Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C03696g83181939920.0
YDR089W8698789871e-120
Scas_636.128378569121e-110
Kwal_56.234108258508491e-101
KLLA0F14509g8518718368e-99
AGR160W8368556674e-75
YPL019C (VTC3)835142880.024
Kwal_27.1229221734840.034
Sklu_2202.8136733860.040
YPL110C122333800.21
KLLA0F00660g137434800.24
CAGL0J07040g124533790.31
AGR223W132133780.43
CAGL0E01617g80352760.58
AGL020W844212760.62
KLLA0E12133g84131760.63
Scas_707.2783643750.84
Scas_704.3991635750.86
Scas_698.4015053682.1
Kwal_23.506083531703.0
KLLA0E15774g114852703.5
Kwal_23.637031850693.7
Kwal_27.12751109340694.5
YFL004W (VTC2)82835685.8
CAGL0F02145g81631678.0
CAGL0I05632g88644678.4
CAGL0I03960g103353678.4
Kwal_56.2442140653669.0
KLLA0F06160g85948669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C03696g
         (819 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...  1542   0.0  
YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...   384   e-120
Scas_636.12                                                           355   e-110
Kwal_56.23410                                                         331   e-101
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...   326   8e-99
AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...   261   4e-75
YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit o...    39   0.024
Kwal_27.12292                                                          37   0.034
Sklu_2202.8 YPL110C, Contig c2202 8829-12932                           38   0.040
YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member...    35   0.21 
KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces ...    35   0.24 
CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces c...    35   0.31 
AGR223W [4534] [Homologous to ScYPL110C - SH] complement(1167870...    35   0.43 
CAGL0E01617g 154719..157130 similar to sp|Q08269 Saccharomyces c...    34   0.58 
AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C (...    34   0.62 
KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces...    34   0.63 
Scas_707.27                                                            33   0.84 
Scas_704.39                                                            33   0.86 
Scas_698.40                                                            31   2.1  
Kwal_23.5060                                                           32   3.0  
KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces...    32   3.5  
Kwal_23.6370                                                           31   3.7  
Kwal_27.12751                                                          31   4.5  
YFL004W (VTC2) [1677] chr6 (131805..134291) Subunit of the vacuo...    31   5.8  
CAGL0F02145g 213561..216011 similar to sp|P43585 Saccharomyces c...    30   8.0  
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    30   8.4  
CAGL0I03960g 346238..349339 similar to sp|P17255 Saccharomyces c...    30   8.4  
Kwal_56.24421                                                          30   9.0  
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    30   9.6  

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score = 1542 bits (3992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 764/819 (93%), Positives = 764/819 (93%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLEVSFKQNIVQINL 60
           MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLEVSFKQNIVQINL
Sbjct: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLEVSFKQNIVQINL 60

Query: 61  FVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVI 120
           FVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVI
Sbjct: 61  FVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVI 120

Query: 121 VQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLI 180
           VQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLI
Sbjct: 121 VQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLI 180

Query: 181 MDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQFDQVLWDKGEL 240
           MDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQFDQVLWDKGEL
Sbjct: 181 MDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQFDQVLWDKGEL 240

Query: 241 IQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIASEPNSEVRSLRSKKSFYESDR 300
           IQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIASEPNSEVRSLRSKKSFYESDR
Sbjct: 241 IQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIASEPNSEVRSLRSKKSFYESDR 300

Query: 301 PALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNN 360
           PALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNN
Sbjct: 301 PALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNN 360

Query: 361 VIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSNKQAISDPLAKIALDWICDHGMKE 420
           VIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSNKQAISDPLAKIALDWICDHGMKE
Sbjct: 361 VIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSNKQAISDPLAKIALDWICDHGMKE 420

Query: 421 CGIEIGFKRTRYFCNKHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVVTTNFSSDN 480
           CGIEIGFKRTRYFCNKHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVVTTNFSSDN
Sbjct: 421 CGIEIGFKRTRYFCNKHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVVTTNFSSDN 480

Query: 481 KSLAKKSQEIYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLMLENIYELNE 540
           KSLAKKSQEIYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLMLENIYELNE
Sbjct: 481 KSLAKKSQEIYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLMLENIYELNE 540

Query: 541 NNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPTRTPXXXXXXXXXXXXXXXXXXXP 600
           NNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPTRTP                   P
Sbjct: 541 NNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPTRTPNDWKKNNLLSKNKNTENNKP 600

Query: 601 AIRYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIHFSKDFIESTYSSLQSF 660
           AIRYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIHFSKDFIESTYSSLQSF
Sbjct: 601 AIRYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIHFSKDFIESTYSSLQSF 660

Query: 661 RDFLGFKDNNRTAIDPALLDLSERFGNSNYXXXXXXXXXXXXXVEDIRKLIEHQMKEIEN 720
           RDFLGFKDNNRTAIDPALLDLSERFGNSNY             VEDIRKLIEHQMKEIEN
Sbjct: 661 RDFLGFKDNNRTAIDPALLDLSERFGNSNYGSISSKGSILSNSVEDIRKLIEHQMKEIEN 720

