Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02167g48045321770.0
Scas_687.205714672952e-28
Scas_712.226242612723e-25
YGL228W (SHE10)5772622465e-22
AFR244C5722582403e-21
Kwal_47.191847122882404e-21
YFR039C5102632359e-21
CAGL0I04092g5562632296e-20
Sklu_2433.186272782031e-16
KLLA0A01177g6362511862e-14
YJL162C482127720.88
YDR242W (AMD2)54971701.5
AEL337C109759682.6
Sklu_2116.459387673.9
Scas_704.20274100639.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02167g
         (473 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02167g 220619..222061 weakly similar to sp|P43611 Saccharo...   843   0.0  
Scas_687.20                                                           118   2e-28
Scas_712.22                                                           109   3e-25
YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown fu...    99   5e-22
AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C ...    97   3e-21
Kwal_47.19184                                                          97   4e-21
YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein...    95   9e-21
CAGL0I04092g 358219..359889 weakly similar to sp|P53075 Saccharo...    93   6e-20
Sklu_2433.18 YGL228W, Contig c2433 29391-31274                         83   1e-16
KLLA0A01177g 108738..110648 some similarities with sp|P53075 Sac...    76   2e-14
YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protei...    32   0.88 
YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similar...    32   1.5  
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    31   2.6  
Sklu_2116.4 YLR077W, Contig c2116 2714-4495 reverse complement         30   3.9  
Scas_704.20                                                            29   9.6  

>CAGL0C02167g 220619..222061 weakly similar to sp|P43611
           Saccharomyces cerevisiae YFR039c, hypothetical start
          Length = 480

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/453 (90%), Positives = 412/453 (90%)

Query: 21  YRDPMTPGCMDMIKYTGYQSTSVPYLAVLIELLLDMWGKVVEFVHRNRLCCTLHRKLGPL 80
           YRDPMTPGCMDMIKYTGYQSTSVPYLAVLIELLLDMWGKVVEFVHRNRLCCTLHRKLGPL
Sbjct: 21  YRDPMTPGCMDMIKYTGYQSTSVPYLAVLIELLLDMWGKVVEFVHRNRLCCTLHRKLGPL 80

Query: 81  LQHLRIVLYYLKPFAQQASSSFNDGFAILRGNLDFSRIDEGYSMLSLINNGRNVIXXXXX 140
           LQHLRIVLYYLKPFAQQASSSFNDGFAILRGNLDFSRIDEGYSMLSLINNGRNVI     
Sbjct: 81  LQHLRIVLYYLKPFAQQASSSFNDGFAILRGNLDFSRIDEGYSMLSLINNGRNVIESDEE 140

Query: 141 XXXXXXXXXXXXXXXXXXXXXXXAESSNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLS 200
                                  AESSNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLS
Sbjct: 141 DEDEEDGDEKSTKNKKQSKNKEQAESSNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLS 200

Query: 201 ELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRS 260
           ELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRS
Sbjct: 201 ELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRS 260

Query: 261 DMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRL 320
           DMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRL
Sbjct: 261 DMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRL 320

Query: 321 EQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEE 380
           EQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEE
Sbjct: 321 EQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEE 380

Query: 381 PRPLAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETS 440
           PRPLAI             VAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETS
Sbjct: 381 PRPLAIDGKGKGEDQGDDEVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETS 440

Query: 441 LDSQLDSLEKTYTAQIQSLRSQADRLLKDRDHK 473
           LDSQLDSLEKTYTAQIQSLRSQADRLLKDRDHK
Sbjct: 441 LDSQLDSLEKTYTAQIQSLRSQADRLLKDRDHK 473

>Scas_687.20
          Length = 571

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 100/467 (21%), Positives = 196/467 (41%), Gaps = 50/467 (10%)

Query: 21  YRDPMTPGCMDMIKYTGYQSTSV---------------PYLAVLIELLLDMWGKVVEFVH 65
           Y   + P   +++ +TG   ++V                Y   + E+L   +   + F+ 
Sbjct: 60  YVTTIEPYLAELVSWTGQFCSNVKIHPVSHSVWLRILSAYEYFINEILSPFYENTLLFIR 119

