Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D01562g1551538201e-114
Scas_667.25*1541517082e-97
YPR062W (FCY1)1581506762e-92
Kwal_27.126071521496207e-84
KLLA0B08437g1521495781e-77
ADL328C1511495556e-74
Scas_690.232561111171e-07
ACR075C245991116e-07
YJL035C (TAD2)2501001063e-06
KLLA0C10989g2381021055e-06
Kwal_23.2894247991037e-06
CAGL0J01023g259102959e-05
CAGL0A00847g329116830.004
YHR144C (DCD1)312150820.005
Kwal_47.17610321113810.008
AFR023W30074800.009
Scas_677.2431676800.009
CAGL0G05852g307150770.024
KLLA0C18403g328118760.036
Sklu_2368.332978740.065
AFR493C32439730.096
Scas_670.29*35740700.22
Kwal_33.1449914473660.51
AAL030C153954670.64
Scas_713.2658284660.72
Kwal_56.24725151063641.3
CAGL0C05291g58480605.1
Kwal_33.1370528945587.6
KLLA0F24794g59782589.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D01562g
         (153 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D01562g complement(166898..167365) highly similar to sp|Q12...   320   e-114
Scas_667.25*                                                          277   2e-97
YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,...   265   2e-92
Kwal_27.12607                                                         243   7e-84
KLLA0B08437g complement(750194..750652) highly similar to sp|Q12...   227   1e-77
ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH] (123313..12...   218   6e-74
Scas_690.23                                                            50   1e-07
ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH] (497467..49...    47   6e-07
YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit t...    45   3e-06
KLLA0C10989g complement(944739..945455) similar to sp|P47058 Sac...    45   5e-06
Kwal_23.2894                                                           44   7e-06
CAGL0J01023g complement(100059..100838) similar to sp|P47058 Sac...    41   9e-05
CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3 Sacch...    37   0.004
YHR144C (DCD1) [2432] chr8 complement(387789..388727) Deoxycytid...    36   0.005
Kwal_47.17610                                                          36   0.008
AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH] complement(...    35   0.009
Scas_677.24                                                            35   0.009
CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces c...    34   0.024
KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3 S...    34   0.036
Sklu_2368.3 YHR144C, Contig c2368 5164-6153                            33   0.065
AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH] (1325485..1...    33   0.096
Scas_670.29*                                                           32   0.22 
Kwal_33.14499                                                          30   0.51 
AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4...    30   0.64 
Scas_713.26                                                            30   0.72 
Kwal_56.24725                                                          29   1.3  
CAGL0C05291g 504216..505970 similar to sp|Q12362 Saccharomyces c...    28   5.1  
Kwal_33.13705                                                          27   7.6  
KLLA0F24794g 2306055..2307848 similar to sp|Q12362 Saccharomyces...    27   9.2  

>CAGL0D01562g complement(166898..167365) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine
           deaminase, hypothetical start
          Length = 155

 Score =  320 bits (820), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 153/153 (100%), Positives = 153/153 (100%)

Query: 1   MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHG 60
           MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHG
Sbjct: 1   MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHG 60

Query: 61  EISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLK 120
           EISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLK
Sbjct: 61  EISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLK 120

Query: 121 SRGVEVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
           SRGVEVVQMNDEPCKAIMKKFIDTRPQDWFEDI
Sbjct: 121 SRGVEVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153

>Scas_667.25*
          Length = 154

 Score =  277 bits (708), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 131/151 (86%), Positives = 137/151 (90%)

Query: 3   NAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEI 62
           +A QWD LGM IA+EEAA G+ EGGVPIGGCLINNKDG VLGRGHNMRFQKGSPTLHGEI
Sbjct: 2   SAGQWDKLGMDIAFEEAANGYAEGGVPIGGCLINNKDGKVLGRGHNMRFQKGSPTLHGEI 61

Query: 63  STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSR 122
           STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIL+YGIPR VIGES NFKSPGE YL SR
Sbjct: 62  STLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILMYGIPRVVIGESVNFKSPGEAYLASR 121