Query: 721 SESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGDNSDIEIDVGKTXXXXXXX 780
           SESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGDNSDIEIDVGKT       
Sbjct: 721 SESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGDNSDIEIDVGKTLIITVIL 780

Query: 781 XXXXXXXXXXXXXXXXFSRYTYAPIWHYALSFAIFIMIM 819
                           FSRYTYAPIWHYALSFAIFIMIM
Sbjct: 781 SLGISLGLITLCLLLLFSRYTYAPIWHYALSFAIFIMIM 819

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score =  384 bits (987), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 267/878 (30%), Positives = 455/878 (51%), Gaps = 82/878 (9%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKK-TAPNSNDFEGL----EVSFKQNI 55
           MKF  +IL+KS+P+WK  NI+YE+LK  IK+VT+     PN +  E L     V+F Q  
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60

Query: 56  VQINLFVSLKLKEISSKLVSIEHSITKLLD--NEINDNRKVLRRIKTIKNYLETCNDLLQ 113
             +NLFVSLK+KEIS++++S+E SI       N+ + NR  LR++K I  +++ CN  LQ
Sbjct: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120

Query: 114 KLSRFVIVQRIALRKLFKKITKHYGDKK----IAQQFISSIQNCNELRDGYEGVSFKNLD 169
            LSRF+I+QRIALRKLFKK+   +         A ++++SI+N   LR+G+EG+SF  LD
Sbjct: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180

Query: 170 LQSYLVEVSLIMDILTDMTNAIKS-------------------TGNFKDLPSELFEKSKL 210
           L  YL+EVSLI+D+L D+ N ++                    T +  +  +     S  
Sbjct: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240

Query: 211 ITNATDNKKPLVSFTTNQQFDQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNL 270
                 NKK      ++ +FD  L DK E +   L+ S++ E LKF+L+ +GF++ D ++
Sbjct: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300

Query: 271 QGISRDIIASEPN---SEVRSLRSKKSFYESDRPALKRLHTSSTEYLNNAEEMEQSKCKA 327
              S++I+ +  N   +  +S+RS KSF  +D      L        +  +  E+    +
Sbjct: 301 ISTSKEILDTTDNINSAGNKSIRSAKSF--NDLQHTLSLSKQKNILPSAVQSNEKYVSIS 358

Query: 328 VMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHIN 387
           ++ T   +    +     I  +P++++    ++   + CIV+CHVGGLR  VVT+ L + 
Sbjct: 359 ILDTVGNEGSPLLLTDDNINQHPNMIV----SSTAEDTCIVMCHVGGLRNHVVTNDLLLR 414

Query: 388 EISEYLK-------NSNKQAI-----SDPLAKIALDWICDHGMKECGIEIGFKRTRYFCN 435
           ++   L          N  A+       P++KIAL+WI  H +K    ++ FKRTR+   
Sbjct: 415 DVKNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISA 474

Query: 436 KHSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVVTTNFSSDNKSLAK--KSQEIYEK 493
            + ++Y+I +DE  T+ + +      +   I++++ ++ +      ++ +  K +++ + 
Sbjct: 475 DNGDIYLIALDESITIGNVST-----LPFPILEIKKLSRSSGLSQTAINEDNKFKQLMKS 529

Query: 494 IISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLMLENIYELNENNKITEDEFFGIG 553
           +++++ QC    PD    K+ L +  +N  ++ + +L+L + Y+LN ++ ++ DEFF +G
Sbjct: 530 VVTNEFQCSLIPPDLTTWKICLELVHSNELQNDLFQLLLRDQYKLNSDDSLSPDEFFQLG 589

Query: 554 FDLLLDICSSEFK-----DNYYQKVESPTRTPXXXXXXXXXXXXXXXXXXXPAIRYWNEF 608
            D L      EF      +N    V+S  R                       IRYWNEF
Sbjct: 590 KDRL----EEEFDLTGPINNSQGSVDSGRRV-----RIHKKSKQSDNETKKKPIRYWNEF 640

Query: 609 DDLEEENGGGGFYI-----QDRTDDLESNELQQER-DYGFIHFSKDFIESTYSSLQSFRD 662
           D+ EE+N    FYI     +  TD+ ES  L+    DYGFI FS++FI  TY   +  R+
Sbjct: 641 DEQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRN 700

Query: 663 FLGFKDNNRTAIDPALLDLSERFGNSNYXXXXX-XXXXXXXXVEDIRKLIEHQMKEIENS 721
            +  + + +T+ D           ++NY               +D+++ +++Q ++IE+S
Sbjct: 701 LI--RHDKKTSPDLFQNSKHPHCSSTNYGSVASFGSQSTSASYDDVQRYLQYQQQDIEDS 758

Query: 722 ESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNG-DNSDIEIDVGKTXXXXXXX 780
           +S+Y Y+HD+V++ +YL ALL +C  + +C+GIVLS+F G  N++I++++          
Sbjct: 759 QSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQSNNEIDLEIQNILIAIIII 818

Query: 781 XXXXXXXXXXXXXXXXFSRYTYAPIWHYALSFAIFIMI 818
                           FSR+T APIWHY   F +F  +
Sbjct: 819 SLLVSLILICACLLLLFSRFTLAPIWHYVGCFTMFFSV 856

