Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02145g77776538970.0
YFR040W (SAP155)100283523220.0
Kwal_47.1919179076420690.0
Sklu_2433.1791478220390.0
AFR245W89978620350.0
Scas_687.1995681920370.0
KLLA0A01155g99364318980.0
Scas_712.2182874818580.0
YGL229C (SAP4)81877314460.0
CAGL0L03586g11236039861e-118
KLLA0F14124g11005959651e-116
AFR089W10316489441e-113
Scas_711.22*10187149391e-113
YKR028W (SAP190)10985968851e-104
YJL098W (SAP185)10586078811e-104
Kwal_26.73467475098481e-102
Scas_675.365573353864e-39
Kwal_26.7343282761085e-05
CAGL0F03597g454198693.1
Sklu_2211.5117566703.5
Kwal_26.675971975694.2
ABL005C84957685.0
KLLA0A05907g34799666.8
AGL223C47846667.1
CAGL0K06369g33052667.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02145g
         (765 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02145g complement(216905..219238) similar to sp|P43612 Sac...  1505   0.0  
YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated p...   899   0.0  
Kwal_47.19191                                                         801   0.0  
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement     790   0.0  
AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C...   788   0.0  
Scas_687.19                                                           789   0.0  
KLLA0A01155g complement(104687..107668) some similarities with s...   735   0.0  
Scas_712.21                                                           720   0.0  
YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...   561   0.0  
CAGL0L03586g complement(408095..411466) similar to sp|P40856 Sac...   384   e-118
KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces...   376   e-116
AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W...   368   e-113
Scas_711.22*                                                          366   e-113
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...   345   e-104
YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that asso...   343   e-104
Kwal_26.7346                                                          331   e-102
Scas_675.36                                                           153   4e-39
Kwal_26.7343                                                           46   5e-05
CAGL0F03597g join(350747..350763,350897..352244) highly similar ...    31   3.1  
Sklu_2211.5 YBL105C, Contig c2211 10237-13764                          32   3.5  
Kwal_26.6759                                                           31   4.2  
ABL005C [587] [Homologous to ScYLR357W (RSC2) - SH; ScYGR056W (R...    31   5.0  
KLLA0A05907g complement(548720..549763) weakly similar to sp|P46...    30   6.8  
AGL223C [4089] [Homologous to ScYCR079W - SH] (278209..279645) [...    30   7.1  
CAGL0K06369g 624706..625698 highly similar to tr|Q03290 Saccharo...    30   7.6  

>CAGL0C02145g complement(216905..219238) similar to sp|P43612
           Saccharomyces cerevisiae YFR040w SAP155 SIT4P-associated
           protein, hypothetical start
          Length = 777

 Score = 1505 bits (3897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 746/765 (97%), Positives = 746/765 (97%)

Query: 1   MTINGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFK 60
           MTINGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFK
Sbjct: 1   MTINGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFK 60

Query: 61  ENEKERVENIDYLLDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDE 120
           ENEKERVENIDYLLDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDE
Sbjct: 61  ENEKERVENIDYLLDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDE 120

Query: 121 DEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQ 180
           DEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQ
Sbjct: 121 DEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQ 180

Query: 181 NLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQK 240
           NLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQK
Sbjct: 181 NLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQK 240

Query: 241 LIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDK 300
           LIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDK
Sbjct: 241 LIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDK 300

Query: 301 MIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRR 360
           MIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRR
Sbjct: 301 MIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRR 360

Query: 361 FAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGL 420
           FAANLPKLFE                   QMNEKFIPIGFERFKIVELIAELLHCSNMGL
Sbjct: 361 FAANLPKLFEIIDDIYDNNDTNDDMLLTNQMNEKFIPIGFERFKIVELIAELLHCSNMGL 420

Query: 421 LNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQS 480
           LNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQS
Sbjct: 421 LNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQS 480

Query: 481 ENESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIM 540
           ENESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIM
Sbjct: 481 ENESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIM 540

Query: 541 KLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKL 600
           KLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKL
Sbjct: 541 KLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKL 600

Query: 601 KDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDS 660
           KDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDS
Sbjct: 601 KDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDS 660

Query: 661 LQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDYDDENDVSGGK 720
           LQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDYDDENDVSGGK
Sbjct: 661 LQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDYDDENDVSGGK 720

Query: 721 LINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI 765
           LINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI
Sbjct: 721 LINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI 765

>YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated
           protein [3009 bp, 1002 aa]
          Length = 1002

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/835 (57%), Positives = 590/835 (70%), Gaps = 88/835 (10%)

Query: 7   ELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKER 66
           +++  T P+    T + LD+SFI+RML E ELLNEL+ QNK L+DFICFGFFF +   ++
Sbjct: 122 DISNATAPMMV--TTKNLDNSFIERMLVETELLNELSRQNKTLLDFICFGFFFDKKTNKK 179

Query: 67  VENIDYLLDQLLFCVDQFKMVEADTVNVT-----RENSPADEGIEMDFNKVIEDNAEDED 121
           V N++YL+DQL+ C+ + K   A TV++      +E    D+  + D    +E + E E+
Sbjct: 180 VNNMEYLVDQLMECISKIKT--ATTVDLNNLIDYQEQQQLDDSSQEDV--YVESDTEQEE 235

Query: 122 E-----------------------------------------YLSRANLIAEIFSLDIWL 140
           E                                         YL++A +I+EIFSLDIWL
Sbjct: 236 EKEDDNNSNNKKRRKRGSSSFGNDDINNNDDDDDANEDDESAYLTKATIISEIFSLDIWL 295

Query: 141 ITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSL 200
           I+ESLVKN+ +L+KIW++++ PNF  E SPL+PIFLK+NQNLL+TRQDQYLNFIR++ S 
Sbjct: 296 ISESLVKNQSYLNKIWSIINQPNFNSENSPLVPIFLKINQNLLLTRQDQYLNFIRTERSF 355

Query: 201 VDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQA 260
           VDDML H+DI+LLMDFFLK+ISTDKIESPTG+IELV DQ LI K L FLNN    ADIQA
Sbjct: 356 VDDMLKHVDISLLMDFFLKIISTDKIESPTGIIELVYDQNLISKCLSFLNNKESPADIQA 415

Query: 261 CVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIV 320
           CV DFLKALI ISANAPLD++SIGPNSLTR+LASP+SI K++ I++N+RGAALN+T+SIV
Sbjct: 416 CVGDFLKALIAISANAPLDDISIGPNSLTRQLASPESIAKLVDIMINQRGAALNTTVSIV 475

Query: 321 IELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEXXXXXXXXXX 380
           IELIRKNNSDYDQVNLL TT++THPPS+RDPI+LGYLLR+F+ +L   F+          
Sbjct: 476 IELIRKNNSDYDQVNLLTTTIKTHPPSNRDPIYLGYLLRKFSNHLSDFFQ---IILDIEN 532

Query: 381 XXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQV 440
                    Q++EKF P+GFERFK+VELIAELLHCSNMGL+N+KRAERIAR RDKVR Q+
Sbjct: 533 DANIPLHENQLHEKFKPLGFERFKVVELIAELLHCSNMGLMNSKRAERIARRRDKVRSQL 592

Query: 441 SFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSENESHDEFEHINQDENDEID 500
           S  LQDALNDL+I      K K    +  D HD       + ++ +       D  DEID
Sbjct: 593 SHHLQDALNDLSIEEKEQLKTKHSPTRDTD-HD-LKNNNGKIDNDNNDNDDESDYGDEID 650

Query: 501 ETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDII 560
           E+FEIPYIN  Q  KLRT+PT+GDLFKIKLYD +I+ KIM+LFL HPWNNFWHNVIFDII
Sbjct: 651 ESFEIPYINMKQTIKLRTDPTVGDLFKIKLYDTRIVSKIMELFLTHPWNNFWHNVIFDII 710

Query: 561 QQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLK--------------DFSIT 606
           QQIFNGRMDFSYNSFLV SLFNL+ S+Q+M      D K                DF IT
Sbjct: 711 QQIFNGRMDFSYNSFLVLSLFNLKSSYQFMTDIVISDEKGTDVSRFSPVIRDPNFDFKIT 770

Query: 607 KDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDW 666
            DFIL GY  SYKFYE +  NLG+MGH+VLIAEEVVKFSKLYKVELIS DIQ  LQ ++W
Sbjct: 771 TDFILRGYQDSYKFYELRKMNLGYMGHIVLIAEEVVKFSKLYKVELISPDIQVILQTEEW 830

Query: 667 QYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYL-----DYDDENDV----- 716
           QYYSEEVLN TR+MYSKILGGG++++D NGNI+PQ+ D   +     D  + N++     
Sbjct: 831 QYYSEEVLNETRMMYSKILGGGSYIDDGNGNIIPQLPDNTTVLTPNGDASNNNEILDSDT 890