Query: 123 GVEVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
            V+VVQM+DE CK IMKKFID RPQDWFEDI
Sbjct: 122 NVQVVQMDDERCKTIMKKFIDERPQDWFEDI 152

>YPR062W (FCY1) [5491] chr16 (677160..677636) Cytosine deaminase,
           catalyzes the hydrolysis of cytidine into uridine and
           ammonia [477 bp, 158 aa]
          Length = 158

 Score =  265 bits (676), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 138/150 (92%)

Query: 4   AAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIS 63
           A++WD  GM IAYEEAA G++EGGVPIGGCLINNKDG+VLGRGHNMRFQKGS TLHGEIS
Sbjct: 7   ASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEIS 66

Query: 64  TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRG 123
           TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAI++YGIPRCV+GE+ NFKS GE+YL++RG
Sbjct: 67  TLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRG 126

Query: 124 VEVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
            EVV ++DE CK IMK+FID RPQDWFEDI
Sbjct: 127 HEVVVVDDERCKKIMKQFIDERPQDWFEDI 156

>Kwal_27.12607
          Length = 152

 Score =  243 bits (620), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 113/149 (75%), Positives = 128/149 (85%)

Query: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64
           ++WD  G+ +AYEEA KG++EGGVPIGGCLINNKDGTVLG GHNMRFQKGS TLHGEIST
Sbjct: 2   SKWDQKGIDLAYEEALKGYKEGGVPIGGCLINNKDGTVLGSGHNMRFQKGSATLHGEIST 61

Query: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124
           LENCGR++G VYKD TLYTTLSPCDMCTGAILLYGI RCV+GE+ NFK  GE YL  RG 
Sbjct: 62  LENCGRMKGSVYKDCTLYTTLSPCDMCTGAILLYGISRCVVGENVNFKGDGERYLAERGC 121

Query: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
           EV  ++D+ CK IMK+FI+ RPQDWFEDI
Sbjct: 122 EVKVLDDDRCKDIMKQFIEERPQDWFEDI 150

>KLLA0B08437g complement(750194..750652) highly similar to sp|Q12178
           Saccharomyces cerevisiae YPR062w FCY1 cytosine deaminase
           singleton, start by similarity
          Length = 152

 Score =  227 bits (578), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 122/149 (81%)

Query: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64
           A+WD  GM  AYEEAA G++EGGVPIGGCLI+N  G +LG GHNMRFQKGSPTLHGE ST
Sbjct: 2   AEWDKKGMDKAYEEAAIGYKEGGVPIGGCLIDNLTGEILGSGHNMRFQKGSPTLHGETST 61

Query: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124
           LEN GRL+G VYK  T+YTTLSPCDMCTGAILLYGI R V+GE+ NFKSPGE+YL  RG+
Sbjct: 62  LENAGRLKGSVYKHCTMYTTLSPCDMCTGAILLYGIGRVVVGENVNFKSPGEKYLAERGI 121

Query: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
           EV  ++DE C  IMK FI  RP+DWFEDI
Sbjct: 122 EVKVVDDERCIEIMKDFIAKRPEDWFEDI 150

>ADL328C [1413] [Homologous to ScYPR062W (FCY1) - SH]
           (123313..123768) [456 bp, 151 aa]
          Length = 151

 Score =  218 bits (555), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 118/149 (79%), Gaps = 1/149 (0%)

Query: 5   AQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64
           AQWD  GM+IAY+EA +G+ EGGVPIGGCLI+  DGTVLGRG NMRFQ+ S TLHGE + 
Sbjct: 2   AQWDRKGMEIAYQEALQGYAEGGVPIGGCLIDQTDGTVLGRGRNMRFQRASATLHGETAA 61

Query: 65  LENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEEYLKSRGV 124
           LEN GRL G VYK  TLYTTLSPCDMC GA+LLYGIPRCV+GE+D F    E +L++RGV
Sbjct: 62  LENAGRLPGHVYKHCTLYTTLSPCDMCAGAVLLYGIPRCVVGENDTFLG-AEAHLRARGV 120

Query: 125 EVVQMNDEPCKAIMKKFIDTRPQDWFEDI 153
           EV  + D  C+A+M++F+  RPQDW EDI
Sbjct: 121 EVTVLQDARCRALMQQFVAARPQDWNEDI 149