>Scas_636.12
          Length = 837

 Score =  355 bits (912), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 250/856 (29%), Positives = 434/856 (50%), Gaps = 70/856 (8%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLEVSFKQNIVQINL 60
           M F S +LDKSVP WK  N++Y++LKK I + T           E L+  FK+    INL
Sbjct: 1   MNFSSHVLDKSVPQWKHQNLEYDKLKKAIMRHTR---------LETLDAMFKEQFQNINL 51

Query: 61  FVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVI 120
           FVSLK+KEIS++++S+E SI +         RK     K + +++  CN+ LQ LSR++I
Sbjct: 52  FVSLKIKEISTRIMSVEASILQ------QTMRKGPSNFKIVFSHVNDCNEELQMLSRYLI 105

Query: 121 VQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLI 180
           VQ++A++KL +++   +    + +++++ +   ++ ++GY+GVSF  LDL  YL+E+SLI
Sbjct: 106 VQKLAVKKLLRRLISSHDGSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLI 165

Query: 181 MDILTDMTNAIKSTGNFKDLPSELF-EKSKLITNATDNKKPLVSFTTNQQ--------FD 231
           +D+L D+   + +T N  D+ S L   K     N   N+ P  S   N +        FD
Sbjct: 166 VDVLNDLKLKV-TTNNNNDVSSTLLTSKHNETLNLRSNENP-PSIQNNGEDIIRSAIDFD 223

Query: 232 QVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIAS----EPNSEV- 286
            +  DK   +  L+V ++N E+ KF+L++  F++ D  L   S+DII S     PN  V 
Sbjct: 224 TIFMDKCLPLHRLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVK 283

Query: 287 RSLRSKKSFYESDRPALKRLHTSSTEYLNNAEEMEQSK----CKAVMLTPSGKVDSSIYD 342
           +S+ S +SF        +R +++++        +  S+       + L P+G V   + D
Sbjct: 284 KSMASIRSFQTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTG-VPRFMKD 342

Query: 343 SKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSNKQAIS 402
                  P++L+  +  N+  N CI++CH+GGLR  +VT+ + +  I++ L    K +I 
Sbjct: 343 D-AFNQSPTLLIHLQDTNISPN-CILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIP 400

Query: 403 ------DPLAKIALDWICDHGMKECGIEIGFKRTRYFCNKHSNLYMITIDEEFTLSDSNG 456
                 +P+  +AL+WI +  ++  G++I  KRTR   +     Y+I+IDE+  ++ ++ 
Sbjct: 401 PSNSNFNPIDNMALEWIMNQKLRHTGMKIDIKRTRLIFSTEEFTYLISIDEKICITFND- 459

Query: 457 QTEKL-MDHSIIDLRVVT---------TNFSSDNKSLAKKSQEIYEKIISSKIQCFPFQP 506
             EK    HSI+++++++          N ++  KS+ +K Q I+ ++    IQCF    
Sbjct: 460 --EKFYFPHSIVEIKLLSKKSPSSMHANNINNPTKSMNEKLQHIFREVYEKNIQCFSLDR 517

Query: 507 DFHPVKLLLSIHE-NNGSKDVIHRLMLENIYELNENNKITEDEFFGIGFDLLLDICSSEF 565
           ++   K+  SI +  N + + + +L+L+  Y L  N+ ++ +EFF +G D +L++C   F
Sbjct: 518 NWTLWKICYSICQLPNVNDNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPF 577

Query: 566 KDNYYQKVESPTRTPXXXXXXXXXXXXXXXXXXXPAIRYWNEFDDLEEE-NGGGGFYIQD 624
           ++    K +S  ++                       RYWNEFDD +   N     + QD
Sbjct: 578 QEEIRNKSQS--QSTHSNFKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQD 635

Query: 625 RTDDLESNELQQERDYGFIHFSKDFIESTYSSLQSFRDFLGFKDNNRTAIDPALLDLSER 684
             + + S E     D+G + F++ FI+S +   +S +  +      R        D +  
Sbjct: 636 EDESICSQE-----DHGLVTFNRPFIDSMFDKFKSIKSMI--IPRKRKQRKKRQQDGTSI 688

Query: 685 FGNSNYXXXXXXXXXXXXXVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFALLMA 744
           +G++                 D+  L+E+    ++ SES+Y +KHDQVL++ YL +LL++
Sbjct: 689 YGSTYVLGSRSTLTLSPGSESDLEALLEYDPSNVQESESIYEFKHDQVLTVFYLASLLIS 748

Query: 745 CATSGICMGIVLSVFNGDNSD--IEIDVGKTXXXXXXXXXXXXXXXXXXXXXXXFSRYTY 802
           C TSG+C+GIVL++F    +D  I  D                           FSR+T 
Sbjct: 749 CMTSGLCLGIVLALFRESENDDVIVFDGINFLLAVIIGSLLVSLILIIVSLLLLFSRFTL 808