Query: 717 -------SGGKLINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGV 764
                   GG+LINVE+LEEQLSLSTESDLH KLR+ML+ +AQ++VD KN  NGV
Sbjct: 891 GSSNGTSGGGQLINVESLEEQLSLSTESDLHNKLREMLINRAQEDVDNKNTENGV 945

>Kwal_47.19191
          Length = 790

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/764 (54%), Positives = 533/764 (69%), Gaps = 57/764 (7%)

Query: 16  TGEETE------QRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVEN 69
           TG E E        L S +ID +L E ELLNEL  QN  L+DF+CFG+F+   +  +V+N
Sbjct: 61  TGPEGENVEGGTAALSSKYIDGILAESELLNELTRQNSTLLDFVCFGYFYGA-DGGKVQN 119

Query: 70  IDYLLDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDEDEYLSRANL 129
           I+YL+DQL+ CV++    EA     +  ++PA E         +E   + +   L+RA +
Sbjct: 120 IEYLIDQLMACVERLGAAEAGQEQNSSASTPAAE-------DSVEGTEDPQQPVLNRATI 172

Query: 130 IAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQ 189
           I+EIF+LDIWLI+ESLVKN  +L+KIW++L   NF  E+S LIPIFLK+NQNLL TRQDQ
Sbjct: 173 ISEIFALDIWLISESLVKNASYLNKIWSILKQQNFASEKSALIPIFLKINQNLLATRQDQ 232

Query: 190 YLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFL 249
           YLNFIRS+ +LVDD+L HI I++LMDF LK+ISTDK ESP+G+IELV +Q+L +KLL +L
Sbjct: 233 YLNFIRSKDTLVDDLLEHIQISVLMDFLLKIISTDKQESPSGIIELVHEQRLPNKLLSYL 292

Query: 250 NNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNER 309
           +N+ Y  DIQAC  D LKA++ ISANAPLD++SIGPNSLTR LAS   +  ++  ++++R
Sbjct: 293 DNDRYEPDIQACAADLLKAIVAISANAPLDDMSIGPNSLTRHLASEDCVSFLLDTIIDKR 352

Query: 310 GAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLF 369
           G AL + +SIVIELIRKNNSDYDQVNLL TTL +HPPS RDPI+LG +L+ F   LP +F
Sbjct: 353 GNALINAVSIVIELIRKNNSDYDQVNLLTTTLTSHPPSMRDPIYLGVMLKLFTERLPSIF 412

Query: 370 EXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERI 429
           +                   Q+ EK+ P+GFERFK+VELIAELLHCSNMGLLN+K+AERI
Sbjct: 413 Q---ILTDIELDSTTKELENQLGEKYKPLGFERFKVVELIAELLHCSNMGLLNSKKAERI 469

Query: 430 ARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSENESHDEFE 489
            + R+  R  V  QLQDAL DL +    DN+  S+    N       G+  E        
Sbjct: 470 VKERNNARGAVVKQLQDALADLDLQ---DNEYASNVVDNN-------GVDEE-------- 511

Query: 490 HINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWN 549
                   ++DE+F+IPY+N NQN+KLR NPTIGDLFKI LYD QIIP+I+ LFL +PWN
Sbjct: 512 --------DVDESFDIPYVNPNQNAKLRENPTIGDLFKITLYDNQIIPRIVHLFLQYPWN 563

Query: 550 NFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDF 609
           NFWHNV+FDIIQQ+FNGRMDFSYNSFL++SLFN   + ++M    AK   ++DF IT+D 
Sbjct: 564 NFWHNVVFDIIQQLFNGRMDFSYNSFLIYSLFNNHAASRFMSEATAK--TVRDFQITRDL 621

Query: 610 ILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDWQYY 669
           IL+GY +SY FYE+ NT LGFMGHLVLIAEE+VKFSK+YKVELIS DIQ  LQ DDW +Y
Sbjct: 622 ILKGYKESYAFYEKHNTALGFMGHLVLIAEEIVKFSKVYKVELISPDIQAVLQNDDWVFY 681

Query: 670 SEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLD---YDDENDVSGGKLINVEN 726
           SE+VLN TR+MYSKILGG +++ED N N      DG+ +D   ++ EN   GG LIN+  
Sbjct: 682 SEDVLNDTRIMYSKILGGNDYLEDGNTN----ERDGDLIDDDTHNRENPQPGGNLINLSE 737

Query: 727 LEEQLS-----LSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI 765
           L +        LST SDLH KLR  L+ ++Q EVD +N  NGVI
Sbjct: 738 LSQDQGQGLSNLSTTSDLHKKLRQRLIDQSQGEVDRRNEQNGVI 781

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/782 (55%), Positives = 570/782 (72%), Gaps = 52/782 (6%)

Query: 20  TEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVENIDYLLDQLLF 79
           T Q L++SFID +L+E ELLNEL  QN  L+DFICFG+F+ +    +VENI+YL+DQL+ 
Sbjct: 124 TLQSLNNSFIDNLLQETELLNELTRQNNTLLDFICFGYFY-DAYGTKVENIEYLIDQLMI 182

Query: 80  CVDQFKMVEADT-------VNVTRENSPADEGIEMDFNKVIE----DNAEDEDE--YLSR 126
           C+D  K+ E D        + V +E+ P+ +    D +  I     DN E++D+  YL++
Sbjct: 183 CID--KINEHDDNEPDDKDLQVEQEDGPSTQTQPNDDSNDISTPSVDNQEEDDQSSYLNK 240

Query: 127 ANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITR 186
           A +I+EIFSLDIWLI+ESLVKN  +L+ IW++LH+PNF  E+SPLIPIFLK+NQNLL+TR
Sbjct: 241 ATIISEIFSLDIWLISESLVKNSTYLATIWSILHHPNFSSEKSPLIPIFLKINQNLLLTR 300

Query: 187 QDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLL 246
           QDQYLNFIR++ +LV D L HI I++LMDFFLK+ISTDK ESPTG+IELV +Q LI KLL
Sbjct: 301 QDQYLNFIRTRENLVGDFLKHIGISVLMDFFLKVISTDKQESPTGIIELVYEQGLISKLL 360

Query: 247 KFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVL 306
            +L+N  Y ADIQAC  DF+KALI ISANAPLD++SIGPNSLTR+L S + ID ++  ++
Sbjct: 361 NYLDNG-YHADIQACAGDFIKALIAISANAPLDDMSIGPNSLTRQLCSEQCIDLLLNAIV 419

Query: 307 NERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLP 366
           N+RGAAL + +SIVIELIRKNNSDYDQVNLL TT++THPPS RDPI+LG +L++FA NLP
Sbjct: 420 NKRGAALTTAVSIVIELIRKNNSDYDQVNLLTTTVKTHPPSIRDPIYLGVMLKKFAVNLP 479

Query: 367 KLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRA 426
           + +                    Q+N+++ P+GFERFK+VELIAELLHCSNMGL+N+K+A
Sbjct: 480 EFYR---ILLDVENDDRIPLVKNQLNQEYKPLGFERFKVVELIAELLHCSNMGLMNSKKA 536

Query: 427 ERIARVRDKVRKQVSFQLQDALNDLTINP-----SVDNKRKSDTAQQNDKHDAFDGIQSE 481
           ERI + RD+VR+ ++ QL+DAL +L +       +  N   S T   N   D  D + + 
Sbjct: 537 ERIVKERDEVRQGLTKQLEDALAELDMGEENDNINDANNNNSTTTTNNTITDNNDTVTTS 596

Query: 482 NESHDE-FEHINQDEN----------DEIDETFEIPYINENQNSKLRTNPTIGDLFKIKL 530
           NE++DE +E +N+  N          +EIDE+FEIPY+N +QN+KLR NPT GDLFKI L
Sbjct: 597 NENNDEVYEKVNEQNNKESPDDANDEEEIDESFEIPYVNPSQNAKLRLNPTTGDLFKINL 656

Query: 531 YDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYM 590
           YD QI+PKI++LFL +PWNNFWHNV+FDIIQQIF+GRMDFSYNSFLV+SLFN +GS Q+M
Sbjct: 657 YDTQILPKIIELFLRYPWNNFWHNVLFDIIQQIFSGRMDFSYNSFLVYSLFNNKGSAQFM 716

Query: 591 DSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKV 650
            +  AK   ++DF IT D IL+GY  S+ FYE   TNLG+MGHLVLIAEE+VKFSK+YKV
Sbjct: 717 LT--AKPTHVRDFRITADLILQGYRDSHDFYEVHETNLGYMGHLVLIAEEIVKFSKVYKV 774

Query: 651 ELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDY 710
           ELIS DI + LQ++ W +YSE+VLN TR+MYSKILGGG++++D   N +  +   +  + 
Sbjct: 775 ELISPDIYEVLQDEAWIFYSEDVLNDTRVMYSKILGGGDYMDDGGENAIHDLASPSSSE- 833

