Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D01628g36035519120.0
Scas_667.213593635493e-67
YPR057W (BRR1)3413514621e-54
ADL325C3223383704e-41
Sklu_1926.33553483024e-31
Kwal_27.125963493532612e-25
KLLA0B08525g3263412576e-25
Kwal_26.821450259701.1
KLLA0E07744g533161691.5
Kwal_33.1489968554672.8
YNL182C (IPI3)55595628.9
AAL083W169848639.3
Kwal_23.61391319108629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D01628g
         (355 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99...   741   0.0  
Scas_667.21                                                           216   3e-67
YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in...   182   1e-54
ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH] (126156..12...   147   4e-41
Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement        120   4e-31
Kwal_27.12596                                                         105   2e-25
KLLA0B08525g complement(754935..755915) weakly similar to sgd|S0...   103   6e-25
Kwal_26.8214                                                           32   1.1  
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...    31   1.5  
Kwal_33.14899                                                          30   2.8  
YNL182C (IPI3) [4418] chr14 complement(295960..297627) Protein c...    28   8.9  
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    29   9.3  
Kwal_23.6139                                                           28   9.7  

>CAGL0D01628g complement(170546..171628) weakly similar to tr|Q99177
           Saccharomyces cerevisiae YPR057w BRR1 involved in snRNP
           biogenesis, hypothetical start
          Length = 360

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/355 (100%), Positives = 355/355 (100%)

Query: 1   MAGRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAISH 60
           MAGRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAISH
Sbjct: 1   MAGRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAISH 60

Query: 61  QIGQVSKNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGC 120
           QIGQVSKNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGC
Sbjct: 61  QIGQVSKNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGC 120

Query: 121 YVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEI 180
           YVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEI
Sbjct: 121 YVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEI 180

Query: 181 DEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMID 240
           DEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMID
Sbjct: 181 DEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMID 240

Query: 241 SSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAK 300
           SSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAK
Sbjct: 241 SSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAK 300

Query: 301 QAREILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQH 355
           QAREILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQH
Sbjct: 301 QAREILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQH 355

>Scas_667.21
          Length = 359

 Score =  216 bits (549), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 204/363 (56%), Gaps = 28/363 (7%)

Query: 3   GRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAISHQI 62
           G+N N  ++       A++P+FGQA AF + +  V+P V  YL +VR EAL T  +S + 
Sbjct: 5   GQNENLTERQ------AVNPLFGQAPAFAVQNSLVDPAVVRYLQDVRKEALRTTVVSIKP 58

Query: 63  GQVSKNTFDANIYDDEDDSTSIPSDTKVKS---------DQITEYLYSIENWYKWFENIS 113
            + ++    A++YDD+DD   +P+ T  K          DQ+  +  ++ +W KWFE   
Sbjct: 59  QKRARPVVTASMYDDDDDE--LPTLTARKKGRNSAYEFPDQLIYFDRNMNDWIKWFECTK 116

Query: 114 DIIWHGCYVFEGYDDESISHLTQLLRFYLQ-KKIDENRASSFDRHLVNIFRDQLKCSDPD 172
           +I+    Y F GYDD +++ L   L+ Y++ K  DE++ SS    L+ I  D+      D
Sbjct: 117 NIVQEKAYEFTGYDDNTLNILLCQLKQYMETKSKDEDKLSS----LIGIISDEC-IETTD 171

Query: 173 PVNGTLEIDEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTH 232
             + +LEIDE WAE + + +++  IK+++ +K C+  +    P+G K W KY+ SN P H
Sbjct: 172 SSDHSLEIDETWAETMCEKLQSRAIKNISEIKDCV-LETPMEPYGFKAWYKYLISNVPVH 230

Query: 233 TAFINMIDSSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQM 292
           T F+ MI+  N+W L+ Y  Q  L+EIY  GKN     +L +WLL I++H+P  +TAE  
Sbjct: 231 TCFVTMINDRNVWILIQYFQQGLLEEIYKRGKN---ASVLEEWLLEIMIHLPVNITAEYT 287