Query: 803 APIWHYALSFAIFIMI 818
           AP+WHY   F  FIM+
Sbjct: 809 APLWHYISCFVFFIMV 824

>Kwal_56.23410
          Length = 825

 Score =  331 bits (849), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 258/850 (30%), Positives = 423/850 (49%), Gaps = 70/850 (8%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKT--APNSNDFEGLEV-----SFKQ 53
           MKFGSQI +KSVP+W+LNNIDY+ LK+ +K VT+ K    P S+  E  E+     +F+ 
Sbjct: 1   MKFGSQIYEKSVPEWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQT 60

Query: 54  NIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQ 113
               +N FV +K+KE S++LVS+E SI +L       +R   R++  I ++L+ CN  L 
Sbjct: 61  QFRNVNDFVGMKIKEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELL 120

Query: 114 KLSRFVIVQRIALRKLFKKITKHYG-DKKIAQQFISSIQNCNELRDGYE-GVSFKNLDLQ 171
           ++ RF+I+Q+IALRKL KK  K+Y  DK +A++F+  I NC ELR   E G+SF  LDL 
Sbjct: 121 RICRFLILQKIALRKLLKKFLKYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLD 180

Query: 172 SYLVEVSLIMDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFT-TNQQF 230
            YL+EVSL++D+L ++  A  ++G    L  E  +          +  P+ S   ++  F
Sbjct: 181 PYLLEVSLVVDVLQELEQA--ASGRKGSLTHETMKSEMPGEIEGAHSAPMASHADSDLAF 238

Query: 231 DQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRDIIASEPNSEV---- 286
           D +   K   +Q+ LV  ++  Q+KFLL+ LGF V D ++  +S+  +    ++ +    
Sbjct: 239 DSIFLGKASRLQAFLVADESISQMKFLLLQLGFHVVDDDMILVSQQSLKDSSSTSLTANG 298

Query: 287 ---RSLRSKKSFYESDRPALKRLHTSSTE--YLNNAEEMEQSKCKAVMLTPSGKVDSSIY 341
              ++ R+ KSF++       RL +   E   L    ++  S+   + +  S  V S + 
Sbjct: 299 TSGKTPRTVKSFHD------LRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLE 352

Query: 342 DSKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHINEISEYLKNSN---- 397
           D   I  +P++++    N     +C+V+CHVGGLR  +V++ +   +++  L N +    
Sbjct: 353 DD-AINRHPTIVV----NGSRTCKCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDTL 407

Query: 398 ----KQAISDPLAKIALDWICDHGMKECGIEIGFKRTRYF-CNKHSNL--YMITIDEEFT 450
               +  ++ P+ K+ L+WI  H + +CG +I  +RTR+       NL  Y++ +DE   
Sbjct: 408 ETESETEVTTPIGKLCLEWIKSHSLHQCGPKISTQRTRFTKAVGEPNLTEYLVCVDESIV 467

Query: 451 LSDSNGQTEKLMDHSIIDLRVVTTNFSSDNKSLAKKS--QEIYEKIISSKIQCFPFQPDF 508
           L+ S     K + H+++++R   +      K   K      + EK+  + I C+P + D 
Sbjct: 468 LAGS-----KKVPHAVVEIRSQQSGGMLHRKEGYKDELITTLIEKMYENHISCYPLKEDQ 522

Query: 509 HPVKLLLSIHENNGSKDVIHRLMLENIYELNENNKITEDEFFGIGFDLLLDICSSEFKDN 568
              KLL   ++   ++D+   L       L   N    +  F IG   L  + +++ +  
Sbjct: 523 TLWKLL---YQAANAEDLKSGLFSAACPSLTSFNS---ESIFEIGESELSRMIAAKGEQ- 575

Query: 569 YYQKVESPTRTPXXXXXXXXXXXXXXXXXXXPAIRYWNEFDDLEEENGGGGFYIQDRTDD 628
             ++     + P                   P IRYWNEFD+  EE G   FY      D
Sbjct: 576 --RRASFAGKKP--KSRKTKEQLISPQANSKPPIRYWNEFDN-GEEAGNESFY-----RD 625

Query: 629 LESNELQQERDYGFIHFSKDFIESTYSSLQSFRDFLGFKDNNRTAIDPALLDLSERFGNS 688
            E+   + E D GFI F+++FI +TY+  +S R FL    ++     P L D S+   + 
Sbjct: 626 TEAMPFEGEMDNGFIVFNRNFINATYNFSESLRRFLTL-SSDEPEKRPLLTD-SQHRQSI 683

Query: 689 NYXXXXXXXXXXXXXVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFALLMACATS 748
           N                D  + I + +++ E+S+SVY +KHDQV++  YL +LL++C TS
Sbjct: 684 NSFTTSSSLNTTSSAERDYNRYINYTIEQ-EDSQSVYEFKHDQVVTFFYLSSLLVSCITS 742

Query: 749 GICMGIVLSVFNGDNSDIEIDVGKTXXXXXXXXXXXXXXXXXXXXXXXFSRYTYAPIWHY 808
           GI +GIV S+F   N DI    G                         FSR+ +AP WHY
Sbjct: 743 GISLGIVASLFRELNDDIVFGAGPGLLTVIIATLLTSLILSCASLLLLFSRFKFAPWWHY 802

