KCPACDS FD ++IA+L++KPV+     KK
Sbjct: 293 VLSVIPPGQKCPACDSPFDSKIIARLRRKPVLSNGVPKK 331

>KLLA0F09526g 875250..876263 weakly similar to sp|P53012
           Saccharomyces cerevisiae YGL126w SCS3 inositol
           phospholipid synthesis protein singleton, start by
           similarity
          Length = 337

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 172 RLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQ 222
           R L++T        E+F   P+M+ +F  +   C  D+    GN+Q+  LQ
Sbjct: 64  RYLLLTLWWMIFTQEVFGLTPLMDLVFLNSGGICSFDIFSTDGNEQTLNLQ 114

>YMR282C (AEP2) [4236] chr13 complement(833355..835097) Protein
           required for the expression of Atp9p [1743 bp, 580 aa]
          Length = 580

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 77  AAFSQGIQYLYPRSSDTSEQNAGNSKDLSIISSHMY-RRF------RNVDETLIEEFYKL 129
           + FS+ I YL+ ++ D   ++  + +DLS + S +Y +RF      R+++    E ++KL
Sbjct: 114 SEFSKSISYLFAKTVDPEPKDVLSLEDLSFLLSKLYTQRFQIRRICRDINAKYSEFWFKL 173

Query: 130 Y 130
           +
Sbjct: 174 F 174

>Kwal_27.11964
          Length = 391

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 217 QSTFLQQTTDATNGVYIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLT 276
           +S F+   ++ T  + +HL  T GI+Q L ++++ D  LR ++V+  + S+ F     L 
Sbjct: 178 ESIFISALSNLTAEMKVHLTVTRGILQDLESSITRD-KLRFLLVQNKKLSI-FNKKSMLI 235

Query: 277 GKVV 280
           G+++
Sbjct: 236 GEMI 239

>YOR254C (SEC63) [5042] chr15 complement(805031..807022) Component
           of ER protein-translocation subcomplex, which includes
           Sec62p, Sec63p, Sec66p, and Sec72p, member of DnaJ
           protein family [1992 bp, 663 aa]
          Length = 663

 Score = 28.5 bits (62), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 68/174 (39%), Gaps = 19/174 (10%)

Query: 168 SLRSRLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQSTFLQQT--- 224
           SL   LL I CG  R  D     I    CI  A  L     ++++    +  F+ +T   
Sbjct: 331 SLLHGLLDIACGF-RNLDIALGAINTFKCIVQAVPLTPNCQILQLPNVDKEHFITKTGDI 389

Query: 225 ---------TDATNGVYIHLESTNGIIQYLSTAMSIDPSLRQI---IVRPTQGSVDFRTS 272
                     DA  G  + ++    + + L  A  I P+L+ I    + P +  V   ++
Sbjct: 390 HTLGKLFTLEDAKIGEVLGIKDQAKLNETLRVASHI-PNLKIIKADFLVPGENQVTPSST 448

Query: 273 CYLTGKVVAIGYICSVCLCVLSIIPPGNKCPACDSQFDERVIAKLKKKPVVPKS 326
            Y++ KV+         L   S+IP  N     D +      A + K+P+VP S
Sbjct: 449 PYISLKVLVRS--AKQPLIPTSLIPEENLTEPQDFESQRDPFAMMSKQPLVPYS 500

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,043,649
Number of extensions: 404966
Number of successful extensions: 1310
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1314
Number of HSP's successfully gapped: 19
Length of query: 330
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 228
Effective length of database: 13,065,073
Effective search space: 2978836644
Effective search space used: 2978836644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)