Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02189g44944223350.0
YER043C (SAH1)44944221610.0
Sklu_2433.1944944221470.0
Scas_687.2144944221260.0
AFR243C44944221220.0
Kwal_47.1918044944220940.0
KLLA0A01199g44944220840.0
YCR045C491213770.21
YKL060C (FBA1)35987710.89
CAGL0M12837g46691682.1
CAGL0C01353g89743692.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02189g
         (442 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02189g 222418..223767 highly similar to sp|P39954 Saccharo...   904   0.0  
YER043C (SAH1) [1469] chr5 complement(235769..237118) Adenosylho...   837   0.0  
Sklu_2433.19 YER043C, Contig c2433 31749-33098                        831   0.0  
Scas_687.21                                                           823   0.0  
AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH] (876308..87...   822   0.0  
Kwal_47.19180                                                         811   0.0  
KLLA0A01199g 111159..112508 highly similar to sp|P39954 Saccharo...   807   0.0  
YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member o...    34   0.21 
YKL060C (FBA1) [3199] chr11 complement(326053..327132) Fructose-...    32   0.89 
CAGL0M12837g 1265948..1267348 highly similar to sp|P40510 Saccha...    31   2.1  
CAGL0C01353g complement(142575..145268) similar to sp|P40482 Sac...    31   2.3  

>CAGL0C02189g 222418..223767 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1, start by
           similarity
          Length = 449

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/442 (98%), Positives = 435/442 (98%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTWTSCNIYSTQDH       SGVPVFAWKGETEEEYMWCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYMWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG
Sbjct: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           VKLTTLSDVQSEYLGIPQQGPF
Sbjct: 421 VKLTTLSDVQSEYLGIPQQGPF 442

>YER043C (SAH1) [1469] chr5 complement(235769..237118)
           Adenosylhomocysteinase (S-adenosylhomocysteine
           hydrolase) [1350 bp, 449 aa]
          Length = 449

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/442 (90%), Positives = 419/442 (94%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MSAPAQNYKIADISLAAFGRKEIELAE+EMPGLMAIRKAY + QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIRKAYGDVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKDNKKLNLILDDGGDLT+ VHEK+PEML DCFGLSEETTTGVHHLYRM++EGKLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLEDCFGLSEETTTGVHHLYRMVKEGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVND+VTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAG+GDVGKGCAA+LRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RVLVTEIDPINALQAAMEGY+V TMEDA+ +GQVFVTTTGCRDII GEHF  MPEDAIVC
Sbjct: 241 RVLVTEIDPINALQAAMEGYQVVTMEDASHIGQVFVTTTGCRDIINGEHFINMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFKS+DK+FR K +EF+KTGPFEVGVHVLPKILDEAVAKFHL  LG
Sbjct: 361 MSCSFSNQVLAQIALFKSNDKSFREKHIEFQKTGPFEVGVHVLPKILDEAVAKFHLGNLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           V+LT LS VQSEYLGIP++GPF
Sbjct: 421 VRLTKLSKVQSEYLGIPEEGPF 442

>Sklu_2433.19 YER043C, Contig c2433 31749-33098
          Length = 449

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/442 (89%), Positives = 420/442 (95%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MSAPAQNYKIADISLAAFGRKEIELAE+EMPGLMAIR+AYAEAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKIADISLAAFGRKEIELAEHEMPGLMAIREAYAEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKD KKLNLILDDGGDLTS VHEK+PEML DCFG+SEETTTGVHHLYRM++E KLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHEKHPEMLEDCFGISEETTTGVHHLYRMVKEAKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVND+VTKSKFDNLYGCRESL+DGIKRATDVMLAGKVAVVAG+GDVGKGCAA+LRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+V  ME+AAS GQVFVTTTGCRDII  EHF  MPEDAIVC
Sbjct: 241 RVVVTEIDPINALQAAMEGYQVIPMEEAASFGQVFVTTTGCRDIITSEHFLSMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NAKECINIKPQVDRYLLSSG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLSSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFK++DK FR K++EF+KTGPFE+GVHVLPKILDEAVAKFHL+KLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDKEFREKYIEFQKTGPFELGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           VKLT LSDVQSEYLGIPQ+GP+
Sbjct: 421 VKLTQLSDVQSEYLGIPQEGPY 442