Query: 293 SNIRSLAKQAREILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKY 352
           S +R L K+ + ++ R++ S+    T + +P EL E +      N+ I  L+L+++ + Y
Sbjct: 288 STLRDLGKKCQVLIKRQIESS-SAKTLLRLPKELEELDIKAPQQNVSIFELVLSIIAKIY 346

Query: 353 GQH 355
           GQ 
Sbjct: 347 GQR 349

>YPR057W (BRR1) [5487] chr16 (672466..673491) Protein involved in
           snRNP biogenesis [1026 bp, 341 aa]
          Length = 341

 Score =  182 bits (462), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 179/351 (50%), Gaps = 25/351 (7%)

Query: 13  KEALSSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAIS--HQIGQVSKNTF 70
           K   S A D +FGQ++AF ++D  VNP V  YL  VR EAL TNAIS  + +    +   
Sbjct: 2   KRGESQAPDAIFGQSRAFALSDSSVNPDVIEYLKSVRQEALRTNAISIKNHMNLQKRTRH 61

Query: 71  DANIYDDEDDSTSIPSDTKVKSDQITEYLY----SIENWYKWFENISDIIWHGCYVFEGY 126
            +++YDDED+         +K   I+  L     ++E W +WF ++   +    Y F GY
Sbjct: 62  KSSMYDDEDEGA-------LKRHAISPSLIRLQRNVEIWVRWFNSVKATVLTNAYEFTGY 114

Query: 127 DDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAE 186
           +DE++  L   L+ YL+   D     +    ++++          +     L+IDE+WA+
Sbjct: 115 EDETLDLLLLFLKNYLE---DMPSKCTTVEKIISVLNQHSFPEKAEEKEENLQIDEEWAK 171

Query: 187 NLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSNLWT 246
           N+L  +  +KI  +  VK  I    K    G   W +Y+ +N+P HT F   I S  LW 
Sbjct: 172 NILVRLEKTKIDSVEDVKKVITEGDKHELVGYNQWFQYLINNEPQHTTFHEKITSKQLWV 231

Query: 247 LVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREIL 306
           L+ YM+  W+KEI+  G++  R   L  WL YIL+H P R+TAE  S +R L K+  E++
Sbjct: 232 LIKYMSNTWIKEIHKKGRHYRR---LQDWLFYILVHTPERVTAEYTSILRDLGKKCLELI 288

Query: 307 NRR-VNSNIFGTTNIVIPDELHEHNC--PPCPPNLDIASLILAVVTRKYGQ 354
            ++ V ++      I +P E+ E N   P    N+ I  L ++V+   YGQ
Sbjct: 289 QKKPVEAH---ENKITLPKEMAELNVEIPAAVENMTITELTVSVIAVNYGQ 336

>ADL325C [1416] [Homologous to ScYPR057W (BRR1) - SH]
           (126156..127124) [969 bp, 322 aa]
          Length = 322

 Score =  147 bits (370), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/338 (30%), Positives = 172/338 (50%), Gaps = 26/338 (7%)

Query: 17  SSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAISHQIGQVSKNTFDANIYD 76
           S  +DPVFGQ + F+ +  EVNP V  YL+ VR+EALHT  +      + K   + + YD
Sbjct: 5   SGPVDPVFGQCQVFDCSAAEVNPEVVKYLAHVRDEALHTVGVVPSASNLRKRKIEIS-YD 63

Query: 77  DEDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGCYVFEGYDDESISHLTQ 136
           DE +    PS+     ++  E  + ++    WF+ + +        FEGYD+E+++ L  
Sbjct: 64  DE-EVVKRPSE----GEKAIELPFDMDEVISWFDQVKEDALSEREAFEGYDEETLNTLLV 118

Query: 137 LLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLKTMRNSK 196
            +R Y+      +R SS D    N+ +  L+   P   N  LE+DE WA  L+  +   K
Sbjct: 119 GIRDYI------SRMSSRDESTNNLIK-LLEGVQPVVTNEALELDEKWAAKLVARLGRRK 171

Query: 197 IKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSNLWTLVMYMTQIWL 256
              L+ +K  + T     P   K W  ++  N+P+H  F + ++S+ L+ L+ Y+T   +
Sbjct: 172 FTTLDNLKLRLNTQLP-IPTRAKAWKIHIPINEPSH-EFFHRMNSTQLFDLLRYLTDNIV 229