Query: 66  RNRLCCTLHRKLGPLLQHLRIVLYYLKPFAQQASSSFNDGFAILRGNLDFSRIDEGYSML 125
           RN+LCC +H KLGP LQHLRI+L+Y++ + ++      D F  L+    F   D    ML
Sbjct: 120 RNKLCCKIHAKLGPRLQHLRIILFYIRRYMERLKLESYDEFEDLKSKYGFFSFDFASGML 179

Query: 126 SLINNGRNVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXAESSNVDAIVDAVLN------- 178
               NG                                 E  + D I + V+N       
Sbjct: 180 ----NG------TLSESLHQDTLSSARETDNETEIETDTEPESDDIINEEVINQKLEDSI 229

Query: 179 DPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDN 238
           +  ++ ++ D +   ++  Q   +++ +V L    FN W+ ++  K          E++ 
Sbjct: 230 ELNNLPINADINGYHLE-NQADGILDRKVALN-NEFNAWINAVEGKSSNALLAFQDEIER 287

Query: 239 TISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQK 298
           +I           +  +  L++++++QI  ++  +Q+I+C   YD +++ + Y+D  G +
Sbjct: 288 SIEREGEYFTNEMEIRLNNLKNEIESQIDKIEKYIQDIDCISKYDPSSNELVYFDSNGTR 347

Query: 299 LLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN-MVEQSHIALEAVRNETIEAYEEWG 357
            +  YV+RPL+         ++++    ++  V N  +      LE +  E +E YEEWG
Sbjct: 348 KILEYVSRPLMDSIFLKAHFQIDEFRNEMEDTVINPFIYSMQYKLETIHQENVEVYEEWG 407

Query: 358 DTFYTEWSKYMAYRDIYDEDGEEPRPLAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKDI 417
           D   +EWS+ MA  D+      +  PL                 +  + W  F   K ++
Sbjct: 408 DIMISEWSRRMAQFDVVSGQLLDDDPL---------------FEQSAKKWQRFLDLKHEV 452

Query: 418 IQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQAD 464
           ++ RD L + + D+  L+   ++   +L+ +      Q ++L  +AD
Sbjct: 453 VEMRDTLYYSEPDSTALEGIISNARIKLEEIIDEANNQFEALGKKAD 499

>Scas_712.22
          Length = 624

 Score =  109 bits (272), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 124/261 (47%), Gaps = 23/261 (8%)

Query: 209 LQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISI 268
           L +  F+ W  +I +K  +I     ++V   I   + S  + F+  I+ L  + +     
Sbjct: 281 LLQSDFDNWSNTIEQKIASINKLFDKDVAKLIKKEMKSNEQKFKDKIQNLNQESELLFQD 340

Query: 269 LKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVK 328
           L   +Q+INCT   D  T+   Y+D  G+  L+ Y+ RPLI    + T   L +L+  ++
Sbjct: 341 LNKAIQDINCTESLDPQTNETIYFDRNGETQLEQYIERPLIRELFEKTRATLNELIADIQ 400

Query: 329 LQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIY-----DEDGEEPRP 383
                ++E+ +  +E++R+E ++ YEEWG+    EWSK MAY D+       E+ E  + 
Sbjct: 401 NDENVLIEKVNKKVESIRDEHLDVYEEWGEIMVNEWSKRMAYVDVVAAHLNAEEKEAKKT 460

Query: 384 LAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDS 443
           ++                   E+W +F   KK +I  RD+L+    + K ++QF  ++  
Sbjct: 461 MS------------------EENWKKFLKVKKQVIGARDELVEHVPNIKTMEQFLNNIQE 502

