Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02123g29729313990.0
Scas_687.183132848111e-108
YFR041C2952797701e-102
Sklu_2433.162992857461e-98
KLLA0A01133g2772266651e-86
Kwal_47.191983002756262e-80
AFR246C2882885879e-75
KLLA0E01628g231701221e-07
CAGL0F03729g361721124e-06
YMR161W (HLJ1)224701104e-06
YNL064C (YDJ1)409701108e-06
Scas_542.2280811062e-05
CAGL0I09526g296861053e-05
Scas_669.2224701025e-05
Scas_692.34375671045e-05
CAGL0J09966g407701001e-04
CAGL0H04499g23263982e-04
AER346W36767992e-04
YMR214W (SCJ1)37767992e-04
KLLA0C07260g36867982e-04
YGL128C (CWC23)28381982e-04
Kwal_14.245260792992e-04
AFL190C23563963e-04
KLLA0F19184g51289965e-04
Kwal_26.902437568957e-04
CAGL0H03707g34952930.001
Kwal_23.483041163930.001
KLLA0F03333g40970930.001
KLLA0D04818g35452930.001
Kwal_47.18133393154930.001
Scas_471.17936850.001
ADR124C611102920.002
ADL257C41051910.002
KLLA0E07876g49555910.002
Sklu_2422.1067878910.003
Scas_695.1432752890.003
Scas_694.2041052890.004
AAL103W66980890.004
YNL007C (SIS1)35252870.006
AAL008W34952860.007
Kwal_26.887965680870.007
Kwal_0.20735352850.009
ABL194C55267860.009
Scas_488.336752850.011
Sklu_2442.134852850.011
Sklu_2109.465885850.014
YOR254C (SEC63)66388840.015
KLLA0E04345g42866830.017
CAGL0J02750g38285830.018
AGR084C42785830.018
KLLA0C09823g66987830.025
KLLA0D06402g63190820.028
Kwal_56.2378241473810.038
Kwal_33.1345128755800.042
YJL073W (JEM1)64570800.044
CAGL0G07469g668120800.048
Scas_532.261656790.063
Sklu_2257.642980790.064
Sklu_2174.639385790.065
YJR097W172115760.069
CAGL0J01936g42582780.072
AFR507W47466780.077
ADR015W43680770.10
AFR659W27351760.11
Scas_564.1*45781770.12
Kwal_47.1795747895760.13
CAGL0J07370g62367760.14
CAGL0I06226g455115760.15
AEL112C53566750.18
YIR004W (DJP1)43283750.18
YNL077W (APJ1)52866750.22
YNL227C59067740.23
YJL162C48284740.24
Scas_709.341479740.25
CAGL0J10296g47987740.26
AER427W47066740.28
KLLA0D13464g43372730.30
CAGL0G00154g43391730.32
Scas_715.2938773730.33
KLLA0B07271g65374730.33
Scas_711.40635102730.40
Scas_651.1749175720.49
CAGL0L12276g45276710.59
CAGL0G01232g730122710.73
KLLA0C02541g27085690.75
ADL327W30592700.76
Kwal_33.1386057854700.88
YER048C (CAJ1)39188690.96
KLLA0D19602g62067681.4
CAGL0L00957g37352681.4
Scas_612.1443172681.4
Kwal_55.2096542162671.7
Kwal_14.117428459662.0
CAGL0H02827g65671672.0
YGR285C (ZUO1)43391662.4
Scas_707.1951997662.5
Kwal_23.442059267662.7
Scas_653.14669128653.2
Kwal_23.306145867644.6
KLLA0D07656g47183635.4
Kwal_26.949542877635.5
YLR090W (XDJ1)45978636.1
CAGL0J04224g52276627.2
YNL311C76366627.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02123g
         (293 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces c...   543   0.0  
Scas_687.18                                                           317   e-108
YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein...   301   e-102
Sklu_2433.16 YFR041C, Contig c2433 25259-26158                        291   1e-98
KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces c...   260   1e-86
Kwal_47.19198                                                         245   2e-80
AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [...   230   9e-75
KLLA0E01628g 155088..155783 weakly similar to sp|P48353 Saccharo...    52   1e-07
CAGL0F03729g complement(362972..364057) similar to sp|P25303 Sac...    48   4e-06
YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticul...    47   4e-06
YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein i...    47   8e-06
Scas_542.2                                                             45   2e-05
CAGL0I09526g 911127..912017 weakly similar to sp|P52868 Saccharo...    45   3e-05
Scas_669.2                                                             44   5e-05
Scas_692.34                                                            45   5e-05
CAGL0J09966g complement(976568..977791) highly similar to sp|P25...    43   1e-04
CAGL0H04499g complement(427509..428207) similar to sp|P48353 Sac...    42   2e-04
AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH] complement(...    43   2e-04
YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli ...    43   2e-04
KLLA0C07260g complement(632987..634093) similar to sp|P25303 Sac...    42   2e-04
YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein p...    42   2e-04
Kwal_14.2452                                                           43   2e-04
AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..848...    42   3e-04
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    42   5e-04
Kwal_26.9024                                                           41   7e-04
CAGL0H03707g complement(341230..342279) highly similar to sp|P25...    40   0.001
Kwal_23.4830                                                           40   0.001
KLLA0F03333g complement(313991..315220) similar to sp|P25491 Sac...    40   0.001
KLLA0D04818g complement(411615..412679) similar to sp|P25294 Sac...    40   0.001
Kwal_47.18133                                                          40   0.001
Scas_471.1                                                             37   0.001
ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH] (926131..92...    40   0.002
ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH] (249514..25...    40   0.002
KLLA0E07876g complement(709306..710793) weakly similar to sp|P53...    40   0.002
Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement      40   0.003
Scas_695.14                                                            39   0.003