Query: 711 DDENDVSGGKLINVENLEEQL-------SLSTESDLHLKLRDMLVVKAQQEVDAKNAANG 763
                 SGG LINV N  ++L       + ST+SDLH KL++ L+ ++Q EVD +N   G
Sbjct: 834 ------SGGDLINVSNYGQELQQHTQANAFSTQSDLHKKLKEKLIKESQSEVDRRNKEKG 887

Query: 764 VI 765
           VI
Sbjct: 888 VI 889

>AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C
           (SAP4) - SH] complement(880258..882957) [2700 bp, 899
           aa]
          Length = 899

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/786 (53%), Positives = 545/786 (69%), Gaps = 62/786 (7%)

Query: 20  TEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVENIDYLLDQLLF 79
           T+  L+ SFID +LKE ELLNEL  QN  L+DF+CFGFF+ + +  +++NI+YL+DQL+F
Sbjct: 127 TKFSLNYSFIDSILKESELLNELTRQNNTLLDFVCFGFFY-DTDGNKIDNIEYLIDQLMF 185

Query: 80  CVD-----QFKMVEADTVNVTRENSPAD-----------EGIEMDFNK--VIEDNAEDED 121
           C+D     Q +  E  T    +EN   D           EG + +F K  V  +    E 
Sbjct: 186 CIDRVNEEQKENDETRTPGHEQENEQHDDFLPPQQAGFLEGQDSEFIKRAVFPEPPSHEG 245

Query: 122 E-----------------YLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNF 164
           +                  L+R N I+EIF+LDIWLI+ESLVK+  HLSKIW++L++ +F
Sbjct: 246 DDAILPFLHGRRDTRQSSLLNRVNTISEIFALDIWLISESLVKDPSHLSKIWSVLNHKDF 305

Query: 165 KFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTD 224
           K E+SPL+PIFLK+NQNLL+TRQDQ LNFIR++ SLVD+ L H++I++LMDFFLK+ISTD
Sbjct: 306 KAEKSPLVPIFLKINQNLLLTRQDQLLNFIRARESLVDEFLQHLEISVLMDFFLKIISTD 365

Query: 225 KIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIG 284
           K ESPTG+IELV DQ LI K+L FL+N+ YSADIQAC  D +KALI IS NAPLDELSIG
Sbjct: 366 KQESPTGIIELVYDQGLIPKMLSFLDNHKYSADIQACAGDLMKALISISTNAPLDELSIG 425

Query: 285 PNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETH 344
           PN+LTR+L S +SID  +  ++N+RG AL + +S+VIELIRKNNSDYDQ+NLL T+++TH
Sbjct: 426 PNALTRQLCSEESIDCFLDAIINKRGHALTTAVSVVIELIRKNNSDYDQINLLCTSVKTH 485

Query: 345 PPSDRDPIFLGYLLRRFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFK 404
           PPS RDPI+LG +L++FA  LP                       Q+  ++ P+GFERFK
Sbjct: 486 PPSTRDPIYLGRMLKKFAEKLPNF---KRVLLEIENDGSIKDIRNQLGIEYKPLGFERFK 542

Query: 405 IVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSD 464
           IVELIAELLHCSNMGL+N+K+AERI + RD+VR  +  QLQDAL +L +N   D  +  +
Sbjct: 543 IVELIAELLHCSNMGLMNSKKAERIVKERDEVRNHMVKQLQDALTELNMNDGNDRTKGDE 602

Query: 465 TAQQNDKHDAFDGIQSENES-HDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIG 523
                       G+ + N S   +   +N + ++EIDE+FEIPY+N NQNSKL  NPTIG
Sbjct: 603 K--------GLTGLCATNTSMSTQTTAVNDNADEEIDESFEIPYLNMNQNSKLPHNPTIG 654

Query: 524 DLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNL 583
           DLFKI+LYD Q++PKI++LF+ HPWNNFWHNV+FDIIQQIFNGRMDFSYNSFLV+SLFN 
Sbjct: 655 DLFKIQLYDTQLLPKIIQLFIEHPWNNFWHNVVFDIIQQIFNGRMDFSYNSFLVYSLFNN 714

Query: 584 EGSFQY---MDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEE 640
           + + Q+   +  E  +     DF+IT+D +L+GY  S+ FYE+ NTNLG+MGHLVLIAEE
Sbjct: 715 KDAGQFVIDVKPEENRAQDFTDFAITRDLVLQGYKNSHAFYEQYNTNLGYMGHLVLIAEE 774

Query: 641 VVKFSKLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVP 700
           +VKFSK+YKVELIS DI   LQ+ DW +YSE+ LN TR+MYSKILGG  ++ + NG    
Sbjct: 775 IVKFSKVYKVELISPDIHRVLQDPDWIFYSEDALNDTRMMYSKILGGSEYLGEENGCTAA 834

Query: 701 QMNDGNYLDYDDENDVS-GGKLINVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKN 759
           +M     L    EN    GGKL          S ST++DLH KL++ L+ ++Q+EVD KN
Sbjct: 835 EMEQ---LTETGENLPEFGGKL-------SGYSFSTQADLHQKLKEKLIKRSQEEVDLKN 884

Query: 760 AANGVI 765
             NGVI
Sbjct: 885 KKNGVI 890

>Scas_687.19
          Length = 956

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/819 (52%), Positives = 572/819 (69%), Gaps = 70/819 (8%)

Query: 3   INGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKEN 62
           +N  +++E T PL    + + LD+SF+DR++ + E LNEL  QN  L+DFIC+GFFF   
Sbjct: 114 LNSEDISETTTPLN--VSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPI 171

Query: 63  EKERVENIDYLLDQLLFCVDQFKMVEADT-------VNVTRENSPADEGIEMDFNKVIED 115
            KE+V+N+DYL+D LL  VD+  M  A T       +  T E    +E      N+ + +
Sbjct: 172 TKEKVQNLDYLIDSLLAYVDEIPMEIAKTEKKEEVKIYATDEEKQTEEEQAEAANEELAN 231

Query: 116 NAEDEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIF 175
                   LS+A +I+E  +LD+W++T++L+KN+ +LSK+W+++ +     E S L+ IF
Sbjct: 232 EVPTS---LSKATIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIF 288

Query: 176 LKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIEL 235
           LK+NQNLL +R + Y+ FI +  +LVD++L HID++++MDFFLK+I+TD+IESPTGVI+L
Sbjct: 289 LKINQNLLFSRTENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQL 348

Query: 236 VSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASP 295
           V DQKLI K L+FL+N  YS+D+Q+C  DFLKALI ISANAP+D+++IGPNSLTR LAS 
Sbjct: 349 VCDQKLIYKSLQFLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASN 408

Query: 296 KSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLG 355
           ++ID +I I+LN+RG AL++ +SIVIELIRKNNSDYDQVNLL+TT+  +PP DRDPI+LG
Sbjct: 409 EAIDILIDIILNKRGYALDTAVSIVIELIRKNNSDYDQVNLLETTIIDNPPIDRDPIYLG 468

Query: 356 YLLRRFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHC 415
           YLL++F+ NLP   +                   Q++EKF P+GFERFKIVELIAELLHC
Sbjct: 469 YLLKKFSINLPNFLK---IIVDIETDDSIPLRENQLHEKFKPLGFERFKIVELIAELLHC 525

Query: 416 SNMGLLNTKRAERIARVRDKVRKQV-SFQLQDALNDLTINPSVDNKRKSDTAQQNDKHD- 473
           SNMGL+N+++AE+IA  RDK RK+  S+ +   L++L    S+ +K    T   +D +D 
Sbjct: 526 SNMGLMNSRKAEKIALKRDKYRKRANSYDVHHTLSNL----SIRDKNSITTLTGSDSNDL 581

Query: 474 --------------AFDGIQSENESHDEFEHINQDEN----------------DEIDETF 503
                             ++    ++D   +IN   N                +EIDE+F
Sbjct: 582 KSNNDNSNDFNENDDTKAVKKPKTNND--PNINTSINASEEQEEVNEESDSSIEEIDESF 639

Query: 504 EIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQI 563
           EIPYINE+QN KLR  PT+GDLFKI LYD Q++P+IMKLFL HPWNNFWHNVIFDIIQQI
Sbjct: 640 EIPYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNVIFDIIQQI 699

Query: 564 FNGRMDFSYNSFLVFSLFNLEGSFQYMDSEA-AKDAKLKD--FSITKDFILEGYHKSYKF 620
           FNGRMDFSYNSFLV+SLFNL+GS QYM  +  A    ++D  F+IT DFIL+GYH S+KF
Sbjct: 700 FNGRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIENIEDVNFAITTDFILKGYHDSFKF 759