Query: 444 QLDSLEKTYTAQIQSLRSQAD 464
            L  L K     +  LR++A+
Sbjct: 503 TLKMLSKDAGEYLYILRARAN 523

>YGL228W (SHE10) [1770] chr7 (67597..69330) Protein of unknown
           function, has weak similarity to uncharacterized S.
           cerevisiae Yfr039p [1734 bp, 577 aa]
          Length = 577

 Score = 99.4 bits (246), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/262 (24%), Positives = 120/262 (45%), Gaps = 11/262 (4%)

Query: 203 INTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDM 262
           +N + LLQE  F++W ++I +K + +     ++V   I+  +V    +F+   + L    
Sbjct: 269 VNEQALLQED-FDMWSETILQKTQDVIQLFEKDVSKYINGKLVEEANHFKAKFQSLDDKS 327

Query: 263 DAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQ 322
               S +   + +I C    D  T    ++D +G   +  Y+TR L+  +   T + L++
Sbjct: 328 KKFFSKISLAINDIECVEGIDSETGKKIFFDKSGSTEISQYITRELVREYFNETRSTLDE 387

Query: 323 LVEAVKLQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPR 382
           L  A++  +  + ++    + A+R E +E +EEWGD    EWSK MAY D+ +       
Sbjct: 388 LTNAMEKDLSEITDEIEKKVNAIREENVEVFEEWGDIIVNEWSKRMAYVDVINAHMGADD 447

Query: 383 PLAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLD 442
              +              AK   +W +F   KK II+ RD+L H   D  ++  F   + 
Sbjct: 448 DTTLDEEK----------AKSSVNWKKFLKGKKQIIESRDKLAHHSADLSRVNAFRQKVQ 497

Query: 443 SQLDSLEKTYTAQIQSLRSQAD 464
            ++ S  +     +  LRS+A+
Sbjct: 498 KKILSFTQESGEFLYILRSKAN 519

>AFR244C [3436] [Homologous to ScYGL228W (SHE10) - SH; ScYFR039C -
           SH] (877997..879715) [1719 bp, 572 aa]
          Length = 572

 Score = 97.1 bits (240), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 118/258 (45%), Gaps = 20/258 (7%)

Query: 214 FNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTV 273
           F+ W ++I RK  ++    ++EV         +    F+  ++ + +      + +   +
Sbjct: 252 FSAWQQAIERKADSVLQAFTEEVGEFEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAI 311

Query: 274 QNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN 333
           ++IN TM  D  T+   ++D  G +L   Y+TRPL+  +       L  +   ++ ++  
Sbjct: 312 RDINSTMELDPATNQTIWFDAHGTQL-HQYITRPLMREYFSQANDELANITNHIRAELRE 370

Query: 334 MVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIXXXXXXX 393
           +V+  +  ++ +R E IE YEEW D   +EWS+ MAY D+ D D E              
Sbjct: 371 VVDSVNGQVDVIRQEHIEVYEEWADVMVSEWSRRMAYIDVVDRDLEAE------------ 418

Query: 394 XXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYT 453
                  A+   +W  F   KK +I+ RDQLL   +   +L+ F   + S L  L +   
Sbjct: 419 -------AERNRNWKRFLKLKKRVIKVRDQLLEHPVKFNQLETFLKEIQSTLRILAQENG 471

Query: 454 AQIQSLRSQADRLLKDRD 471
             +  LRS+A+   ++R+
Sbjct: 472 EYLYILRSKANLSFQERE 489

>Kwal_47.19184
          Length = 712

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 132/288 (45%), Gaps = 28/288 (9%)

Query: 177 LNDPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEV 236
           L  PT  + H+D  D++++ P L +L+  E       F  W  ++ +K     ++   E+
Sbjct: 245 LEKPTASSSHED--DASLEVP-LRDLVQDE-------FEAWSTAVQQKASNTLSQFDAEI 294

Query: 237 DNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTG 296
            + + S +     N    ++ +     A    +   + +++C M  D  T    Y++  G
Sbjct: 295 QDLVDSKLSEIRPNVTTLLQSISDSCQAYYRDINKAILDVDCNMELDPVTGEQLYFNRDG 354