Scas_694.20                                                            39   0.004
AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH] complement(1...    39   0.004
YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein r...    38   0.006
AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH] complement(3...    38   0.007
Kwal_26.8879                                                           38   0.007
Kwal_0.207                                                             37   0.009
ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [165...    38   0.009
Scas_488.3                                                             37   0.011
Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement         37   0.011
Sklu_2109.4 YOR254C, Contig c2109 4786-6762                            37   0.014
YOR254C (SEC63) [5042] chr15 complement(805031..807022) Componen...    37   0.015
KLLA0E04345g complement(400495..401781) similar to sp|P39101 Sac...    37   0.017
CAGL0J02750g complement(270406..271554) highly similar to sp|P39...    37   0.018
AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH] (885026..88...    37   0.018
KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces c...    37   0.025
KLLA0D06402g 547385..549280 weakly similar to sp|P40358 Saccharo...    36   0.028
Kwal_56.23782                                                          36   0.038
Kwal_33.13451                                                          35   0.042
YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein r...    35   0.044
CAGL0G07469g complement(708261..710267) similar to sp|P14906 Sac...    35   0.048
Scas_532.2                                                             35   0.063
Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement        35   0.064
Sklu_2174.6 YER048C, Contig c2174 7478-8659                            35   0.065
YJR097W (YJR097W) [2989] chr10 (612330..612848) Protein containi...    34   0.069
CAGL0J01936g complement(190181..191458) highly similar to sp|P40...    35   0.072
AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH] complement(...    35   0.077
ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH] complement(...    34   0.10 
AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH] complemen...    34   0.11 
Scas_564.1*                                                            34   0.12 
Kwal_47.17957                                                          34   0.13 
CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces c...    34   0.14 
CAGL0I06226g 597520..598887 some similarities with sp|P46997 Sac...    34   0.15 
AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723) [...    33   0.18 
YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for...    33   0.18 
YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by ...    33   0.22 
YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member...    33   0.23 
YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protei...    33   0.24 
Scas_709.3                                                             33   0.25 
CAGL0J10296g complement(1004500..1005939) similar to sp|P53940 S...    33   0.26 
AER427W [2927] [Homologous to ScYNL077W - SH] complement(1456998...    33   0.28 
KLLA0D13464g complement(1159251..1160552) similar to sp|P40564 S...    33   0.30 
CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomy...    33   0.32 
Scas_715.29                                                            33   0.33 
KLLA0B07271g complement(633724..635685) some similarities with s...    33   0.33 
Scas_711.40                                                            33   0.40 
Scas_651.17                                                            32   0.49 
CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces...    32   0.59 
CAGL0G01232g complement(114924..117116) similar to sp|P09620 Sac...    32   0.73 
KLLA0C02541g complement(226721..227533) weakly similar to sp|P52...    31   0.75 
ADL327W [1414] [Homologous to ScYPR061C - SH] complement(123853....    32   0.76 
Kwal_33.13860                                                          32   0.88 
YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of...    31   0.96 
KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces...    31   1.4  
CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces c...    31   1.4  
Scas_612.14                                                            31   1.4  
Kwal_55.20965                                                          30   1.7  
Kwal_14.1174                                                           30   2.0  
CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces c...    30   2.0  
YGR285C (ZUO1) [2230] chr7 complement(1061857..1063158) Zuotin (...    30   2.4  
Scas_707.19                                                            30   2.5  
Kwal_23.4420                                                           30   2.7  
Scas_653.14                                                            30   3.2  
Kwal_23.3061                                                           29   4.6  
KLLA0D07656g 658179..659594 similar to sp|P35191 Saccharomyces c...    29   5.4  
Kwal_26.9495                                                           29   5.5  
YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli ...    29   6.1  
CAGL0J04224g 393253..394821 similar to sp|P35191 Saccharomyces c...    28   7.2  
YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein ...    28   7.7  