>Scas_687.21
          Length = 449

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/442 (87%), Positives = 416/442 (94%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MSAPAQNYK+ADISLAAFGRKEIELAE+EMPGLMAIRKAYA  QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAQNYKVADISLAAFGRKEIELAEHEMPGLMAIRKAYAGVQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAASAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKD KKLNLILDDGGDLTS VH+K+PEML DCFGLSEETTTGVH+LY+M++E +LKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTSLVHDKHPEMLDDCFGLSEETTTGVHYLYKMVKENRLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVND+VTKSKFDNLYGCRESL+DGIKRATDVMLAGKVAVVAG+GDVGKGCAA+LRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RV+VTE+DPINALQAAMEGY+V TME A+++GQ+FVTTTGCRDII G HF  MPEDAIVC
Sbjct: 241 RVIVTEVDPINALQAAMEGYQVDTMESASNIGQIFVTTTGCRDIITGAHFANMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NAKECINIKPQVDRYLL +GRHVILLANGRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECINIKPQVDRYLLPTGRHVILLANGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFK+DDKAFR K +EF+KTGPF VGVHVLPKILDEAVAKFHL+KLG
Sbjct: 361 MSCSFSNQVLAQIALFKADDKAFREKHIEFQKTGPFTVGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           V+LT LSD QSEYLG+PQ+GP+
Sbjct: 421 VQLTKLSDTQSEYLGVPQEGPY 442

>AFR243C [3435] [Homologous to ScYER043C (SAH1) - SH]
           (876308..877657) [1350 bp, 449 aa]
          Length = 449

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/442 (87%), Positives = 417/442 (94%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MS PAQNYK+AD+SLAAFGRKEIEL+E+EMPGLMAIRKAY +AQPLKGARIAGCLHMTIQ
Sbjct: 1   MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTWTSCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKD KKLNLILDDGGDLT+ VHEKYPEML DCFG+SEETTTGVHHLYRM++EGKLKVPA
Sbjct: 121 AFKDGKKLNLILDDGGDLTTLVHEKYPEMLDDCFGVSEETTTGVHHLYRMLKEGKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVND+VTKSKFDNLYGCRESLVDG+KRATDVMLAGKVAVVAG+GDVGKGCAA+LRGMGA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKVAVVAGYGDVGKGCAAALRGMGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+VTTM+  AS GQVFVTTTGCRDIIK EHF  MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFVTTTGCRDIIKKEHFLAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NA E +NIKPQVDRYLLSSGRHVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLSSGRHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFK++D+AFR K++EF+KTGPF++GVHVLPKILDEAVAKFHL+KLG
Sbjct: 361 MSCSFSNQVLAQIALFKANDEAFRQKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDKLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           VKLT LS  QSEYLGIP++GPF
Sbjct: 421 VKLTKLSSTQSEYLGIPEEGPF 442

>Kwal_47.19180
          Length = 449

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/442 (86%), Positives = 415/442 (93%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MS+PAQN K+ADISLAAFGRKEIELAE+EMPGLMAIR+AY EAQPLKGARIAGCLHMTIQ
Sbjct: 1   MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIREAYGEAQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKDNKKLNLILDDGGDLT+ VHEK+PEML DCFGLSEETTTGVHHLYRM+++ KLKVPA
Sbjct: 121 AFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEETTTGVHHLYRMVKDAKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVNDAVTKSKFDNLYGCRESL+DGIKRATDVMLAGKV+VVAG+GDVGKGCAA+LRGMG+
Sbjct: 181 INVNDAVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVAGYGDVGKGCAAALRGMGS 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+V  ME+A S+GQVFVTTTGCRDII  EHF  MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVCPMEEAVSIGQVFVTTTGCRDIITAEHFMAMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NAKEC+NIKPQVDR+LL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANAKECVNIKPQVDRFLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFK+ D  FR K++EF+KTGPFE+GVHVLPKILDEAVAKFHL KLG
Sbjct: 361 MSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIGVHVLPKILDEAVAKFHLGKLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           V+LT LS+VQSEYLGIP++GP+
Sbjct: 421 VRLTKLSEVQSEYLGIPEEGPY 442