Query: 297 QKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEW 356
            +L   Y+TRPL+  +  +    +E+ +E V+ Q+E  V   +  ++ +R E++E YEEW
Sbjct: 355 TQLR-KYMTRPLMREYFSAAHAHVEERLEFVRAQLEKFVAMVNKEVDEIRQESLELYEEW 413

Query: 357 GDTFYTEWSKYMAYRDIYDEDGEEPRPLAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKD 416
           GD   +EWSK MAY DI+   G +                     + +++W +F   KK 
Sbjct: 414 GDVMISEWSKRMAYGDIFHAIGSDSFD-----------------QQQHDNWKQFLKLKKR 456

Query: 417 IIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQAD 464
           ++  RDQL+      + L  F   +   L +L++     +  LRSQA+
Sbjct: 457 VVATRDQLMQHPAKLQALDTFLRDIQFTLSALQRDAGEYLFILRSQAN 504

>YFR039C (YFR039C) [1721] chr6 complement(231999..233531) Protein of
           unknown function, has weak similarity to uncharacterized
           S. cerevisiae She10p [1533 bp, 510 aa]
          Length = 510

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 126/263 (47%), Gaps = 19/263 (7%)

Query: 214 FNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTV 273
           +  W+K+I  K  +    L  E+ +   + V +      +++++L + ++ Q+  L   +
Sbjct: 252 YEAWIKAIDSKIHSAMALLDSEIQSVFEAEVQNKSIEITRNLDDLNTTVNEQLVFLDSKI 311

Query: 274 QNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN 333
           ++INCT  +D   + + Y+D +GQ  L+ Y+T+  I   LK+ +  L    +++   +++
Sbjct: 312 KDINCTSKFDPVQNKIKYFDESGQVELEAYITKSSITSILKNYKIHLLDFEKSLFHSLDS 371

Query: 334 MVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDI---YDEDGEEPRPLAIXXXX 390
            + +     E++R E +E YEEWGD   ++WS+ MAY D+   + ED  +P         
Sbjct: 372 FLTEMAKLAESIRLENVEVYEEWGDVMISQWSQRMAYMDVRGLHLEDQYDP--------- 422

Query: 391 XXXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEK 450
                    + + + +W  F   KK +I  R++L+   LD   + ++ T L +   + + 
Sbjct: 423 -------AYIEENHSNWLRFMELKKKVISERNRLVKHDLDMTLILEWITKLKADFQNTKN 475

Query: 451 TYTAQIQSLRSQADRLLKDRDHK 473
                     + AD L K+R+ K
Sbjct: 476 NIQDTFLQRMNTADTLFKNRELK 498

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 30/51 (58%)

Query: 56  MWGKVVEFVHRNRLCCTLHRKLGPLLQHLRIVLYYLKPFAQQASSSFNDGF 106
            W  +  F+  N LCC+LH KLGPLL HLRI  YYLKP+     +   + F
Sbjct: 94  FWYNIFSFLRLNELCCSLHSKLGPLLNHLRIAWYYLKPYTDNVKNVLENPF 144

>CAGL0I04092g 358219..359889 weakly similar to sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, start by
           similarity
          Length = 556

 Score = 92.8 bits (229), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/263 (25%), Positives = 122/263 (46%), Gaps = 22/263 (8%)

Query: 214 FNIWVKSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTV 273
           F+ W  +I +K K +   L ++V   +   + +  + F+  ++ L  + +    ++   +
Sbjct: 277 FDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLINKAI 336

Query: 274 QNINCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVEN 333
           Q+INCT   D  T    Y+D  G+  ++ Y+TR +I   L  T+T L  LV  ++  V  
Sbjct: 337 QDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIENDVSK 396

Query: 334 MVEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIY--DEDGEEPRPLAIXXXXX 391
           ++E      E  R + +  +EEWGD    EWSK +AY D+    ED E            
Sbjct: 397 ILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSKTELSE- 455