Query: 809 ALSFAIFIMI 818
              F IF+++
Sbjct: 803 VGCFLIFLVV 812

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score =  326 bits (836), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 255/871 (29%), Positives = 424/871 (48%), Gaps = 106/871 (12%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTA------PNS----NDFEGLEVS 50
           MKFG+QILDKSVP+WKL+NIDY++LK  I++ T+ +        PNS     +   L+  
Sbjct: 1   MKFGTQILDKSVPEWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKL 60

Query: 51  FKQNIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCND 110
           F+     IN+F+S+KLKE S+++VSIE+ +T+L  + I D  K LRRIK I  +L+ CN 
Sbjct: 61  FRSQFEMINVFISMKLKECSTRIVSIENYLTQL--HLIKDENKKLRRIKLINQHLDRCNL 118

Query: 111 LLQKLSRFVIVQRIALRKLFKKITKHYG-DKKIAQQFISSIQNCNELRDGYEGVSFKNLD 169
            LQKLSR++I+Q+IA+RKLFKK  KHY    ++AQ+FI+S++NC E ++G+EGVS   +D
Sbjct: 119 ELQKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVD 178

Query: 170 LQSYLVEVSLIMDILTDMTNAIKS----TGNFKDLPSELFEKSKLITNA--TDNKKPLVS 223
           L  YL+E+SLI+D+L +M          +GN K   +     S+  +N   T    P   
Sbjct: 179 LDPYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNT---SNSRANSNVGITSGTAPSSR 235

Query: 224 FTTNQ----------QFDQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGI 273
            ++            +FD     K   + S L+  ++ +++KFLLI LGF +FD ++   
Sbjct: 236 KSSVVSSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIAT 295

Query: 274 SRDIIASEPNSEVR--SLRSKKSFYESDR----PALKRLHTSSTEYLNNAEEMEQSK--- 324
           S+ I++ +     R  S++S + F ++ R     + +R  T S+  + + E    S    
Sbjct: 296 SKKILSGDALLSKRKGSIKSLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGSNRSQ 355

Query: 325 --------CKAVMLTPSGKVDSSI---YDSKKITSYPSVLLEYEKNNVIANECIVICHVG 373
                      ++  P  K  + +   Y+S +   +P++L+ Y      +N+ I++CHVG
Sbjct: 356 QLSNSSSSAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPS----SNDSILLCHVG 411

Query: 374 GLRGKVVTDKLHINEISEYLKNSNKQ--AISDPLAKIALDWICDHGMKECGIEIGFKRTR 431
           GLR  + TD +   +I   L         +S+ L +   DW   H +K   + I  +R+R
Sbjct: 412 GLRNHISTDTIEYTDIKAVLNGCEPSLMPVSNRLDEFCRDWCYSHNLKTTDLVIKCRRSR 471

Query: 432 YFCNKHS----NLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVV--TTNFSSDNKSLAK 485
           +  +  S    N Y+I ID+   ++D+       +  ++++++++  T++ S  NK+ +K
Sbjct: 472 FIISHSSIETNNDYLICIDDNIEINDNK------LPFAVLEVKILEATSSSSVPNKTYSK 525

Query: 486 KS-----QEIYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIH-RLMLENIYELN 539
           K       ++ EK+++  +  +P   +F   ++   I   +     +   L  E++    
Sbjct: 526 KHIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESV---- 581

Query: 540 ENNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPT--RTPXXXXXXXXXXXXXXXXX 597
                  +E FG G  LL      +  D Y   +  PT   +                  
Sbjct: 582 -------EEMFGAGNALL-----KKTHDRYQSLLNPPTIEFSQSSSQNTAVNISPTVTER 629

Query: 598 XXPAIRYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIHFSKDFIESTYSSL 657
             P IRYWNEFDD EE      +   D  DD      +   D G I F+  FI + Y  L
Sbjct: 630 EKPRIRYWNEFDDGEEAMDQDFYSCLDEDDD------EYTHDTGLIRFNPSFIIAIYHLL 683

Query: 658 QSFRDFLGFKDNNRTAIDPALLDLSERFGNSNYXXXXXXXXXXXXXVEDIRKLIEHQMKE 717
             F+   G  D+ + A    L D  + + + +                D+ K  E    E
Sbjct: 684 SKFQIAFGIIDDVQ-ARKSLLRDAGKSYNSIDTDTSILTSSSSER--NDVNKFWE---LE 737

Query: 718 IENSESVYVYKHDQVLSLMYLFALLMACATSGICMGIVLSVFNGDNSDIEIDVGKTXXXX 777
            +NSES+Y ++HDQV+S  Y+ +LL++C T+G+ +GI+ S+F   N D +++   +    
Sbjct: 738 EQNSESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFKSLNDDTQLENETSILTM 797

Query: 778 XXXXXXXXXXXXXXXXXXXFSRYTYAPIWHY 808
                              FSR+T+AP WHY
Sbjct: 798 IFISLSISLILGAWSLLLMFSRFTFAPTWHY 828

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score =  261 bits (667), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 214/855 (25%), Positives = 382/855 (44%), Gaps = 104/855 (12%)