Query: 621 YEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLM 680
           YE + TNLG+MGHLVL+AEE++KFS+LYKVELIS DIQ++  + DW+YYS +VLN TR+M
Sbjct: 760 YETRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSNDVLNETRIM 819

Query: 681 YSKILGGGNFVEDANGNIVPQM-NDGN-----YLDYDDENDVS--------GGKLINVEN 726
           YSKILGGG +V+D NGNIVPQ+  DG       +   D+ + +        GG+LINVE 
Sbjct: 820 YSKILGGGTYVDDGNGNIVPQLATDGTPEENMGIPSSDDQEFNTNFQEMKDGGELINVEA 879

Query: 727 LEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI 765
           LEEQL LSTESDLH KLR+ML  + Q++VD +NA NGVI
Sbjct: 880 LEEQLMLSTESDLHNKLREMLASQGQKQVDDRNAKNGVI 918

>KLLA0A01155g complement(104687..107668) some similarities with
           sp|P43612 Saccharomyces cerevisiae YFR040w SAP155
           SIT4P-associated protein, hypothetical start
          Length = 993

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/643 (57%), Positives = 485/643 (75%), Gaps = 48/643 (7%)

Query: 123 YLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNL 182
           +L++AN+I+EIF+LDIWLI+ESLVKN E+L+KIW++L++P F  E+SPLIPIFLK+NQNL
Sbjct: 393 FLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNL 452

Query: 183 LITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLI 242
           L+TRQDQYLNFIR++ +LV DML HIDI+LLMDFFLK+++TDK E+PTG+IELVS+QKLI
Sbjct: 453 LLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLI 512

Query: 243 DKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMI 302
           D L  FL N  YSADIQAC  DF+K++I +SANAPLDE+SIGPN+LTR +AS K ID ++
Sbjct: 513 DHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLL 572

Query: 303 KIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFA 362
             ++NERG AL + +SI IELIRKNNSDYDQVNLL TT+++HPPS RDP++LG +LR+F+
Sbjct: 573 GCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFS 632

Query: 363 ANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLN 422
            NL  L +                   QM E + P+GFERFK+VELIAELLHCSNMGL+N
Sbjct: 633 ENLVNLKQ---ILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHCSNMGLMN 689

Query: 423 TKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSEN 482
           +K+AERI + RD+VR ++  QL+DAL DL I      K K               + ++N
Sbjct: 690 SKKAERIVKERDQVRTELVQQLEDALTDLNI------KSK---------------LTADN 728

Query: 483 ESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKL 542
            + D    ++ D  D+IDE+FE+PY+N+NQN+KLR+NPTIGDLFKI+LY+ Q++P I++L
Sbjct: 729 HNSDSPTELSLD--DDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQL 786

Query: 543 FLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKD 602
           F+ +PWNNFWHNVIFDIIQQIFNGRMDFSYNSFLV++LF+ + + ++   +   DA + D
Sbjct: 787 FIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAPI-D 845

Query: 603 FSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQ 662
           F IT+D +L GY  S+KFYE+ NT LGFMGHLVLIAEE+VKFSK+YKV+LIS DI + L 
Sbjct: 846 FQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDIHEVLL 905

Query: 663 EDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDYDDENDVSGGKLI 722
           ++DW +YS ++LN TR+MYSKILGGG+++ED N                    ++GG ++
Sbjct: 906 DEDWDFYSNDILNDTRIMYSKILGGGDYIEDGN--------------------LNGGDIV 945

Query: 723 NVENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVI 765
            + N ++  S ST+ DLH KLR+ L+ K++QEVD KN  NGVI
Sbjct: 946 -MGNDQDPTSFSTQMDLHDKLREKLIEKSRQEVDEKNEKNGVI 987

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 46/62 (74%), Gaps = 1/62 (1%)

Query: 22  QRLDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVENIDYLLDQLLFCV 81
           Q L   F+D +L+E ELLNEL  QN  L+DF+CFG+F+ E   ++VENI YL+D+LL C+
Sbjct: 213 QALSHKFMDEILEETELLNELTRQNNTLLDFVCFGYFYTET-GDKVENIAYLIDRLLDCI 271

Query: 82  DQ 83
           D+
Sbjct: 272 DK 273

>Scas_712.21
          Length = 828

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/748 (52%), Positives = 519/748 (69%), Gaps = 58/748 (7%)

Query: 24  LDSSFIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVENIDYLLDQLLFCVDQ 83
           LD+SFI+R+L E +L++EL  +N  L+DF+CFG+FF  + K ++ N+ YL+DQL+ CV  
Sbjct: 102 LDNSFIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSK-KIMNMQYLIDQLISCVQY 160

Query: 84  FKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDED--EYLSRANLIAEIFSLDIWLI 141
                  +V+  + N                DN   ++   +L +A +I+ I S D WLI
Sbjct: 161 LTNASITSVDEDKAN----------------DNMRSQEGPNFLHKATIISNILSFDEWLI 204

Query: 142 TESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLV 201
           +ESL+KN  +L++IW++L N   + E SPL+PIFLK+N++LL++R+DQYLNFIR++ +LV
Sbjct: 205 SESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLV 264

Query: 202 DDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQAC 261
           D+   H++I +L+DF LKLI+TDK + PTG+IEL+ DQ++I K LKF  N+ YSAD+QAC
Sbjct: 265 DEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFKNDQYSADVQAC 324

Query: 262 VCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVI 321
             DFLKALI ISAN PLDE+S+GPN L+R LASP  +D +I I+LNE G ALN TIS+VI
Sbjct: 325 ASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLINIILNENGTALNHTISVVI 384

Query: 322 ELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEXXXXXXXXXXX 381
           ELIRKNNSDYD++NLL+TT  +H PS+RDPI+LGYLL++F+  +  +F            
Sbjct: 385 ELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIF--ALVDDMADKT 442

Query: 382 XXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVS 441
                   Q+N++F P+GFER KIVELIAELLHCSNMGL+N+KRAE IA  RD +R Q+ 
Sbjct: 443 IMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQLP 502

Query: 442 FQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSENESHDEFEHINQDEN----- 496
            QLQDAL DL IN +  +   SD    N+  D   G  ++ +     E++++        
Sbjct: 503 HQLQDALQDLEINKTEHSDIISDNNSINN--DLTTGSVTDEDEDVLIENVSEHPERSFID 560

Query: 497 ------------DEIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFL 544
                        EID++FEIPYINE QNSKLR  PTIGD FKI LYD QII KI+ LFL
Sbjct: 561 SDSDDDLDTIDVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQIIIKILILFL 620

Query: 545 NHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAK----L 600
            +PWNNFWHNVIFDIIQQ+FNGRMDFSYNSF+V+SLFNLE + Q+  +++  ++     L
Sbjct: 621 KNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILL 680

Query: 601 KDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDS 660
            +F+ITKDFIL GY KSY+FYE+  TNLG+MGHLVLIAEEVVKFSKLYKVELIS DIQ  
Sbjct: 681 GNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKI 740

Query: 661 LQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGN--YLDYDDENDVSG 718
           LQE +W +Y +EVL+ TR+MYSKILGGG+FV+D NGN+VPQ  + +  Y ++ + ND   
Sbjct: 741 LQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGNGNVVPQFIESSDPYEEHLETND--- 797

Query: 719 GKLINVENLEEQLSLSTESDLHLKLRDM 746
                    E   SL TE D+HLK+ ++
Sbjct: 798 ---------ETSESLLTELDIHLKVGEI 816

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/773 (41%), Positives = 472/773 (61%), Gaps = 55/773 (7%)

Query: 17  GEETEQR--LDSSFIDRMLKEGELLNEL-AAQNKGLIDFICFGFFFKENEKERVENIDYL 73
           G E+  R  L+ SFIDR+L E  LL+EL  A N  L+DFIC G+F+ ++  ++V ++DYL
Sbjct: 53  GTESRDRSDLNQSFIDRILLETALLDELNGAANDRLVDFICLGYFY-DDRSQQVRHMDYL 111

Query: 74  LDQLLFCVDQFKMVEADTVNVTRENSPADEGIEMDFNKVIEDNAEDEDEYLSRANLIAEI 133
           +D L+          A   ++ R        +E  F++  E   +D+++ +   N+I+ I
Sbjct: 112 VDMLM----------AYLKDIDRTGYRTPFLLENSFHQTGEYEDQDDEDPMLYVNIISSI 161

Query: 134 FSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNF 193
           F      I E+LV+N   LS ++ +    N + E  P++ +FLK+N+ LL  +   YL F
Sbjct: 162 FCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAENCPILAVFLKINETLLFEQTSSYLEF 221

Query: 194 IRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNL 253
            +SQ ++VD  L HI+++ L++F +K++ TD++ESPT +I+ +  Q LI K L  L N+ 
Sbjct: 222 FKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVESPTNIIDFLYHQDLIPKCLNLLENSK 281