Query: 392 XXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKT 451
                        ++W +F   KK I+  RD++  +Q+   K+ +F+  LD+  ++L+  
Sbjct: 456 -------------KNWKKFMAIKKQILDARDKMAKRQI---KISEFKLLLDNVQNTLQAV 499

Query: 452 YTAQ---IQSLRSQADRLLKDRD 471
                  +  LR+QA+   ++R+
Sbjct: 500 TNENGEYLYILRAQANLAFQERE 522

>Sklu_2433.18 YGL228W, Contig c2433 29391-31274
          Length = 627

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/278 (23%), Positives = 124/278 (44%), Gaps = 29/278 (10%)

Query: 187 KDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISRKFKAIENELSQEVDNTISSTVVS 246
           ++ +DS++  P L +L+  E       +  W  ++ RK     +  ++EV +     + S
Sbjct: 259 REEEDSSLDVP-LKDLVQNE-------YQAWSNTVERKANTALDAFTKEVHDYEIEQLES 310

Query: 247 GVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYYDHTGQKLLDTYVTR 306
                   ++ + +        +   + +INCTM   EN + +F+  H  Q  L  Y+TR
Sbjct: 311 VSPLMSSLLQNISNTTQLHFQKINKAILDINCTMEIGENGEQLFFDRHGTQ--LKEYITR 368

Query: 307 PLIMHHLKSTETRLEQLVEAVKLQVENMVEQSHIALEAVRNETIEAYEEWGDTFYTEWSK 366
           PL+     +    L  + + ++ +++  V   +  ++ +RNE +E YEEWGD   +EWSK
Sbjct: 369 PLMRGLFTAANEELTAMSDDLRARLKEFVNTVNDHVDVIRNEHLEVYEEWGDVMISEWSK 428

Query: 367 YMAYRDIYDEDGEEPRPLAIXXXXXXXXXXXXXVAKIYEDWFEFTLHKKDIIQFRDQLLH 426
            MAY D+   D ++                    ++ + +W  F   K+++I+ RD L+ 
Sbjct: 429 RMAYVDVVALDEQDD-------------------SEQHSNWKNFLKLKRNVIKTRDLLVE 469

Query: 427 KQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLRSQAD 464
             +    L+ F   +   L  L K     +  LRS+A+
Sbjct: 470 HPVKFHDLEVFLKEVQFTLRMLAKESGEYLYILRSKAN 507

>KLLA0A01177g 108738..110648 some similarities with sp|P53075
           Saccharomyces cerevisiae YGL228w SHE10, hypothetical
           start
          Length = 636

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 117/251 (46%), Gaps = 24/251 (9%)

Query: 228 IENELS---QEVDNTISSTVVSGVENFQKDIEEL--RSDMDAQIS--ILKDTVQNINCTM 280
           IEN+LS   ++ +N I+      +++ Q  + +L  R+   +Q +  I+   + ++NCT 
Sbjct: 327 IENKLSNTMKDFENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQIITKAIMDVNCTE 386

Query: 281 IYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVENMVEQSHI 340
             D  T+   ++D    +L   Y+TR L+  +  +  ++ + L + ++  +  + ++ + 
Sbjct: 387 SVDPKTNKTIWFDQNNTQL-PKYMTRELMREYFSAAHSQFDALSQEIRAHLRKLADEVND 445

Query: 341 ALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIXXXXXXXXXXXXXV 400
            +E +R E +E +EEW D   TEWSK +AY D+          LA               
Sbjct: 446 HVEVLRQENVELFEEWADVMITEWSKNLAYVDV----AVNEEKLADLEKEQR-------- 493

Query: 401 AKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEKTYTAQIQSLR 460
               ++W +F   K+ +I+ RD L+   +    L+ F  ++   L +L       +  LR
Sbjct: 494 ----KNWKDFMKLKRQVIKTRDTLMEHPVKLDSLQSFVNTVQQSLKTLSHENGEYLYILR 549

Query: 461 SQADRLLKDRD 471
           S+A+   + R+
Sbjct: 550 SKANLEFQARE 560

>YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protein
           that contains a DnaJ chaperonin domain [1449 bp, 482 aa]
          Length = 482