Query: 14  DWKLNNIDYEELKKIIKQVTSKKTAPNSND---FEGLEVSFKQNIVQINLFVSLKLKEIS 70
           +W LN +DYE L++ +++ T+        D      L  +F+  +  +NLFVSLK++EI+
Sbjct: 23  EWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLLGAFRAELSNVNLFVSLKMREIT 82

Query: 71  SKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVIVQRIALRKLF 130
           ++L ++E  I +    ++ +      R++     L  C+  LQ+L+R++++Q+ ALRKL 
Sbjct: 83  ARLETVEAGIVEWRRRKVGEPGARALRLRRANGQLAQCSADLQRLARYLLLQKAALRKLT 142

Query: 131 KKITKHYG-DKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLIMDILTDMTN 189
           +++ ++Y  D+   + F++++  C+EL+ G+EGV F  +DL+ YL+EVSLIM +L D+  
Sbjct: 143 RRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDLEPYLLEVSLIMGVLYDLEM 202

Query: 190 AIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQFDQVLWDKGELIQSLLVRSD 249
             +S    ++ P+ +              +P+ S  T   FD +   K  L+Q LL+  D
Sbjct: 203 KDRSVERAREPPNNVL------------GRPITSCLT---FDTLFLGKYHLLQRLLISQD 247

Query: 250 NNEQLKFLLITLGFQVFDQNLQGISRDII-----ASEPNSEVRSLRSKKSF-YESDRPAL 303
           N  +LKFLL+ L +Q+ D ++   SR +        +P       +S + F + + RPA 
Sbjct: 248 NVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDFGAARPAR 307

Query: 304 KRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNNVIA 363
            R ++S  + L    ++          T    +D      +    +P++ +  ++++   
Sbjct: 308 MRRNSSLPDKLRTLSQLR---------THMYPLDKQFMTDEAYNQHPNIFVRGQQDDA-- 356

Query: 364 NECIVICHVGGLRGKVVTDKLHINEISEYLKN---SNKQAISDPLAKIALDWICDHGMKE 420
             C+++CHVGG+R  ++T  L +  + E L     S+K      L K+ LDW+  + +  
Sbjct: 357 --CLLMCHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSALDKLCLDWVRTNNLGL 414

Query: 421 CGIEIGFKRTRYFCNK--------HSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVV 472
               I  KRTR+F  +         +++Y+IT+DEE  +++    T KL  H+ +++R +
Sbjct: 415 SDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINN----TLKL-PHAFVEVRKL 469

Query: 473 TTNFSSDNKSLAKKSQE---IYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHR 529
           T    + NKS  K   E   + + I+   + C+P  P     K+  S+ +    +  I R
Sbjct: 470 TNTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEE--IER 527

Query: 530 LMLENI--YELNENNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPTRTPXXXXXXX 587
            M   +   +  +++ I+ D  F IG   L  + +             P RTP       
Sbjct: 528 SMYAALAAADFQDSSNISGDILFSIGRRRLDQMSTPTV----------PQRTPSLAKSSH 577

Query: 588 XXXXXXXXXXXXPAI---RYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERDYGFIH 644
                             RYWNE D+  + +    FY     D  E +    E ++GFI 
Sbjct: 578 KSQDAQSPSSSGETPQRKRYWNELDEQNDADAQDCFY----RDPEELHTGDYEAEHGFIK 633

Query: 645 FSKDFIESTYSSLQSFRDFLGFKDN----------------NRTAIDPALLDLSERFGNS 688
           F K+FI + Y  L        ++                   R+ + P +   SE    S
Sbjct: 634 FDKNFILNFYQYLHKLNHIFCYQKKPPKEYTVVPCSGDSEITRSELTPLIRQNSEARSYS 693

Query: 689 NYXXXXXX----XXXXXXXVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFALLMA 744
                               +D   L+ +   ++     +Y YKHD+V+SL YL  LL++
Sbjct: 694 ALEVQSTLPGGGSQLQVPNWDDEAALVCYDELDV-----LYGYKHDEVVSLFYLTTLLVS 748

Query: 745 CATSGICMGIVLSVFNG-DNSDIEIDVGKTXXXXXXXXXXXXXXXXXXXXXXXFSRYTYA 803
           C T+G  +GI+ S+F+   N   E +                           FSRY  A
Sbjct: 749 CITTGTTVGIMFSLFSALGNDQTEFEGSNYITALILVSLVVSLMLSSFSLLLLFSRYHMA 808

Query: 804 PIWHYALSFAIFIMI 818
           P WHY+    +FI++
Sbjct: 809 PWWHYSSCIIVFILV 823

>YPL019C (VTC3) [5418] chr16 complement(514507..517014) Subunit of
           the vacuolar transporter chaperone (Vtc) complex (Vtc1p,
           Vtc2p, Vtc3p, Vtc4p), required for the final step of
           vacuolar fusion, involved in vacuolar polyphosphate
           accumulation [2508 bp, 835 aa]
          Length = 835

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 17/142 (11%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDF-EGLEVSFKQNIVQIN 59
           M FG ++ +   P WK + IDYE LKK++K+        + + + E  E  F + + +  
Sbjct: 1   MLFGIKLANDVYPPWKDSYIDYERLKKLLKESVIHDGRSSVDSWSERNESDFVEALDK-- 58