Query: 254 YSADIQACVCDFLKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAAL 313
           YS  IQ    + LKALI IS N  LD L IGPN LTR+LASP+ +D++I I+L +RG A+
Sbjct: 282 YSPGIQNSSGELLKALISISTNFKLDTLWIGPNRLTRQLASPQYVDQLINIILFQRGHAM 341

Query: 314 NSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFE--- 370
              +SI+IELIRKNNSDYD+V+LL TT+  +PPS RDP++LG+LL     ++   +    
Sbjct: 342 GVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQRDPVYLGHLLYELTMHMEDFYALLI 401

Query: 371 --------XXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLN 422
                                      Q++E F P+GFER KI ELI+E+LHCSNMGL+N
Sbjct: 402 KLENDDDDDHDTASKALPSVKHHLLENQLHESFRPLGFERVKITELISEMLHCSNMGLMN 461

Query: 423 TKRAERIARVRDKVRKQV-SFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQS- 480
           +KR E+IAR RDK R  +    L+ A+ +L IN   DN   S+T +    ++  +     
Sbjct: 462 SKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIN---DNTITSNTLEDKCNNNDSNDSNDN 518

Query: 481 ------------ENESHDEFEHINQDENDEIDETFEIPYINENQNSKLRTNPTIGDLFKI 528
                       +NE +  F+  + + +D+ D +FEIPY++E QN K+R NPTIGDLFKI
Sbjct: 519 QKQKKNIKKKFHDNELYSTFDTSDDNIDDDDDMSFEIPYVSETQNLKIRKNPTIGDLFKI 578

Query: 529 KLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQ 588
           KL+D    PK ++LFL +PWNNFWHN++FDIIQQIFNGRMDFSYNSFLV+SLF+ + S +
Sbjct: 579 KLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQQIFNGRMDFSYNSFLVYSLFDFKKSTR 638

Query: 589 YMDSE---AAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFS 645
           ++      + +   +KDF I  DFIL+G+  S++FYE++ TNLG+MG LVLIAEE+ K+S
Sbjct: 639 FIPKPLYGSNQKLPVKDFHIISDFILQGHKDSFEFYEKEKTNLGYMGQLVLIAEEIAKYS 698

Query: 646 KLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNI------V 699
           K+YK +LI+ DI   LQ++ W  YS ++LN TR M S ILGGG F  +++ N        
Sbjct: 699 KIYKTDLIAPDIYAFLQDEVWMSYSSDILNETRTMCSIILGGGQFCAESDENTNQDFLEK 758

Query: 700 PQMNDGNYLDYDDENDVSGGKLI----NVENLEEQLSLSTESDLHLKLRDMLV 748
             M+   +    DEN++   + +     V  L ++L   TE D+H K++D++V
Sbjct: 759 ADMSKPAHPSTMDENEIVHEEDVKLHDKVAELIDELGQLTELDIHDKIKDVIV 811

>CAGL0L03586g complement(408095..411466) similar to sp|P40856
           Saccharomyces cerevisiae YJL098w SAP185 or sp|P36123
           Saccharomyces cerevisiae YKR028w SAP190, start by
           similarity
          Length = 1123

 Score =  384 bits (986), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 241/603 (39%), Positives = 351/603 (58%), Gaps = 67/603 (11%)

Query: 112 VIEDNAEDEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPL 171
            +  + E++DE L RA + AE+ S D+W I+ ++++N++ L K+W+++  P      +PL
Sbjct: 236 TVRQDYEEQDE-LRRARMAAEVLSADVWPISSAIIQNEDLLEKLWSIMQYP------APL 288

Query: 172 IPI-----FLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKI 226
            PI     F+K+N+ LL    +  L FI +  +L+D  L HID   LMDF LK+ISTDK 
Sbjct: 289 -PIEISTYFMKINERLLDMDLNGILAFILNHPNLLDIFLTHIDNPPLMDFLLKVISTDKA 347

Query: 227 ESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLD-ELSIGP 285
           ++PTG+I+++ +Q +I KLL FL+   Y    Q+   DF+KAL+ IS N   +   SIGP
Sbjct: 348 DTPTGIIKILKEQGMIPKLLDFLSPE-YDKSTQSAAGDFIKALVTISGNCNNEIASSIGP 406

Query: 286 NSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHP 345
           N + R L SP  ++K+I I+L + G++L++ + IVIELIRKNNSDYD V L  TT++THP
Sbjct: 407 NEMIRELVSPPMVEKLISIML-KAGSSLSNGVGIVIELIRKNNSDYDFVQLAYTTIKTHP 465

Query: 346 PSDRDPIFLGYLLRRFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKI 405
           P+DRDPI+LGYLL+ FAA++ +  +                       +  P+GFERFKI
Sbjct: 466 PNDRDPIYLGYLLKAFAAHMAEFTQMLTSIELPPLQTPQG--------EIEPLGFERFKI 517

Query: 406 VELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNK----- 460
            ELIAELLHCSNM LLN    E I + RD+ R+++       LND + N   DN      
Sbjct: 518 CELIAELLHCSNMTLLNDPNGESIVKERDEERERILKLENQKLNDESDNEIEDNNIPTTD 577

Query: 461 RKSDTAQQNDK-HDAFDGIQSENESH-DEFEHINQDENDEIDETFEIPYINENQ------ 512
            KSDT+Q+++K  +  + +Q ++E + D+ +   Q ++D + + FE    NE +      
Sbjct: 578 LKSDTSQEDEKIANEMNDLQLDSEGNADDTDGSEQAKSDTVRDEFESKETNEEEYLENIS 637

Query: 513 -----NSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGR 567
                  KLR NPT+GD  KI L D ++I  I+++F ++ WNNF HNV+FDIIQQIFNG 
Sbjct: 638 DDSETEHKLRENPTVGDQLKIALEDTRVIEVILEMFFHYVWNNFLHNVVFDIIQQIFNGP 697

Query: 568 MDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNT- 626
           +   YN FL+  L                   LK+  +T D I++G  +S   YEEK+  
Sbjct: 698 LMTGYNRFLLIDL-------------------LKNIHMT-DLIIKGNEQS-GVYEEKHVL 736

Query: 627 NLGFMGHLVLIAEEVVKFSKL---YKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSK 683
            LG+MGHL L+AEE+VKF       K+   +  I   L E  W+YY+E  L   R  Y+ 
Sbjct: 737 RLGYMGHLTLMAEEIVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETELADLREKYNT 796

Query: 684 ILG 686
           ILG
Sbjct: 797 ILG 799

>KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces
           cerevisiae YKR028w SAP190 SIT4P-associated protein,
           start by similarity
          Length = 1100

 Score =  376 bits (965), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 236/595 (39%), Positives = 330/595 (55%), Gaps = 62/595 (10%)

Query: 126 RANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPI----FLKMNQN 181
           RA + AEI S D+W I+ + + N++ L K+W+ L +P      +PL  I    F+K+N+ 
Sbjct: 284 RARIAAEILSADVWTISSAFMDNEDLLVKLWSTLEHP------APLSIIASTYFMKINER 337

Query: 182 LLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKL 241
           LL       +NFI  Q ++VD  + HID   LMDF LK+ISTDK ++PTG+I L+  Q L
Sbjct: 338 LLDMDISGMINFILKQENIVDRFIAHIDNPPLMDFLLKVISTDKPDAPTGIIALLKKQHL 397

Query: 242 IDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELS-IGPNSLTRRLASPKSIDK 300
           I KLL +L+   + + IQ+   DFLKALI ISAN+  +  S IGPN LTR L S + + K
Sbjct: 398 ISKLLDYLSIE-HDSSIQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSAEMVSK 456

Query: 301 MIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRR 360
           ++ I+L + G +L++ + IVIELIRKNNSDYD V ++ TTLETHPPSDRDP++LG+L+R 
Sbjct: 457 LVNIML-QCGTSLSNGVGIVIELIRKNNSDYDFVQVMYTTLETHPPSDRDPVYLGHLVRC 515

Query: 361 FAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGL 420
           FA  + +  +                          P+GFERFKI EL+AELLHCSNMGL
Sbjct: 516 FANKMDRFNKILLETKLDPLETPFGSIE--------PLGFERFKICELVAELLHCSNMGL 567

Query: 421 LNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDN--KRKSDTAQQNDKHDAFDGI 478
           L     E I   RD  R+++  ++++ L +   + +       + DTA  N+ H     +
Sbjct: 568 LGEPSGEAIVLERDLKREEILKEMEEQLENENASDAETGYYDGEDDTAHANNLHRELQDL 627

Query: 479 Q-----SENESHDEFEHINQDEND--EIDETF--------EIPYINENQNSKLRTNPTIG 523
                  ++E+ DE E + +D  D  ++D +         E    +E     LR NP +G
Sbjct: 628 NINATLKDSEATDEVEDV-KDVGDAGDVDASLAERTDIHSETSSDSEVTEKVLRENPVVG 686