>CAGL0C02123g 215564..216457 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c, start by similarity
          Length = 297

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/293 (91%), Positives = 268/293 (91%)

Query: 1   MVGISRQXXXXXXXXXXXYCFTAEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQIN 60
           MVGISRQ           YCFTAEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQIN
Sbjct: 1   MVGISRQLVVLVCLLAVAYCFTAEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQIN 60

Query: 61  KNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFF 120
           KNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFF
Sbjct: 61  KNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFF 120

Query: 121 FQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLF 180
           FQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLF
Sbjct: 121 FQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLF 180

Query: 181 FKQHEDDPGKELVLRFGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGK 240
           FKQHEDDPGKELVLRFGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGK
Sbjct: 181 FKQHEDDPGKELVLRFGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGK 240

Query: 241 LFXXXXXXXXXXXXXXIDVAEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVIYS 293
           LF              IDVAEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVIYS
Sbjct: 241 LFKSTTKKLHEETTEKIDVAEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVIYS 293

>Scas_687.18
          Length = 313

 Score =  317 bits (811), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/284 (56%), Positives = 191/284 (67%), Gaps = 9/284 (3%)

Query: 19  YCFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN 75
           YCFT  E+EIFQLQKE+  KYG   DFYKFLKLP    ST ++I KNLRKL+RKYHPDKN
Sbjct: 26  YCFTTSEIEIFQLQKELENKYGKEMDFYKFLKLPKSMDSTSREIIKNLRKLSRKYHPDKN 85

Query: 76  PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFV 135
            K KKLY RLNLAT+ L N   RK+YDYYLKNGFPDYDFSKGGFFF R QPKTWFI+ FV
Sbjct: 86  KKFKKLYERLNLATQFLANDDMRKSYDYYLKNGFPDYDFSKGGFFFTRVQPKTWFILSFV 145

Query: 136 LLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLR 195
            L     HY+ILK+Q +SNRRRI  F++ CK+QD T GLGEK L FKQHE+D  KEL+++
Sbjct: 146 FLFTGVIHYLILKVQASSNRRRIEGFVKQCKDQDDTQGLGEKRLSFKQHEEDEAKELIVK 205