Query: 257 KEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREILNRRVNSNIFG 316
           +   T     +      QWL+Y+LLH+P +LTA ++S +R L+K+ R ++   ++  I  
Sbjct: 230 EHYQT-----DSATDYGQWLVYLLLHLPRQLTANEISEVRGLSKKVRALI---IDHEILK 281

Query: 317 TTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQ 354
              +++P E+   +  P P  ++   L LAVV   YGQ
Sbjct: 282 LP-MLLPSEI--EDVSPIPRGVNPLHLALAVVAVIYGQ 316

>Sklu_1926.3 YPR057W, Contig c1926 1476-2543 reverse complement
          Length = 355

 Score =  120 bits (302), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 99/348 (28%), Positives = 163/348 (46%), Gaps = 20/348 (5%)

Query: 17  SSAIDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAI----SHQIGQVSKNTFDA 72
           + + DPVFGQ++AF +N   VNP   SYL+ VR EAL T+ I    S  + +    + + 
Sbjct: 14  TQSTDPVFGQSRAFALNGTLVNPDAVSYLNSVRKEALRTSGIDVTRSVDVKKTRAQSHNT 73

Query: 73  NIYDDEDDSTSIPSDTKVKSDQITEYLYSI-ENWYKWFENISDIIWHGCYVFEGYDDESI 131
           +   +E            KS+Q+ ++   + E+  +     S         F GYD E++
Sbjct: 74  DFCGEEPILNRELIKCNRKSNQLLQWFLELREHLVEQRLEDSREQQENAQEFSGYDIETL 133

Query: 132 SHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLKT 191
           + L    + YL+ +  +N+  +    L+ I +D     +    + +L IDE WAE LL  
Sbjct: 134 NLLVHYFKNYLRGR--DNKDDTVVELLLEILKDFPSIKE----DQSLAIDEAWAEKLLDQ 187

Query: 192 MRNSKIKDLNTVKYCIRTDYKRA---PHGLKPWAKYVTSNQPTHTAFINMIDSSNLWTLV 248
           +R+  + ++  +K  I    K +   P   K W  ++  N+P+   F  +     L  L+
Sbjct: 188 LRSKTVNNVEELKEAINKPAKASVEFPKNAKGWHSHINKNEPSSKVFTRLTLDQKL-KLI 246

Query: 249 MYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREILNR 308
            YMTQ WL   +T G +    + +SQW LY LL IP  L A  +S +R L K+A+++  R
Sbjct: 247 GYMTQ-WLN--HTVG-DQSNARQISQWCLYTLLSIPEYLPAPHISILRELGKKAKQLKLR 302

Query: 309 RVNSNIFGTTNIVIPDELHEHNC-PPCPPNLDIASLILAVVTRKYGQH 355
               NI      V  + + ++      P    I  L+L VV++ YGQ 
Sbjct: 303 SCQENIALLPLTVSSEMIGKYTTDSTVPQESSITDLVLVVVSKIYGQR 350

>Kwal_27.12596
          Length = 349

 Score =  105 bits (261), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 101/353 (28%), Positives = 166/353 (47%), Gaps = 53/353 (15%)

Query: 20  IDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAI--SHQIGQVSKNTFDANIYDD 77
           IDPVFGQ +AF +    VNP V+ YL  VR +AL T A   S++    +K    +++YD+
Sbjct: 23  IDPVFGQGRAFALEGDLVNPEVQQYLKTVRTQALTTLAARPSNRGRHDTKVNRTSDLYDE 82

Query: 78  EDDSTSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGCYVFEGYDDESISHLTQL 137
           E     IP        +++ +     +W KWF  +            GYD    S +  L
Sbjct: 83  E---PLIPP-------ELSRFNRYKSSWLKWFNELKRSKDAHTAPAPGYD----SAMLNL 128

Query: 138 LRFYLQKKIDENRASS------FDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLKT 191
           L FY ++ + E +A++       DR ++ I +D     + +  + TLEIDE+WA+ +L+ 
Sbjct: 129 LVFYFKQYLQELKAAASESDADLDR-ILTILQDH----NVEKQDSTLEIDEEWAKGILQQ 183