>Scas_690.23
          Length = 256

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 1   MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHG 60
           MS++    A  M+ A + A    +    P+    ++     ++  G N   +  +   H 
Sbjct: 1   MSSSLAKHASWMESAIKLARYALDHDETPVASIFVHEPTNKIIAYGLNDTNKSLTGIAHA 60

Query: 61  EISTLENCGRLEG-----KVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
           E   +E    + G     +++KDT LY T+ PC MC  A+   GI + V G
Sbjct: 61  EFMGIEQIKAMVGSEHLTEIFKDTVLYVTVEPCVMCASALRQLGIKKVVFG 111

>ACR075C [1122] [Homologous to ScYJL035C (TAD2) - SH]
           (497467..498204) [738 bp, 245 aa]
          Length = 245

 Score = 47.4 bits (111), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 12  MKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLENCGRL 71
           M+ A   A    + G  P+    ++     ++  G N   +  +   H E   +     L
Sbjct: 8   MRTAIRLARYALDHGETPVACVFVHTPSDQIIAYGMNDTNRSLTGIAHAEFGAIAQVQEL 67

Query: 72  EGK----VYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
            G+    ++K+ T+Y T+ PC MC  A+   GI R + G
Sbjct: 68  FGEQDASIFKEVTVYVTVEPCVMCASALKQLGIGRVIFG 106

>YJL035C (TAD2) [2876] chr10 complement(380165..380917) Subunit
           tRNA[Ala]-specific adenosine deaminase [753 bp, 250 aa]
          Length = 250

 Score = 45.4 bits (106), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 5/100 (5%)

Query: 12  MKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLENCGRL 71
           M+ A   A    +    P+    ++   G V+  G N   +  +   H E   ++    +
Sbjct: 7   MRTAVRLARYALDHDETPVACIFVHTPTGQVMAYGMNDTNKSLTGVAHAEFMGIDQIKAM 66

Query: 72  EGK-----VYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
            G      V+KD TLY T+ PC MC  A+    I + V G
Sbjct: 67  LGSRGVVDVFKDITLYVTVEPCIMCASALKQLDIGKVVFG 106

>KLLA0C10989g complement(944739..945455) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2 tRNA-specific
           adenosine deaminase 2 singleton, start by similarity
          Length = 238

 Score = 45.1 bits (105), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 42/102 (41%), Gaps = 3/102 (2%)

Query: 8   DALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLEN 67
           D L M+ A   A    +    P+    +++K   V+  G N   +  S   H E   ++ 
Sbjct: 4   DLLHMRTAITLAKYALDHEETPVACIFVHSKLNKVIAYGMNGTNESISGISHAEFMGIKQ 63

Query: 68  CGRLEG---KVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
                G   K+  +  LY T+ PC MC  A+   GI + V G
Sbjct: 64  IQEKYGTDPKILSEVVLYVTVEPCIMCASALKQLGIKKVVFG 105

>Kwal_23.2894
          Length = 247

 Score = 44.3 bits (103), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 4/99 (4%)

Query: 12  MKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGE---ISTLE-N 67
           M+ A + A    +    P+    ++     +L  G N   +  +   H E   IS ++  
Sbjct: 10  MRAALKLARYALDHDETPVACIFVHAPTNQILAYGMNDTNRSLTGIAHAEFMGISQIQAK 69

Query: 68  CGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
            G     VYKD  LY T+ PC MC  A+   GI + + G
Sbjct: 70  FGVQNTSVYKDIILYVTVEPCIMCASALKQLGIQKVIFG 108

>CAGL0J01023g complement(100059..100838) similar to sp|P47058
           Saccharomyces cerevisiae YJL035c TAD2, hypothetical
           start
          Length = 259

 Score = 41.2 bits (95), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 44/102 (43%), Gaps = 10/102 (9%)

Query: 15  AYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGE---ISTLENCGRL 71
           A + A    + G  P+    ++ K  +V+  G N      S T H E   +  L +  + 
Sbjct: 11  ALKLARYALDHGETPVACVFVHEKSDSVVAYGLNDTNDSLSGTAHAEFVAMRMLRDAVQA 70

