Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0D01540g1271256623e-91
YPR063C1401204118e-53
Scas_667.26*1261273787e-48
ADL329W111791858e-19
KLLA0B08415g1211141814e-18
Kwal_27.1261072721714e-17
KLLA0B01606g68132603.3
Scas_714.41d24233593.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0D01540g
         (125 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces c...   259   3e-91
YPR063C (YPR063C) [5492] chr16 complement(677807..678188,678275....   162   8e-53
Scas_667.26*                                                          150   7e-48
ADL329W [1412] [Homologous to ScYPR063C - SH] complement(122957....    76   8e-19
KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267 Sacch...    74   4e-18
Kwal_27.12610                                                          70   4e-17
KLLA0B01606g 127978..130023 some similarities with sgd|S0002865 ...    28   3.3  
Scas_714.41d                                                           27   3.5  

>CAGL0D01540g 166233..166616 similar to tr|Q12160 Saccharomyces
           cerevisiae YPR063c, start by similarity
          Length = 127

 Score =  259 bits (662), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60
           MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV
Sbjct: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60

Query: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPPPSSEKK 120
           HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPPPSSEKK
Sbjct: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPPPSSEKK 120

Query: 121 ILDEE 125
           ILDEE
Sbjct: 121 ILDEE 125

>YPR063C (YPR063C) [5492] chr16
           complement(677807..678188,678275..678315) Protein of
           unknown function [423 bp, 140 aa]
          Length = 140

 Score =  162 bits (411), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 91/120 (75%)

Query: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60
           M LNNV R DLCV YKK  PP+G+YS + S+SG+VNQ+MPMAAIFL+NKFIAWFSLIQSV
Sbjct: 1   MTLNNVARPDLCVSYKKIAPPKGLYSATPSISGVVNQSMPMAAIFLRNKFIAWFSLIQSV 60

Query: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPPPSSEKK 120
           H YLNTDE+ +   K     S +DQPP +K+ MSL+G+ VCYMNLVFP   A P SS  K
Sbjct: 61  HYYLNTDEDIIVAYKENKAPSPMDQPPAIKLFMSLIGLCVCYMNLVFPQQIAQPSSSGSK 120

>Scas_667.26*
          Length = 126

 Score =  150 bits (378), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60
           M LNNV+R DLC +  ++ PP+G+YS   S+SGIVNQ+MPMAAIFL+N+F+AWF++IQSV
Sbjct: 1   MGLNNVKRPDLCARASRAIPPKGLYSTLPSMSGIVNQSMPMAAIFLRNRFVAWFAVIQSV 60

Query: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDA--PPPSSE 118
           H YLNTDE+       K  +S+++Q P++KVAM++VG++VCYMNLVFP  +    PPS E
Sbjct: 61  HYYLNTDEDEANAKDGKQ-SSSIEQTPIIKVAMAMVGLIVCYMNLVFPVVNQMPQPPSDE 119

Query: 119 KKILDEE 125
             I +E+
Sbjct: 120 IPITEEK 126

>ADL329W [1412] [Homologous to ScYPR063C - SH]
           complement(122957..123292) [336 bp, 111 aa]
          Length = 111

 Score = 75.9 bits (185), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 54/79 (68%), Gaps = 8/79 (10%)

Query: 33  GIVNQTMPMAAIFLKNKFIAWFSLIQSVHSYLNTDEETL-EKNKSKTGNSALDQPPLVKV 91
           G+V+Q+MPM A+F++NKF+AWFSL+ + H+YL  D   + ++  ++ G       P++K+
Sbjct: 34  GVVSQSMPMLAMFMRNKFLAWFSLLTAWHTYLTADPNAVRDREGTEVG-------PIMKL 86

Query: 92  AMSLVGILVCYMNLVFPTP 110
            M++V ++VCY  +V P P
Sbjct: 87  GMAVVAVVVCYTGMVLPQP 105

>KLLA0B08415g 749520..749885 weakly similar to sgd|S0006267
           Saccharomyces cerevisiae YPR063c hypothetical protein,
           start by similarity
          Length = 121

 Score = 74.3 bits (181), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 68/114 (59%), Gaps = 10/114 (8%)

Query: 1   MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAIFLKNKFIAWFSLIQSV 60
           M LNNVRR DL   Y  +  P+G+YS S S  G+++Q+MPMAA+F+KNKF+AWF+++ + 
Sbjct: 1   MPLNNVRRPDLVATYNHTPAPKGLYSSSSSSQGMLSQSMPMAAMFMKNKFLAWFAVLTTW 60

Query: 61  HSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCYMNLVFPTPDAPP 114
           H +L +  +      S          P +K+ M+++ + + Y+ L FP    PP
Sbjct: 61  HVFLTSQPDPSNPTDS----------PFMKIGMAVLAVGMNYLGLFFPGTQPPP 104

>Kwal_27.12610
          Length = 72

 Score = 70.5 bits (171), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (66%), Gaps = 11/72 (15%)

Query: 39  MPMAAIFLKNKFIAWFSLIQSVHSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGI 98
           MPMAA+F++NKF+AWF+L+ +VH  L T+ +          N+  DQ  +VKV MSLV +
Sbjct: 1   MPMAAMFMRNKFLAWFALLSTVHYALTTEPD---------ANA--DQSAVVKVLMSLVSL 49

Query: 99  LVCYMNLVFPTP 110
            VCY+N+ FP P
Sbjct: 50  AVCYINVAFPQP 61

>KLLA0B01606g 127978..130023 some similarities with sgd|S0002865
           Saccharomyces cerevisiae YDR452w PHM5, hypothetical
           start
          Length = 681

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 72  EKNKSKTGNSALDQPPLVKVAMSLVGILVCYM 103
           EK KS TG S    P +++V + L+G +V ++
Sbjct: 8   EKRKSNTGLSWFPSPRILQVFLVLLGAIVAFL 39

>Scas_714.41d
          Length = 242

 Score = 27.3 bits (59), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 56  LIQSVHSYLNTDEETLEKNKSKTGNSALDQPPL 88
           +IQ++ SY + D +TL+K K K      +  PL
Sbjct: 187 IIQTMFSYFSNDNKTLKKEKVKGNYKYFETIPL 219

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.130    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,327,305
Number of extensions: 164506
Number of successful extensions: 380
Number of sequences better than 10.0: 14
Number of HSP's gapped: 376
Number of HSP's successfully gapped: 14
Length of query: 125
Length of database: 16,596,109
Length adjustment: 89
Effective length of query: 36
Effective length of database: 13,515,107
Effective search space: 486543852
Effective search space used: 486543852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)