Query: 192 MRNSK--------IKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSN 243
           +++SK        +KD  +    +       P     W   VT  +PT   F  M  S  
Sbjct: 184 LKSSKSQVSSVSDLKDFISKPAPL-------PKNFNGWYYCVTKTEPTCALFERM--SPE 234

Query: 244 L-WTLVMYMTQIWLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQA 302
           L + L  Y+ Q WL ++       ++   ++ W+LY  L +  +L A+++S +R L K+A
Sbjct: 235 LTFKLASYLNQ-WLGDV----SKDKKASRITAWILYTFLFLGDQLPAQEVSVLRDLGKKA 289

Query: 303 REILNRRVNSNIFGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQH 355
           R+ +    + +      IV P ++  +  PP P  L    LIL +V  KYGQ 
Sbjct: 290 RQ-MKLNCSDSADALPKIVQPSDMSFYKDPPQP--LSAIDLILVLVAFKYGQR 339

>KLLA0B08525g complement(754935..755915) weakly similar to
           sgd|S0006261 Saccharomyces cerevisiae YPR057w BRR1
           involved in snRNP biogenesis, start by similarity
          Length = 326

 Score =  103 bits (257), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 92/341 (26%), Positives = 162/341 (47%), Gaps = 36/341 (10%)

Query: 20  IDPVFGQAKAFNINDPEVNPLVKSYLSEVRNEALHTNAI--SHQIGQVSKNTFDANIYDD 77
           +DPVFGQ  AF +ND  V+P V  YL +VRNEAL  + +  + +  Q S N  +  +  D
Sbjct: 11  LDPVFGQHSAFALNDEGVSPNVIRYLLDVRNEALSNSPLYSTSRTEQNSHNVVETGLVAD 70

Query: 78  EDD---STSIPSDTKVKSDQITEYLYSIENWYKWFENISDIIWHGCYVFEGYDDESISHL 134
             D   + SI  D++  ++ I E    +E      E+ SD I         Y D+ +  L
Sbjct: 71  TSDLLNARSILEDSEAINEWINEIRKEMEPLE---ESPSDSI---------YTDDMLDLL 118

Query: 135 TQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDWAENLLKTMRN 194
              ++ YL +  +E      +  +  + R  L  ++P+      +I  +  ++++  +RN
Sbjct: 119 VSEIKKYLDQHPEE-----INDPVRRVTRSVLPIANPE-----YDISTETVQSMVAKLRN 168

Query: 195 SKIKDLNTVKYCIRTDYKRAPHGLKPWAKYVTSNQPTHTAFINMIDSSNLWTLVMYMTQI 254
            +  D++ +K  I       P   + W  ++  N+PT   F+  ++  +L  ++ +M Q 
Sbjct: 169 KRFSDVSFLKRYINRPMP-IPTNFRQWFGHIKHNEPTR-QFMLRLEFDDLMKILGFMIQ- 225

Query: 255 WLKEIYTFGKNLERKKMLSQWLLYILLHIPTRLTAEQMSNIRSLAKQAREILNRRVNSNI 314
           W+  I    KN    K L QWLLYI + +P  L + Q+S +R L ++ +  L    NS I
Sbjct: 226 WINSI---TKNKPDSKQLQQWLLYIWIFMPNELLSPQISQLRDLGRKCQLSLIAASNSKI 282

Query: 315 FGTTNIVIPDELHEHNCPPCPPNLDIASLILAVVTRKYGQH 355
              T++ +P E+ +   P     L+   + LAV+  ++GQ 
Sbjct: 283 ---TSLTMPTEIRDIPFPNQRDQLNAIEITLAVIAHRFGQR 320

>Kwal_26.8214
          Length = 502

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 7/59 (11%)

Query: 82  TSIPSDTKVKSDQITEYLYSI---ENWYKWFENISD--IIWHGCY--VFEGYDDESISH 133
           T IPS   +  + +TEY+ SI   E  Y++F+ I D  ++  GC+  + + +DDE +S 
Sbjct: 359 TDIPSFIMLMPNPLTEYIESIKDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSE 417