>KLLA0A01199g 111159..112508 highly similar to sp|P39954
           Saccharomyces cerevisiae YER043c SAH1
           S-adenosyl-L-homocysteine hydrolase singleton, start by
           similarity
          Length = 449

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/442 (86%), Positives = 412/442 (93%)

Query: 1   MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQPLKGARIAGCLHMTIQ 60
           MSAPA NYK+ADISLAAFGRKEIELAE+EMPGL+AIR+AY   QPLKGARIAGCLHMTIQ
Sbjct: 1   MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQPLKGARIAGCLHMTIQ 60

Query: 61  TAVLIETLVALGAEVTWTSCNIYSTQDHXXXXXXXSGVPVFAWKGETEEEYMWCIEQQLF 120
           TAVLIETLVALGAEVTW+SCNIYSTQDH       SGVPVFAWKGETEEEY+WCIEQQLF
Sbjct: 61  TAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFAWKGETEEEYLWCIEQQLF 120

Query: 121 AFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEETTTGVHHLYRMMREGKLKVPA 180
           AFKD+KKLNLILDDGGDLTS VH+KYP+ML DCFGLSEETTTGVHHLYRM++E KLKVPA
Sbjct: 121 AFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEETTTGVHHLYRMVKENKLKVPA 180

Query: 181 INVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAGFGDVGKGCAASLRGMGA 240
           INVND+VTKSKFDNLYGCRESL+DGIKRATDVMLAGKVAVVAG+GDVGKGCAA+LRG GA
Sbjct: 181 INVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVAVVAGYGDVGKGCAAALRGFGA 240

Query: 241 RVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKGEHFEKMPEDAIVC 300
           RV+VTEIDPINALQAAMEGY+V  ME+A S GQVFVTTTGCRDII  EHF +MPEDAIVC
Sbjct: 241 RVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFVTTTGCRDIITKEHFLQMPEDAIVC 300

Query: 301 NIGHFDIEIDVAWLKENAKECINIKPQVDRYLLSSGRHVILLANGRLVNLGCATGHSSFV 360
           NIGHFDIEIDVAWLK NA E INIKPQVDRYLL SG+HVILLA+GRLVNLGCATGHSSFV
Sbjct: 301 NIGHFDIEIDVAWLKANATEVINIKPQVDRYLLPSGKHVILLADGRLVNLGCATGHSSFV 360

Query: 361 MSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEVGVHVLPKILDEAVAKFHLEKLG 420
           MSCSFSNQVLAQIALFK+ DKAFR K++EF+KTGPF++GVHVLPKILDEAVAKFHL+ LG
Sbjct: 361 MSCSFSNQVLAQIALFKAQDKAFREKYIEFQKTGPFDIGVHVLPKILDEAVAKFHLDNLG 420

Query: 421 VKLTTLSDVQSEYLGIPQQGPF 442
           VKLT LSDVQSEYLGIP++GP+
Sbjct: 421 VKLTKLSDVQSEYLGIPEEGPY 442

>YCR045C (YCR045C) [578] chr3 complement(208130..209605) Member of
           the subtilase family of serine proteases, has moderate
           similarity to S. pombe Isp6p, which is a putative
           subtilase-type proteinase involved in sexual
           differentiation [1476 bp, 491 aa]
          Length = 491