Query: 524 DLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNL 583
           DL KI L D  II  I+ +F   PWNNF HNV+FDI+QQIFNG +   YN FL+  LF+ 
Sbjct: 687 DLLKISLQDNNIITTILDMFFRFPWNNFLHNVVFDIVQQIFNGPLKSGYNKFLLADLFS- 745

Query: 584 EGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVK 643
                                IT D I+EG  K  ++ +E    LG+MGHL LIAEEV K
Sbjct: 746 ------------------SAHIT-DVIMEGDRKCLEYEKETGIRLGYMGHLTLIAEEVAK 786

Query: 644 FSKLYK---VELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDAN 695
           F+   +   V   S  +Q+ L E  W+ Y + +L  TR  YS +LG   F E  N
Sbjct: 787 FAAYIEEANVTFASPVVQEGLNEPKWKEYCDTILTETREKYSSLLGDDGFDEGEN 841

>AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W
           (SAP185) - SH] complement(590137..593232) [3096 bp, 1031
           aa]
          Length = 1031

 Score =  368 bits (944), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 247/648 (38%), Positives = 343/648 (52%), Gaps = 81/648 (12%)

Query: 119 DEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPI---- 174
           DE     RA + AEI S D+W I+ + +++ E L K+W++L +P      +PL  +    
Sbjct: 204 DEQVQSRRARMAAEILSADVWPISSAFIEHDELLYKLWSILDHP------APLSIVASTY 257

Query: 175 FLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIE 234
           F+K+N+ LL       + FI +Q +LVD  L HID   LMDF LK+ISTDK ++PT VI 
Sbjct: 258 FMKINERLLDMDIASMIRFILNQDNLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIG 317

Query: 235 LVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELS-IGPNSLTRRLA 293
           L+  QKLI KLL  L+   +S+ +Q+   DFLKALI ISAN+  +  S IGPN LTR L 
Sbjct: 318 LLKYQKLISKLLDHLSPE-WSSSVQSAAGDFLKALITISANSNNEIASAIGPNELTRELV 376

Query: 294 SPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIF 353
           SP    K+  I+LN  G +L++ + IVIELIRKNNSDYD   ++ TTL+THPP+DRDP++
Sbjct: 377 SPAMASKLGDIMLN-GGTSLSNGVGIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVY 435

Query: 354 LGYLLRRFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELL 413
           LG+L++ FA  LP+                             P+GFERFKI ELIAELL
Sbjct: 436 LGHLVKSFANKLPEFNAMLLDTKLPPLETPFGTIE--------PLGFERFKICELIAELL 487

Query: 414 HCSNMGLLNTKRAERIARVRDKVRKQV----SFQLQDALNDLTINPSVDNKRKSDTAQQ- 468
           HCSNMGLLN  + E I   RD  R+ V     + +    +D   + SV    + D A++ 
Sbjct: 488 HCSNMGLLNEPKGEEIVNERDIDRECVLRLEGYGIPKNCHDEERSVSVSPIEEEDLAKKI 547

Query: 469 NDKHDAFDGIQSENESHDEFEHINQDENDEIDETFEIPYINENQNSK--------LRTNP 520
            D     D   S + S    E +N D         ++     +++S         LR  P
Sbjct: 548 RDLQLVTDKRPSSDNS---VESLNSDSQQATTPIHQLGTEIHSEDSSDAELSEQALREKP 604

Query: 521 TIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSL 580
            +GD  KI L D +II  I+ +F  +PWNNF HNV+FDI+QQIFNG +   YN FL+  L
Sbjct: 605 VVGDQLKIALQDNKIITTILGMFFKYPWNNFLHNVVFDIVQQIFNGPLKTGYNRFLLADL 664

Query: 581 FNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEE 640
           F                       IT + I+EG  K +++  E    LG+MGHL L+AEE
Sbjct: 665 F-------------------ASAHIT-EAIIEGDRKCHEYERETGLRLGYMGHLTLVAEE 704

Query: 641 VVKFSKL---YKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGN 697
           V KF+      K+   +  I +SL +  W+ Y+E VL  TR  YS +L  G+  E+   N
Sbjct: 705 VTKFASYIDEMKISFSNPVISESLNDQRWREYTELVLAETRGKYSTVL--GDLAEEEGRN 762

Query: 698 IVPQMND--------------GNYLDYDDEN-----DVSGGKLINVEN 726
           +    N+              G+Y ++DDEN     DV G +    E+
Sbjct: 763 VGKGANEEDNARYYNSDEIYHGSYAEHDDENYAEYSDVDGNRYYEYED 810

>Scas_711.22*
          Length = 1018

 Score =  366 bits (939), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 259/714 (36%), Positives = 377/714 (52%), Gaps = 87/714 (12%)

Query: 9   AELTVPLTGEE-TEQRLDSSFIDRMLKEGELLNELAAQN-------------KGLIDFIC 54
           +E ++P T  E  E R +   +D +L E E+  EL   N               L+D+I 
Sbjct: 75  SEDSLPSTEAEFKEYRPNLEILDDLLDEEEVYTELMCSNFKLLMYFKYPEVLSRLLDYIK 134

Query: 55  FGFFFKENEKERVENIDYLLDQLLFCVDQFKMVEADTVNVTRENSPADEG-IEMDFNKVI 113
           F     E E E V   D          +   +   D +N T E S   +   E + + V 
Sbjct: 135 FDEQNTEKEDEEVIEGD---------AEHSDLDSEDYINGTEEASEEQQSNDETNESDVS 185

Query: 114 EDN-----AEDEDEY-LSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNP-NFKF 166
           EDN     AE E++  + RA++ +EI S ++W I+ ++++N E L+K+W++L +P     
Sbjct: 186 EDNSVTLPAELEEQIEVRRAHMASEILSAEVWGISNAILENDELLTKLWSILDHPIPLSI 245

Query: 167 ERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKI 226
           E S     F+K+N+ LL T     + FI SQS+LV   L HID   L+DF LK+IS+DK 
Sbjct: 246 ETSTY---FMKINERLLDTDITGMVTFILSQSTLVARFLKHIDNPPLLDFLLKVISSDKP 302

Query: 227 ESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLD-ELSIGP 285
           ++PT VI+ + +Q LI +LL  L++  Y    Q    DFLKA + IS N   +   SIGP
Sbjct: 303 DAPTRVIQCLKEQGLIPRLLDCLSHE-YDPSTQTAAADFLKAFVTISGNCNSEIASSIGP 361

Query: 286 NSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHP 345
           N LTR+L SP+ ++K+IKI+L   G +L++ + I+IELIRKNNSDYD V ++ TTLETHP
Sbjct: 362 NELTRQLVSPEMMEKLIKIMLT-GGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHP 420

Query: 346 PSDRDPIFLGYLLRRFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKI 405
           P+DRDPI+LGYL+  FA  +P+  +                          P+GFERFK+
Sbjct: 421 PNDRDPIYLGYLVSLFAQYMPEFNKFLLDTNSTMLRTSFG--------NITPLGFERFKV 472

Query: 406 VELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDT 465
            ELIAELLHCSNM LLN  + E I + RD+ RK+V       LN   I+ S +     DT
Sbjct: 473 CELIAELLHCSNMSLLNEPKGEAIVKERDEERKRV-------LNFSHISDSEEANMNGDT 525

Query: 466 A--QQNDKHDAFDGIQSENESHDEFEHINQDEND-EIDETFEIPYINENQNS-------K 515
              +  +  +  D ++ E+E  +E   +N+ E++  + E+ ++    E+  S        
Sbjct: 526 TTIEGEEITERIDSLKLESE--EEIRELNEKEDESSVAESSDVEAAPEDHISDSPATEKS 583

Query: 516 LRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSF 575
           +R    +GD+ K  LYD  I+  I+K+F   PWNNF HNV+FDIIQQIFNG +   YN F
Sbjct: 584 IRDEKIVGDVLKTLLYDTGIVVNIVKMFFQFPWNNFLHNVVFDIIQQIFNGPLKTGYNIF 643

Query: 576 LVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLV 635
           L+  L       Q                     +L+G  +S ++ E  +  LG+MGHL 
Sbjct: 644 LLKDLLTRAHLTQ--------------------LLLDGDTRSREYEERTHFRLGYMGHLT 683

Query: 636 LIAEEVVKFSKL---YKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILG 686
           LI EE++KF+      KV     DI D+LQ+  W  Y++ +L  TR  Y   LG
Sbjct: 684 LIGEEILKFAAYLEETKVVFTEDDIVDALQDSAWIEYADTILADTREKYETALG 737

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score =  345 bits (885), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 235/596 (39%), Positives = 325/596 (54%), Gaps = 79/596 (13%)