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 28/161 (17%)

Query: 74  IYDDEDDSTSIPSDTKV-KSDQITEYLYSIENW--YKWFE--NISDIIWHG-CYVF---- 123
           ++DDED +  +     V + DQ+    Y  E W   ++++  ++ D+ +   C  F    
Sbjct: 116 VFDDEDRACLVDKKLGVLEVDQLECLAYEFEKWVEMRYYDSLDVEDVSYFQLCIEFCFSR 175

Query: 124 -EGYDDESISHLTQLLRFY-LQKKID----ENRASSFD---RHLVNIFRDQLKCSDPDPV 174
            E   DE + HL QLLR+  L   +D      + S  +   R+ + +  D++     +PV
Sbjct: 176 KEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDKILARISNPV 235

Query: 175 NGTLEIDEDWAENLLKTMRNSKIKDLNTVK------YCIRT 209
              + + E  + NL+K + N K + +NT K      YCI T
Sbjct: 236 KDKIHLSE--SVNLIKKLSNGKYQ-VNTDKGKYLCDYCIVT 273

>Kwal_33.14899
          Length = 685

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%)

Query: 115 IIWHGCYVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVNIFRDQLKC 168
           +I     + EG  + +I +L++ L F+  K I  ++ SS D   +  +RD L+C
Sbjct: 60  LILAHLMIREGEPNVTIEYLSKHLEFFRLKDIFHSKLSSGDLQALRRYRDYLQC 113

>YNL182C (IPI3) [4418] chr14 complement(295960..297627) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has low similarity
           to uncharacterized C. albicans Orf6.5122p [1668 bp, 555
           aa]
          Length = 555

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 16/95 (16%)

Query: 30  FNINDPEVN-------PL--VKSYLSEVRNEALHTNAISHQIGQVSKNTFDANIYDDEDD 80
           + I +PE         PL    +YL +V+ +     +I   IG+VS N     + D++ D
Sbjct: 453 YQIGEPEAETDPNLALPLNDFNAYLEQVKTQ----ESIFSHIGKVSSN---VKVIDNKID 505

Query: 81  STSIPSDTKVKSDQITEYLYSIENWYKWFENISDI 115
           +TS       K ++ITE   +IE     ++ + D+
Sbjct: 506 ATSSLDSNAAKDEEITELKTNIEALTHAYKELRDM 540

>AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH]
           complement(196774..201870) [5097 bp, 1698 aa]
          Length = 1698

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 58  ISHQIGQVS-KNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSIEN 104
           ISH     S  N   AN  D+ED +  IPS+     D++T+  Y  EN
Sbjct: 717 ISHSFNNSSISNIIFANSTDEEDSANDIPSEGSRSEDELTDKHYEDEN 764

>Kwal_23.6139
          Length = 1319

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 48/108 (44%), Gaps = 11/108 (10%)

Query: 129 ESISHLTQLLRFYL--QKKIDENRASSFDRHLVNIFRDQLKCSDPDPVNGTLEIDEDW-- 184
           E + HL    +  L  Q  +D ++     +  + IFR  L    P  V+ T++I E +  
Sbjct: 131 EVVHHLVLHFKHTLIQQNGVDSHKKMDSIKAAMEIFRPNLSHYVPHEVDETIQILETFFP 190

Query: 185 --AENLLKTMRNSKIKD-LNTVK----YCIRTDYKRAPHGLKPWAKYV 225
               +L   +  SKIK+ + T K      +R  + R P G+ PW  Y+
Sbjct: 191 RDGCSLTGEVLKSKIKEQIGTSKSKLILALRIIWSRFPSGIIPWESYL 238

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,752,083
Number of extensions: 583670
Number of successful extensions: 2069
Number of sequences better than 10.0: 35
Number of HSP's gapped: 2079
Number of HSP's successfully gapped: 35
Length of query: 355
Length of database: 16,596,109
Length adjustment: 103
Effective length of query: 252
Effective length of database: 13,030,455
Effective search space: 3283674660
Effective search space used: 3283674660
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)