Query: 72  EG-------KVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIG 106
           +G       +++K+   Y T+ PC MC  A+   GI + V G
Sbjct: 71  QGYASVQLKQLFKEIVCYVTVEPCIMCASALKQMGIHKIVFG 112

>CAGL0A00847g complement(86551..87540) similar to sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3, hypothetical
           start
          Length = 329

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

Query: 12  MKIAYEEAAK-GFEEGGVPIGGCLINNKDG-----TVLGRGHNMRFQKGSPTLHGEI--- 62
           +KI  EE+ + G E G +PI    ++ K        V  R H+          H  +   
Sbjct: 165 LKIIQEESKRIGKESGSLPIVSVFVDPKFKGDFIIAVDQRSHSEEEHLSLKIDHSIMVGI 224

Query: 63  ----------STLENCGRL-EGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGE 107
                      +LE+C  + +  +  D  +YTT  PC MC+ A++   I RC+  E
Sbjct: 225 NKVANTEKKRRSLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRCIFIE 280

>YHR144C (DCD1) [2432] chr8 complement(387789..388727)
           Deoxycytidylate deaminase [939 bp, 312 aa]
          Length = 312

 Score = 36.2 bits (82), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 61/150 (40%), Gaps = 28/150 (18%)

Query: 7   WDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMR-------FQKGSPT-- 57
           WD+  MK+A   A++          GC+I  ++  V+  G+N         F  G P   
Sbjct: 163 WDSYFMKLATLAASRS--NCMKRRVGCVIV-RECRVIATGYNGTPRHLTNCFNGGCPRCN 219

Query: 58  ------------LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVI 105
                       LH E + L   GR   +V ++ TLY    PC  C+  I+  GI   V 
Sbjct: 220 DGDSRNLHTCLCLHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGISEVVY 277

Query: 106 GESDNFKSPGEEYLKSRGVEVVQMN--DEP 133
            +S        + LK+ G+ V Q +  +EP
Sbjct: 278 SQSYRMDEESFKVLKNAGITVRQFSFTEEP 307

>Kwal_47.17610
          Length = 321

 Score = 35.8 bits (81), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 19/113 (16%)

Query: 9   ALGMKIAYEEAAKGFEEGG----VPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEIST 64
           +L  K+  +   K FEE      +P+    +N K+   +    + R++  SP  H  +  
Sbjct: 159 SLIRKLLQKICDKSFEESKSGNKIPVVSAFVNPKNQETVF-ATDCRYE-DSPLDHSIMRG 216

Query: 65  LENCGRLEGK-------------VYKDTTLYTTLSPCDMCTGAILLYGIPRCV 104
           + +   LE K             +  D  +YTT  PC MC  A++   I RC+
Sbjct: 217 IRSVAALEQKRKNEAKRGSEETYLCLDFDVYTTHEPCSMCAMALIHSRIKRCI 269

>AFR023W [3215] [Homologous to ScYHR144C (DCD1) - SH]
           complement(483186..484088) [903 bp, 300 aa]
          Length = 300

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 2/74 (2%)

Query: 58  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEE 117
           LH E + L   GR   +V +   LY    PC  C+  I+  GI   V  ++    S   +
Sbjct: 220 LHAEENALLEAGR--ERVGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSFK 277

Query: 118 YLKSRGVEVVQMND 131
            L++ GV+V Q+ D
Sbjct: 278 VLRAGGVKVRQLQD 291

>Scas_677.24
          Length = 316

 Score = 35.4 bits (80), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 58  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEE 117
           LH E + L   GR   +V    TLY    PC  C+  I+  GI   V  ++        +
Sbjct: 236 LHAEENALLEAGR--DRVGVKATLYCDTCPCLTCSVKIVQTGIKEVVYSQTYRMDEESFK 293

Query: 118 YLKSRGVEVVQMNDEP 133
            L S G+ V Q N  P
Sbjct: 294 VLTSAGINVRQFNFTP 309

>CAGL0G05852g 565237..566160 similar to sp|P06773 Saccharomyces
           cerevisiae YHR144c DCD1 deoxycytidylate deaminase, start
           by similarity
          Length = 307