Query: 126 RANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPL-IPI---FLKMNQN 181
           RA + AEI S D+W I+ ++++NK+ L ++W++L +P      +PL IP    F+K+N+ 
Sbjct: 215 RARIAAEILSADVWPISAAIMQNKDLLGRLWSILDHP------APLPIPASTYFMKINER 268

Query: 182 LLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKL 241
           LL       L FI S+ SLV   L H+D   LMDF LK+ISTDK +SPTGVI+++  Q+L
Sbjct: 269 LLDMDITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVISTDKPDSPTGVIKILKSQEL 328

Query: 242 IDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLDELS--IGPNSLTRRLASPKSID 299
           I KLL  LN   Y    Q+   DF+KA + +S N+  +EL+  IGPN LTR+L S + I+
Sbjct: 329 IPKLLDHLNPE-YGISTQSAAGDFIKAFVTLSTNSS-NELASGIGPNELTRQLVSEEMIE 386

Query: 300 KMIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLR 359
           K+IKI+L + G +L++ + I+IELIRKNNSDYD + L+ TTLE+HPP+DRDPI L +L++
Sbjct: 387 KLIKIML-KGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLESHPPTDRDPIHLIHLVK 445

Query: 360 RFAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMG 419
            FA ++P   +                          P+GFERFKI ELIAELLHCSNM 
Sbjct: 446 LFAKHMPDFADMLDKTKLPLMEMPFGNIE--------PLGFERFKICELIAELLHCSNMT 497

Query: 420 LLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSVDNKRK--SDTAQQNDKHDAFDG 477
           LLN    E IA+ RD  R +   +L+ +     I   VDNK         + D  +    
Sbjct: 498 LLNEPNGEMIAQERDIERAK---ELETSTEKENITAIVDNKSSYYDKDCVEKDITENLGA 554

Query: 478 IQSENESHDEFE-----------HINQD-------ENDE-----IDETFEIPYINENQNS 514
           +Q  N+  +E E            +  D       END       DET       E+   
Sbjct: 555 LQINNQGSEEDELNDTGVSSVKLDVKSDAKVVEGLENDASGVELYDETLS---DTESVRE 611

Query: 515 KLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNS 574
            LR  P +GD  KI L D +I+  I+ +F   PWNNF HNVIFDI QQIFNG +   YN 
Sbjct: 612 CLREKPLVGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLKTGYNR 671

Query: 575 FLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNT-NLGFMGH 633
           FL+                  KD  L D  +TK  +     K+ + YE+K     G+MGH
Sbjct: 672 FLL------------------KDY-LVDAYLTKKIV--DADKACQDYEKKTGLRYGYMGH 710

Query: 634 LVLIAEEVVKFSKL---YKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILG 686
           L L+AEE+ KF +     K+   +T + D L+E  W+ YSE +L  TR  Y+ +LG
Sbjct: 711 LTLVAEEISKFKEYIDEMKLTFCNTAVSDRLEEPFWKEYSETILADTREKYNTVLG 766

>YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3177 bp, 1058 aa]
          Length = 1058

 Score =  343 bits (881), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 225/607 (37%), Positives = 327/607 (53%), Gaps = 85/607 (14%)

Query: 126 RANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLI----PIFLKMNQN 181
           RA + AEI S D+W I+ +L++N+  L+K+W++L  P      SPL       F+K+N+ 
Sbjct: 208 RARIAAEILSADVWPISSALIENEGLLAKLWSILRLP------SPLSIEASTYFMKINER 261

Query: 182 LLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKL 241
           LL    D  + FI  +  +VDD L HID   LMDF LK+ISTDK E   GVI+L   Q L
Sbjct: 262 LLDMNMDGIIEFILKKEHIVDDFLAHIDNPPLMDFLLKVISTDKPEISNGVIQLFKKQNL 321

Query: 242 IDKLLKFLNNNLYSADIQACVCDFLKALIVISANAPLD-ELSIGPNSLTRRLASPKSIDK 300
           + KL+  L+  ++ +  Q+   DFLKAL+ IS N P +   SIGPN LTR+L SP  + +
Sbjct: 322 VPKLIHLLDP-VFDSCTQSAAGDFLKALVTISGNCPNEITSSIGPNELTRQLVSPNMMKQ 380

Query: 301 MIKIVLNERGAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRR 360
           ++ I+L + G +LN+ + I+IELIRKNNSDYD +    TT+E+HPP+DRDPI+LGYL++ 
Sbjct: 381 LMDIML-KGGNSLNNGVGIIIELIRKNNSDYDTIQTNYTTIESHPPTDRDPIYLGYLVKM 439

Query: 361 FAANLPKLFEXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGL 420
           F+ ++    +                          P+GFERFKI ELIAELLHCSNM L
Sbjct: 440 FSEHMADFNKILTEKKIPLLQTSYGTIE--------PLGFERFKICELIAELLHCSNMTL 491

Query: 421 LNTKRAERIARVRDKVRKQVSFQLQDAL----------NDLTINPSVDNKRKSDTAQQND 470
           LN   A  I R RD  R+++ F  Q+ +          N+       D++ + DT Q   
Sbjct: 492 LNEPSAYDIVRERDAERERI-FNSQNYVDSNDRSELKENEDDNTGDADDEVEDDTNQVES 550

Query: 471 KHDAFDG---IQSENESHDEFEHINQDENDE--------------IDETFEIPYINENQN 513
            + + DG   I   N    E   +NQ+ N+E               DE  E P+  E Q 
Sbjct: 551 ANTSIDGEEVIDKLNSLQIETNKVNQNMNNEEQHSLMPDFNNGDFKDEEDENPF--EPQY 608

Query: 514 SKL-----------RTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQ 562
           S +           R +P +GD  KI L D ++I  ++++F +  WNNF HNV++D++QQ
Sbjct: 609 SDVILDSSDIEKNFRVSPNVGDQLKISLQDTRVIDTMLEMFFHFQWNNFLHNVVYDVVQQ 668

Query: 563 IFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYE 622
           IFNG +   YN FL+                   D  L +  +T D I+ G ++  ++ +
Sbjct: 669 IFNGPLKIGYNRFLL-------------------DDLLINIRLT-DMIINGNNECIEYEK 708

Query: 623 EKNTNLGFMGHLVLIAEEVVKFSKLYK---VELISTDIQDSLQEDDWQYYSEEVLNRTRL 679
             +T LG+MGHL LIAEEV KF+   +   +   +T++  SL E  W  Y+E+VL   + 
Sbjct: 709 GHDTRLGYMGHLTLIAEEVTKFTAYIEEMNITFENTEVMSSLFESKWIAYTEDVLEDLKE 768

Query: 680 MYSKILG 686
            Y+ ILG
Sbjct: 769 KYNAILG 775

>Kwal_26.7346
          Length = 747

 Score =  331 bits (848), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 210/509 (41%), Positives = 285/509 (55%), Gaps = 55/509 (10%)

Query: 191 LNFIRSQSSLVDDMLMHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLN 250
           L+FI +Q +LVD  L HID   LMD+ LK+ISTDK ++ TGVIE +  Q LI KLL  L 
Sbjct: 2   LHFILAQDNLVDRFLKHIDNPPLMDYLLKVISTDKPDTTTGVIERLDSQDLIPKLLDHLA 61

Query: 251 NNLYSADIQACVCDFLKALIVISANAPLDELS-IGPNSLTRRLASPKSIDKMIKIVLNER 309
           + ++S   ++   DFLKALI ISAN+  +  S IGPN LTR+L SP  ++K++ I+L+  
Sbjct: 62  S-VHSPSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRKLVSPSMVEKLMNIMLS-G 119

Query: 310 GAALNSTISIVIELIRKNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLF 369
           G +L++ + I+IELIRKNNSDYD V ++ TTLETHPP+DRDPI+LGYL++  A +LP+  
Sbjct: 120 GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCSAKHLPEFN 179

Query: 370 EXXXXXXXXXXXXXXXXXXXQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERI 429
           +                          P+GFERFKI EL+AELLHCSNM LLN    E I
Sbjct: 180 KILVETELPPLETPFGSIE--------PLGFERFKICELVAELLHCSNMTLLNEPNGEEI 231

Query: 430 ARVRDKVRKQVSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQ--------SE 481
              RD VR++           L    + +N+  +DT  +++  D  D +         S 
Sbjct: 232 VSERDAVREK----------SLHAEQTDNNEGTADT--EDESEDVLDKMSDLRIATTTSS 279

Query: 482 NESHDEFEHINQDENDEIDETF-EIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIM 540
           +   D   H+ +D+++   E   E    +E     LR NP +GD  KI L D ++I  I+
Sbjct: 280 SSDEDNNSHMKEDDDEVGGEIHSEGSADSEIPEKVLRENPVVGDQLKIALQDNRVITTIL 339