Query: 60  LFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTI-----KNYLETCNDLLQK 114
                +L+++ +  +S  +++ + LD ++ +N K   +I+ I     KN LE C D  Q+
Sbjct: 59  -----ELEKVYTFQISKYNAVLRKLD-DLEENTKSAEKIQKINSEQFKNTLEECLDEAQR 112

Query: 115 LSRFVIVQRIALRKLFKKITKH 136
           L  F    R+      K + KH
Sbjct: 113 LDNF---DRLNFTGFIKIVKKH 131

>Kwal_27.12292
          Length = 217

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTS 34
          MKFG    +  VP+W    ++Y+ LKK+IK++T+
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKNLKKLIKEITT 34

>Sklu_2202.8 YPL110C, Contig c2202 8829-12932
          Length = 1367

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVT 33
          MKFG    +  VP+W    ++Y+ LKK+IKQ+T
Sbjct: 1  MKFGKTFPNHQVPEWSHQYVNYKGLKKLIKQIT 33

>YPL110C (YPL110C) [5334] chr16 complement(341067..344738) Member
          of the glycerophosphoryl diester phosphodiesterase
          family, contains six ankyrin (Ank) repeats and a SYG1,
          Pho81 and XPR1 (SPX) N-terminal domain, has weak
          similarity to S. cerevisiae Pho81p, which is a
          cyclin-dependent kinase (CDK) inhibitor [3672 bp, 1223
          aa]
          Length = 1223

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVT 33
          MKFG    +  +P+W    + Y+ LKK+IK++T
Sbjct: 1  MKFGKTFANHRIPEWSSQYVGYKSLKKMIKEIT 33

>KLLA0F00660g 54232..58356 similar to sgd|S0006031 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1374

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTS 34
          MKFG    +  VP+W    ++Y+ LKK+IK++ +
Sbjct: 1  MKFGKTFPNHQVPEWSHEYVNYKSLKKLIKEIVA 34

>CAGL0J07040g 675389..679126 similar to tr|Q02979 Saccharomyces
          cerevisiae YPL110c, start by similarity
          Length = 1245

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVT 33
          MKFG  +L   +P+W    ++Y+ LKKI+K++T
Sbjct: 1  MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEIT 33

>AGR223W [4534] [Homologous to ScYPL110C - SH]
          complement(1167870..1171835) [3966 bp, 1321 aa]
          Length = 1321

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVT 33
          MKFG    +  VP+W    ++Y+ LKK IK++T
Sbjct: 1  MKFGKTFPNHQVPEWAHKYVNYKGLKKQIKEIT 33

>CAGL0E01617g 154719..157130 similar to sp|Q08269 Saccharomyces
           cerevisiae YOL130w divalent cation transporter, start by
           similarity
          Length = 803

 Score = 33.9 bits (76), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 458 TEKLMDHSIIDLRVVTTNFSSDNKSLAKKSQEIYEKIISSKIQCFPFQPDFH 509
           + K +D   +  ++   +FSSDN   +++SQE  E +      CFP  P  H
Sbjct: 191 SHKSVDDDNLKRKITRASFSSDNSQASRESQETEEDV------CFPMPPQLH 236

>AGL020W [4291] [Homologous to ScYFL004W (VTC2) - SH; ScYPL019C
           (VTC3) - SH] complement(682963..685497) [2535 bp, 844
           aa]
          Length = 844

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 89/212 (41%), Gaps = 45/212 (21%)

Query: 1   MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKK--------------------TAPN 40
           M FG ++ +   P WK   IDY+ LKK++K+   K                     TA N
Sbjct: 1   MLFGVKLANDIYPPWKDWYIDYDGLKKLLKESVIKDLGLSPKESKRKGKGDTDEHWTARN 60

Query: 41  SNDF-EGLEVSFKQNIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIK 99
            ++F E L+    + + ++  F S K  EI  KL  +E  +         D    L+ + 
Sbjct: 61  ESNFVEALD----RELEKVYSFQSGKYTEIMGKLERLEEEL---------DGADALQSLD 107

Query: 100 T--IKNYLETCNDLLQKLSRFVIVQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELR 157
              I+  LE      Q+L RF    R+      K + KH    K+ + +  S+++  ++R
Sbjct: 108 LGHIREELEQALTEAQELDRF---SRLNFTGFIKIVKKH---DKLHEGY-PSVKSLLQVR 160

Query: 158 DGYEGVSFKNLDLQSYLVEVSLIMDILTDMTN 189
              + + F + +    L ++S + D+L   T+
Sbjct: 161 --LKALPFHSEEYSPLLYKISFLYDVLRKSTD 190

>KLLA0E12133g 1076424..1078949 similar to sp|P43585 Saccharomyces
          cerevisiae YFL004w VTC2 putative polyphosphate
          synthetase, start by similarity
          Length = 841

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 23/31 (74%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQ 31
          M FG ++ + + P W+ + IDYE+LKK++K+
Sbjct: 1  MLFGVKLANDTYPPWRDSYIDYEKLKKLLKE 31