 Score = 34.3 bits (77), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 28/150 (18%)

Query: 7   WDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMR-------FQKGSPT-- 57
           WD   MK+A   A++          GC+I  ++  V+  G+N         F  G P   
Sbjct: 158 WDTYFMKLATLAASRS--NCMKRRVGCVIV-RECRVIATGYNGTPRHLTNCFHGGCPRCN 214

Query: 58  ------------LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVI 105
                       LH E + L   GR   +V ++ TLY    PC  C+  I+  GI   V 
Sbjct: 215 DGDSKNLHTCLCLHAEENALLEAGR--DRVGQNATLYCDTCPCLTCSVKIVQTGITEVVY 272

Query: 106 GESDNFKSPGEEYLKSRGVEVVQMN--DEP 133
            ++        + L+  G++V Q +  +EP
Sbjct: 273 SQTYRMDDASFKVLREAGIKVRQFSFREEP 302

>KLLA0C18403g 1627733..1628719 some similarities with sp|Q9URQ3
           Saccharomyces cerevisiae YLR316c TAD3 subunit of
           tRNA-specific adenosine-34 deaminase singleton,
           hypothetical start
          Length = 328

 Score = 33.9 bits (76), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 48/118 (40%), Gaps = 24/118 (20%)

Query: 9   ALGMKIAYE-EAAKGFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLEN 67
           +L  KIA E  A +  +   +PI    +N K G ++    + R   GSP  H  +  +  
Sbjct: 161 SLLTKIAEESRAIRDSDSMQLPIVSAFVNPKSGKIII-SKDYR-HSGSPLDHSVMVGINE 218

Query: 68  CGRLE-------------------GKVYK--DTTLYTTLSPCDMCTGAILLYGIPRCV 104
             + E                   G+ Y   D  +YT+  PC MC+ A++   + RC+
Sbjct: 219 VAKEEQERRDRVQNGTASEKDIHQGETYLCLDFDVYTSHEPCSMCSMALIHSRVKRCI 276

>Sklu_2368.3 YHR144C, Contig c2368 5164-6153
          Length = 329

 Score = 33.1 bits (74), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 4/78 (5%)

Query: 58  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEE 117
           LH E + L   GR   +V  + TLY    PC  C+  I+  GI   V  +S        +
Sbjct: 249 LHAEENALLEAGR--DRVGSNATLYCDTCPCLTCSVKIVQTGIREVVYSQSYRMDEASFK 306

Query: 118 YLKSRGVEVVQMN--DEP 133
            L+S GV + Q +  +EP
Sbjct: 307 VLQSGGVLIRQYSLLEEP 324

>AFR493C [3685] [Homologous to ScYLR316C (TAD3) - SH]
           (1325485..1326459) [975 bp, 324 aa]
          Length = 324

 Score = 32.7 bits (73), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 67  NCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVI 105
           + GR +  +  D  +YTT  PC MC  A++   I RC+ 
Sbjct: 235 SVGRTDTYLCLDFDVYTTHEPCSMCAMALIHSRIKRCIF 273

>Scas_670.29*
          Length = 357

 Score = 31.6 bits (70), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 69  GRLEGKVYK----DTTLYTTLSPCDMCTGAILLYGIPRCV 104
           G LE ++      D  +YTT  PC MC+ A++   I RC+
Sbjct: 266 GELEDRISTYLCLDFDVYTTHEPCSMCSMALIHSRIRRCI 305

>Kwal_33.14499
          Length = 144

 Score = 30.0 bits (66), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 58  LHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCVIGESDNFKSPGEE 117
           LH E + L   GR   +V  + TLY    PC  C+  I+  G+   V  +S +      +
Sbjct: 64  LHAEENALLEAGR--DRVGPNATLYCDTCPCLTCSVKIVQTGVREVVYSQSYHMDEASFK 121

Query: 118 YLKSRGVEVVQMN 130
            L+  GV V Q +
Sbjct: 122 VLQDGGVLVRQFS 134

>AAL030C [157] [Homologous to ScYLR247C - SH] (284758..289377) [4620
            bp, 1539 aa]
          Length = 1539