Query: 541 KLFLNHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKL 600
           ++F   PWNNF HNV+FDI+QQIFNG +   +N FL+  LF                AKL
Sbjct: 340 EMFFAFPWNNFLHNVVFDIVQQIFNGPLKTGFNRFLIADLFT--------------GAKL 385

Query: 601 KDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKL---YKVELISTDI 657
                    I+EG  K   +  E    LG+MGHL LIAEEV KF+      K+   +  I
Sbjct: 386 ------THMIMEGDKKCEDYENETGLRLGYMGHLTLIAEEVAKFAAYVEEMKISFSNQAI 439

Query: 658 QDSLQEDDWQYYSEEVLNRTRLMYSKILG 686
            DSL E  W+ Y+E VL  TR  YS +LG
Sbjct: 440 TDSLDEPSWKEYTETVLADTRENYSSVLG 468

>Scas_675.36
          Length = 557

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 122/335 (36%), Positives = 171/335 (51%), Gaps = 59/335 (17%)

Query: 398 IGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALNDLTINPSV 457
           +GFE+FKI ELIAELLHCSNM LLN    E I   RD  R ++  Q +D  ND+  N + 
Sbjct: 1   LGFEKFKICELIAELLHCSNMTLLNEPNGEAIVTERDLERVKMFSQEED--NDM--NGTA 56

Query: 458 D----------NKRKSDTAQQNDKHDAF----DGIQSENESHDEFEHINQDE-----NDE 498
           D           ++ S+  +  +K +      + I SE     E EH + D      NDE
Sbjct: 57  DLQEEIEENSVAEKSSNGGEVTEKLNKLKIEPEQIISETNEEIETEHEDNDTDPVNTNDE 116

Query: 499 ID------ETFEIP----YINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPW 548
           +D      ET EI       +E   + LR NP  GD  KI L +  II  I+++F +  W
Sbjct: 117 LDVANGEVETAEIYDETLSDSEATEALLRENPIPGDQLKISLRETGIIRTILEMFFHFEW 176

Query: 549 NNFWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKD 608
           NNF HNV+FDI+QQIFNG +  +YN FL+  L  L GS                  I   
Sbjct: 177 NNFLHNVVFDIVQQIFNGPLRTTYNRFLLGDL--LTGS-----------------EIIH- 216

Query: 609 FILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKL---YKVELISTDIQDSLQEDD 665
            +L+G  K     E+    +G+MGHL+LIAEE+ KF +     K+   +  IQ+ L E  
Sbjct: 217 LVLDGDKKCAAQQEKHGLRIGYMGHLMLIAEEIAKFIEYIEEMKISFSNPAIQECLNEPQ 276

Query: 666 WQYYSEEVLNRTRLMYSKILGGGNFV-EDANGNIV 699
           W+ Y   +L  TR+ Y+ +L  G+FV ED +G+++
Sbjct: 277 WREYMATILADTRVKYNTVL--GDFVSEDGSGDLI 309

>Kwal_26.7343
          Length = 282

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 10/76 (13%)

Query: 126 RANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLHNPNFKFERSPLIPI----FLKMNQN 181
           RA + AEI S D+W I+ + + ++E LS++W++L +P      +PL  +    F+K+N+ 
Sbjct: 213 RARMAAEILSADVWPISSAFMDHEELLSQLWSMLDHP------APLSIVASTYFMKINER 266

Query: 182 LLITRQDQYLNFIRSQ 197
           LL       L+FI +Q
Sbjct: 267 LLDMDIAGMLHFILAQ 282

>CAGL0F03597g join(350747..350763,350897..352244) highly similar to
           sp|P32363 Saccharomyces cerevisiae YPL175w SPT14
           N-acetylglucosaminyltransferase
          Length = 454

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 89/198 (44%), Gaps = 30/198 (15%)

Query: 150 EHLSKIWNLLHNPNFKFERSPLIP-IF--LKMNQNLLITRQDQYLNFIRSQSSLVDDMLM 206
            +L+    + H P F   R    P IF    + +N+LI  Q Q ++   S S+   + ++
Sbjct: 51  RYLTNGLKVYHVPFFVLYRETTFPTIFSTFPVVRNILIREQIQIVHSHGSVSTFAHETIL 110

Query: 207 HIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFL 266
           H +        LK + TD   S  G   + S   L++KLL F   +L   D   CV +  
Sbjct: 111 HAN-----SMGLKTLFTD--HSLYGFDSMGS--ILVNKLLTF---HLTCIDRVICVSNTC 158

Query: 267 KALIVISANAPLDELSIGPNSLTR---RLASP-----KSIDKMIKIVLNE----RGAALN 314
           K  +V+  +   D + + PN++     R  SP     KS D++  +V++     +GA L 
Sbjct: 159 KENMVMRTDIEPDRVYVIPNAVVSKDFRPRSPQEERLKSNDRITIVVISRLFPNKGADL- 217

Query: 315 STISIVIELIRKNNSDYD 332
             +  +I +I + +SD D
Sbjct: 218 --LVRIIPIICQEHSDVD 233

>Sklu_2211.5 YBL105C, Contig c2211 10237-13764
          Length = 1175

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 689 NFVEDANGNIVPQMNDGNY-LDYDDENDVSGGKLINVENLEEQLSLSTESDLHLKLRDML 747
           +F   A GN  PQ+N+  Y LD    ++     L++   L EQL L  E   + + R + 
Sbjct: 652 SFTNGAAGNTSPQLNERLYTLDPASRSESDKNDLLDQSTLREQLRLEEEQKWYEEQRTIE 711

Query: 748 VVKAQQ 753
           + K QQ
Sbjct: 712 LRKQQQ 717

>Kwal_26.6759
          Length = 719

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 8/75 (10%)

Query: 653 ISTDIQDSLQEDDWQYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGNYLDYDD 712
           IS +   SLQ     +   EVLN +R   ++++G  +F E     ++P  N  N+L +  
Sbjct: 475 ISQNRITSLQGLSESHAHVEVLNVSR---NRLIGPLDFAE-----LMPPTNKRNFLMHLR 526

Query: 713 ENDVSGGKLINVENL 727
           E D+SG K+ +++NL
Sbjct: 527 ELDLSGNKITSIKNL 541

>ABL005C [587] [Homologous to ScYLR357W (RSC2) - SH; ScYGR056W
           (RSC1) - SH] (386890..389439) [2550 bp, 849 aa]
          Length = 849

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 449 NDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSENESHDEFEHINQDENDEIDETFEI 505
            D+ +N     KRK D  + ++  +  DG Q EN S+DE++  +QDE+ E+  TF +
Sbjct: 779 TDVPLNRWFKKKRKLDYEEVDE--EVGDGTQVENGSNDEYD--SQDEHTELPGTFPM 831

>KLLA0A05907g complement(548720..549763) weakly similar to sp|P46958
           Saccharomyces cerevisiae YJL146w IDS2 IME2-dependent
           signaling protein singleton, hypothetical start
          Length = 347

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 9/99 (9%)

Query: 440 VSFQLQDALNDLTINPSVDNKRKSDTAQQNDKHDAFDGIQSENES------HDEFEHINQ 493
           +S  + +A+N      +VD   +S+T  Q+   D+  G ++ + +      H   E  + 
Sbjct: 14  ISIDIANAVNKSLKETNVDPTFRSNTPIQSQSEDSIQGSETADNTSYQLWNHHYVEAPSA 73

Query: 494 DENDEIDETFE-IPYINENQNSKLRTNPTIGDLFKIKLY 531
            +N  I E  E   +I++N  +K RT  ++ D+FK++ Y
Sbjct: 74  ADNSNITEILEDWNFIDDNVRNKRRT--SMEDIFKVRHY 110

>AGL223C [4089] [Homologous to ScYCR079W - SH] (278209..279645)
           [1437 bp, 478 aa]
          Length = 478

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 231 GVIELVSDQKLIDKLLKFLNN-NLYSADIQACVCDFLKALIVISAN 275
           GV +L+SDQ+L+D +   +NN  L  A  Q C  + ++ ++ I +N
Sbjct: 389 GVSDLMSDQELVDLITSTVNNRGLKVATPQYCSDEVIRYIMAIGSN 434

>CAGL0K06369g 624706..625698 highly similar to tr|Q03290
           Saccharomyces cerevisiae YDR460w TFB3, hypothetical
           start
          Length = 330

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 590 MDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEV 641
           +D E+  D  +KD    KD+I  G+   + +  ++     FMG   ++AEEV
Sbjct: 281 IDQESYDDPFIKDLENRKDYIASGFRSDFVY--DRMLTEAFMGLGCVVAEEV 330

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,897,382
Number of extensions: 1256914
Number of successful extensions: 6192
Number of sequences better than 10.0: 122
Number of HSP's gapped: 6291
Number of HSP's successfully gapped: 127
Length of query: 765
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 656
Effective length of database: 12,822,747
Effective search space: 8411722032
Effective search space used: 8411722032
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)