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 89/213 (41%), Gaps = 35/213 (16%)

Query: 228 GKGCAASLRGMGARVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFVTTTGCRDIIKG 287
           GK C A+L     R       PI  +  A+EG        A   G VFV   G  ++   
Sbjct: 262 GKKCVANLSLGSFR------SPI--INMAVEG--------AIEEGIVFVAAAGNFNL--- 302

Query: 288 EHFEKMPEDA-IVCNIGHFDIEIDVAWLKENAKECINI-KPQVDRYLLSS-GRHVILLAN 344
           + +   P  A  V  +G FD  ID      N   C+NI  P V+   LS    +  L+ +
Sbjct: 303 DAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLILS 362

Query: 345 GRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSDDKAFRTKFVEFEKTGPFEV---GVH 401
           G  ++    TG ++ ++S     +++AQ   + S    F  + + F+ + P ++   GV 
Sbjct: 363 GTSMSTPIVTGVAAILLSKGIEPEMIAQEIEYLSTRNVFHRRTLFFKPSTPNQILYNGVD 422

Query: 402 VL---------PKILDEAVAKFHLEKLGVKLTT 425
            L         P++  EA+AK  LE+    L T
Sbjct: 423 KLDDPYDDETFPRLNIEAIAK-ELEEYNATLQT 454

>YKL060C (FBA1) [3199] chr11 complement(326053..327132)
           Fructose-bisphosphate aldolase II, catalyzes cleavage or
           condensation of fructose-1,6-bisphosphate into
           dihydroxyacetonephosphate and glyceraldehyde-3-phosphate
           at the sixth step in glycolysis [1080 bp, 359 aa]
          Length = 359

 Score = 32.0 bits (71), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 164 VHHLYRMMREGKLKVPAINVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKVAVVAG 223
           VH+L+   +E K  +PAINV  + T      L   R+S    I + ++    G  A  AG
Sbjct: 19  VHNLFTYAKEHKFAIPAINVTSSST--AVAALEAARDSKSPIILQTSN----GGAAYFAG 72

Query: 224 FGDVGKGCAASLRG-MGARVLVTEIDP 249
            G   +G  AS++G + A   +  I P
Sbjct: 73  KGISNEGQNASIKGAIAAAHYIRSIAP 99

>CAGL0M12837g 1265948..1267348 highly similar to sp|P40510
           Saccharomyces cerevisiae YIL074c SER33
           3-phosphoglycerate dehydrogenase, hypothetical start
          Length = 466

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 216 GKVAVVAGFGDVGKGCAASLRGMGARVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVF 275
           GK   V G+G +G   +     MG  VL  +I  I AL  A    +V+T+++  +    F
Sbjct: 195 GKTLGVVGYGHIGSQLSVLAESMGMHVLYYDIVTIMALGTAK---QVSTLDELLNKSD-F 250

Query: 276 VT-----TTGCRDIIKGEHFEKMPEDAIVCN 301
           VT     T   ++++    F  M + A V N
Sbjct: 251 VTLHVPETPETKNLLSAPQFAAMKDGAYVIN 281

>CAGL0C01353g complement(142575..145268) similar to sp|P40482
           Saccharomyces cerevisiae YIL109c SEC24 or sp|P53953
           Saccharomyces cerevisiae YNL049c SFB2, start by
           similarity
          Length = 897

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 131 ILDDGGDLTSFVH-EKYPEMLTDCFGLSE--ETTTGVHHLYRM 170
           ++D+G +L  +V  E  PE+L+D FG+ E  +   G H L+R+
Sbjct: 773 LIDNGSELFLWVGGEAVPELLSDVFGVPEMSQVPVGKHDLFRV 815

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,123,534
Number of extensions: 537214
Number of successful extensions: 1160
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1184
Number of HSP's successfully gapped: 18
Length of query: 442
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 337
Effective length of database: 12,961,219
Effective search space: 4367930803
Effective search space used: 4367930803
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)