 Score = 30.4 bits (67), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 2/54 (3%)

Query: 45   RGHNMRFQ--KGSPTLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIL 96
            RG +M  +  +   TL   +  L+N  +LE  +  +     T+  CD+C GAI+
Sbjct: 1179 RGDSMYLKNIQKISTLQSRLKYLQNLTKLEQALKDNMRFNCTICLCDICDGAII 1232

>Scas_713.26
          Length = 582

 Score = 30.0 bits (66), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 12/84 (14%)

Query: 12  MKIAYEEAAK-GFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLENCGR 70
           MK+A  EA K         +G  L+N  +  ++ RG++   +  +   H E   LE    
Sbjct: 434 MKLAINEARKCEPTNTAFSVGAILVNGTE--IISRGYSRELEGNT---HAEQCALEKYFS 488

Query: 71  LEGKVYKD----TTLYTTLSPCDM 90
            +GK  KD    T LYTT+ PC  
Sbjct: 489 SKGK--KDIPFGTVLYTTMEPCSF 510

>Kwal_56.24725
          Length = 1510

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 10/63 (15%)

Query: 61   EISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPRCV----IGESDNFKSPGE 116
            +IS+LE   RL+ K Y+D +    +  C+     +L     RC     +GE DN K+P E
Sbjct: 1279 DISSLE---RLKAKNYRDRSWLENVMDCE---KKVLFLDHGRCPSFQEVGEKDNIKNPNE 1332

Query: 117  EYL 119
              L
Sbjct: 1333 AEL 1335

>CAGL0C05291g 504216..505970 similar to sp|Q12362 Saccharomyces
           cerevisiae YOL066c RIB2 DRAP deaminase or sp|Q12069
           Saccharomyces cerevisiae YDL036c, hypothetical start
          Length = 584

 Score = 27.7 bits (60), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 34/80 (42%), Gaps = 8/80 (10%)

Query: 12  MKIAYEEAAK-GFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLENCGR 70
           M  A EEA K G  +    +G  L+N  +  VL  GH+      +   H E   LE    
Sbjct: 439 MVQAIEEADKCGPTKTAFSVGAVLVNGTE--VLSVGHSRELPGNT---HAEQCALEKYFE 493

Query: 71  LEG--KVYKDTTLYTTLSPC 88
                KV   T ++TT+ PC
Sbjct: 494 THNTDKVPPGTVIFTTMEPC 513

>Kwal_33.13705
          Length = 289

 Score = 26.9 bits (58), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 8/45 (17%)

Query: 108 SDNFKSPG----EEYLKSRGVEVVQMNDEPCKAIMKKFIDTRPQD 148
           S+ FK+P     ++ +++ GVE    +  PC  I++ F +TRP D
Sbjct: 129 SEPFKTPANRRIQDIIEAWGVE----DRTPCVHILRPFNETRPTD 169

>KLLA0F24794g 2306055..2307848 similar to sp|Q12362 Saccharomyces
           cerevisiae YOL066c RIB2 DRAP deaminase, hypothetical
           start
          Length = 597

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 8/82 (9%)

Query: 12  MKIAYEEAAK-GFEEGGVPIGGCLINNKDGTVLGRGHNMRFQKGSPTLHGEISTLEN-CG 69
           M++A +EA   G  +    +G  L+N  D  +L  G++      +   H E   L+    
Sbjct: 449 MELAIDEARNCGETQTAFNVGALLVNGTD--ILSTGYSRELPGNT---HAEQCALDKYFT 503

Query: 70  RLEGKVYKD-TTLYTTLSPCDM 90
           + EG    D T +YTT+ PC +
Sbjct: 504 KSEGAKLPDGTIIYTTMEPCSL 525

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.138    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,299,113
Number of extensions: 220654
Number of successful extensions: 379
Number of sequences better than 10.0: 30
Number of HSP's gapped: 378
Number of HSP's successfully gapped: 30
Length of query: 153
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 60
Effective length of database: 13,376,635
Effective search space: 802598100
Effective search space used: 802598100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 57 (26.6 bits)