 Score = 32.3 bits (72), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 63/127 (49%), Gaps = 13/127 (10%)

Query: 267 SILKDTVQNINCTMIYDENTDSVFYYDHTGQK-------LLDTYVTRPLIMHHLKSTETR 319
           +IL+D ++ +N + + D N D +F  D  G K       + +  +  P  M   K  +  
Sbjct: 355 NILRDIIEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIKEPKGMKRRKKDDIS 414

Query: 320 LEQLVEAVKLQVEN-MVEQSHIALEAV----RNETIEAYEEWGDTFYTEWSKYMAYRDIY 374
           LE+L +++  + +  M++  + +LE++    + +T +++E+ G TF    S    ++ + 
Sbjct: 415 LEELFQSLPREKDYFMMDPINDSLESINLFKKPKTTQSHEQGG-TFAQAESNRAKFKPLL 473

Query: 375 DEDGEEP 381
           ++ G  P
Sbjct: 474 EQCGITP 480

>YDR242W (AMD2) [1076] chr4 (946799..948448) Protein with similarity
           to amidases [1650 bp, 549 aa]
          Length = 549

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 11/71 (15%)

Query: 236 VDNTISS--TVVSGVENFQKDIEELRSDMDAQISILKDTVQNINCTMIYDENTDSVFYYD 293
           VDN+     T+ S +    +D+ +LR  M   I+I +  VQ++ C           +++D
Sbjct: 258 VDNSFEGRETIPSVIGPLARDLSDLRYFMSCVINICQPWVQDVKCI---------PYHFD 308

Query: 294 HTGQKLLDTYV 304
            +  KL D YV
Sbjct: 309 SSTSKLHDNYV 319

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
           bp, 1097 aa]
          Length = 1097

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 210 QEGGFNIWVKSISRKFKAIENEL-SQEVDNTISSTVVSGVENFQKDIEELRSDMDAQIS 267
           Q+  F+I +  + RK + ++  +  Q     I S  +S ++N ++ +EE R DM+  +S
Sbjct: 688 QKKQFHIPLAEVQRKLQDLQKAIHEQNHKRIIQSRTMSEIQNIEQKLEEFRRDMNKDVS 746

>Sklu_2116.4 YLR077W, Contig c2116 2714-4495 reverse complement
          Length = 593

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 17/87 (19%)

Query: 308 LIMHHLKSTETRL--EQLVEAVKLQVENMV-----EQSHIALEAVRNETI-EAYEEWGDT 359
           L+   +KS ET L  + L+E   +++ N V     ++  I +  V++E + E Y EW  +
Sbjct: 196 LMAWDMKSCETILPDQNLIE---VKISNNVAYGLNKKGEILVIPVKDEELREKYTEWKRS 252

Query: 360 FYTEWSKYMAY------RDIYDEDGEE 380
               W KY +Y      + +++E GE+
Sbjct: 253 LLAPWKKYCSYKWKLETKQLFNEKGEK 279

>Scas_704.20
          Length = 274

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 13/100 (13%)

Query: 164 AESSNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWVKSISR 223
           AE  + D++ D   N   +V + KD D+SA+ F  L       + LQEG F  +V S++ 
Sbjct: 147 AEEEDFDSLADNFAN--VNVVVSKD-DNSALSFELL-------MNLQEGSF--YVDSVT- 193

Query: 224 KFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMD 263
            FK+I+  L++  D  ++  +V     F    EEL+  ++
Sbjct: 194 PFKSIDQALNESADAELNRELVYHGPPFSNLDEELQESLE 233

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,527,589
Number of extensions: 543797
Number of successful extensions: 2357
Number of sequences better than 10.0: 66
Number of HSP's gapped: 2380
Number of HSP's successfully gapped: 72
Length of query: 473
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 368
Effective length of database: 12,961,219
Effective search space: 4769728592
Effective search space used: 4769728592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)