>Scas_707.27
          Length = 836

 Score = 33.5 bits (75), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 26/43 (60%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSND 43
          M FG ++ +   P W+ + IDYE LKK++K+   +  A  ++D
Sbjct: 1  MLFGVKLANDIYPPWRESYIDYERLKKLLKENIIRDNATTTSD 43

>Scas_704.39
          Length = 916

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSK 35
          MKFG  + +  +P+WK   IDY+  KK IK   +K
Sbjct: 1  MKFGDHLRESIIPEWKDKYIDYKSSKKRIKHFRAK 35

>Scas_698.40
          Length = 150

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 166 KNLDLQSYLVEVSLIMDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNK 218
           KNL LQ Y ++     D+L D+   IK+ G+F+   +  F+  K+ T+A  +K
Sbjct: 40  KNLILQDYNLQTKTGYDLLQDVLQHIKTDGSFRPFRNVNFDTMKIYTHAHGSK 92

>Kwal_23.5060
          Length = 835

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 22/31 (70%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQ 31
          M FG ++ ++  P W+ + I+YE LKK++K+
Sbjct: 1  MLFGVRLANQMYPPWRDSYIEYERLKKLLKE 31

>KLLA0E15774g 1402940..1406386 similar to sp|P17442 Saccharomyces
          cerevisiae YGR233c PHO81 cyclin-dependent kinase
          inhibitor singleton, start by similarity
          Length = 1148

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 4/52 (7%)

Query: 1  MKFGSQILDKSV--PDWKLNNIDYEELKKIIKQ--VTSKKTAPNSNDFEGLE 48
          MKFG  +  + +  P++  + I+Y+ LKK+IKQ  V +  +  NSND+  L+
Sbjct: 1  MKFGKHLEGRQLELPEYNGHFINYKALKKLIKQLSVPAVSSYTNSNDYMTLD 52

>Kwal_23.6370
          Length = 318

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 499 IQCFPFQPDFHPVKLLLSIHENNGSKDVIHRLML---ENIYELNENNKIT 545
           +  FPFQ  F     L  + E + S DV+H++     ENI+    N+++T
Sbjct: 122 VMAFPFQLAFDEFTRLCQLPEGSNSSDVVHQIQYRDDENIFIKPSNDRVT 171

>Kwal_27.12751
          Length = 1093

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 1  MKFGSQILDK--SVPDWKLNNIDYEELKKIIKQVTSKKTA 38
          MKFG  +  +  ++P++  + IDY+ LKK+IKQ++    A
Sbjct: 1  MKFGKHLETRQLALPEYNGHFIDYKSLKKLIKQLSVSGAA 40

>YFL004W (VTC2) [1677] chr6 (131805..134291) Subunit of the
          vacuolar transporter chaperone (Vtc) complex (Vtc1p,
          Vtc2p, Vtc3p, Vtc4p), involved in vacuolar
          polyphosphate accumulation [2487 bp, 828 aa]
          Length = 828

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSK 35
          M FG ++ ++  P WK + I+YE LKK +K+ + K
Sbjct: 1  MLFGVKLANEVYPPWKGSYINYEGLKKFLKEDSVK 35

>CAGL0F02145g 213561..216011 similar to sp|P43585 Saccharomyces
          cerevisiae YFL004w VTC2 or sp|P47075 Saccharomyces
          cerevisiae YJL012c VTC4, start by similarity
          Length = 816

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQ 31
          M FG ++  +  P WK + IDY+ LK+++K+
Sbjct: 1  MLFGVRLASEVYPPWKQSYIDYDGLKELLKE 31

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
          cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDF 44
          MKF   +   SVP+W    I Y +LKK+I  +  +K   ++ D 
Sbjct: 1  MKFSHSLQFNSVPEWSSKYIAYSQLKKLIYSLQKEKLYSSTPDL 44

>CAGL0I03960g 346238..349339 similar to sp|P17255 Saccharomyces
           cerevisiae YDL185w TFP1, start by similarity
          Length = 1033

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 8/53 (15%)

Query: 295 FYESDRPALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKIT 347
           FY+S+ P    L     E L+NAEE+EQ     V L   GK  S++ DS KIT
Sbjct: 887 FYDSNYPEFPTLRDRMKEILSNAEELEQ----VVQLV--GK--SALSDSDKIT 931

>Kwal_56.24421
          Length = 406

 Score = 30.0 bits (66), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 8/53 (15%)

Query: 295 FYESDRPALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKIT 347
           +YE++ P   +L     E L+NAEE+EQ     V L   GK  S++ DS KIT
Sbjct: 260 YYENNHPEFPQLRNRIREILSNAEELEQ----VVQLV--GK--SALSDSDKIT 304

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
          cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 1  MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDFEGLE 48
          MKF   +   +VP+W    I Y +LKK+I  +  +K   ++++   LE
Sbjct: 1  MKFSHSLQFNAVPEWTTKYIGYSQLKKLIYTLQKEKLYRSTSESSDLE 48

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.135    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,262,939
Number of extensions: 1177051
Number of successful extensions: 4821
Number of sequences better than 10.0: 120
Number of HSP's gapped: 4961
Number of HSP's successfully gapped: 123
Length of query: 819
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 709
Effective length of database: 12,788,129
Effective search space: 9066783461
Effective search space used: 9066783461
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)