Query: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFXXXXXXXXXXXXX 255
           FG V++IE DG  +L+S D+I EP L D++LFK       +T+G+               
Sbjct: 206 FGQVYIIESDGMYTLVSPDSITEPTLYDSILFKLPLWFWKQTLGRFITLPTRKSVEKPRP 265

Query: 256 XIDV------AEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVIYS 293
              V       E  S +D K      IKPGQ+K  L NGKVIYS
Sbjct: 266 GEQVLGTASKPEKASKNDGKRTTSTTIKPGQQKKVLENGKVIYS 309

>YFR041C (YFR041C) [1723] chr6 complement(237355..238242) Protein
           with weak similarity to dnaJ proteins Sis1p, Mdj1p, and
           Scj1p [888 bp, 295 aa]
          Length = 295

 Score =  301 bits (770), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 191/279 (68%), Gaps = 8/279 (2%)

Query: 19  YCFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN 75
           Y FT  E EIFQLQ EI+ KYG   +FYKFLKLP  ++S+ K+I KNLRKL++KYHPDKN
Sbjct: 19  YAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNLRKLSKKYHPDKN 78

Query: 76  PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFV 135
           PK++KLY RLNLAT+IL+N S+RK YDYYL+NGFP+YDF KGGF+F R +PKTWF++ F+
Sbjct: 79  PKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKPKTWFLLAFI 138

Query: 136 LLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLR 195
            +V     YII  +QY S R RI  FI  CK+QD T+GLG K L FKQHE D GK LV+R
Sbjct: 139 WIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVKQLTFKQHEKDEGKSLVVR 198

Query: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFXXXXXXXXXXXXX 255
           F DV+V+E DGSE+LIS DT+++P + + L ++   +V N T GK               
Sbjct: 199 FSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGKEEIITDSK 258

Query: 256 XIDVAED-NSNDDKKPKAEMKIKPGQKKMTLPNGKVIYS 293
             D  +    N  KK  A    K GQKKM LPNGKVIYS
Sbjct: 259 KYDGNQTKKGNKVKKGSA----KKGQKKMELPNGKVIYS 293

>Sklu_2433.16 YFR041C, Contig c2433 25259-26158
          Length = 299

 Score =  291 bits (746), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 191/285 (67%), Gaps = 23/285 (8%)

Query: 20  CFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNP 76
           CFT+EEVEIFQLQKEI  KYG   DFY+FLKLP  K S  K+I KN R+L++KYHPDKN 
Sbjct: 22  CFTSEEVEIFQLQKEINTKYGEEIDFYQFLKLPKLKDSNSKEIVKNFRRLSKKYHPDKNR 81

Query: 77  KHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFVL 136
           K+KKLY RLNL ++ILTN S RKTYDYYLKNGFPDYDF+KGGFFF+R QPKTWFI+ F+ 
Sbjct: 82  KYKKLYERLNLVSQILTNDSRRKTYDYYLKNGFPDYDFTKGGFFFKRVQPKTWFILAFIY 141

Query: 137 LVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDD-PGKELVLR 195
           +     H ++L+LQ N N+ RI  FI+  KEQD T+GLGEK L FKQ  DD  GKE+++R
Sbjct: 142 VACGLIHLVLLRLQNNGNKTRIKSFIRDVKEQDDTNGLGEKRLIFKQSADDEAGKEILVR 201

Query: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFXXXXXXXXXXXXX 255
           FGDV+ ++ DGSE+LIS + I+EP L D++L +    +   T+G+               
Sbjct: 202 FGDVYAVQADGSEALISVNDIKEPGLRDSMLVRLPTWIWKCTLGRFIVSNK--------- 252

Query: 256 XIDVAEDNSNDDKKPKA-------EMKIKPGQKKMTLPNGKVIYS 293
             D A D +  DK  +              GQ KM LPNGKV++S
Sbjct: 253 --DTASDLTTQDKDKEVTSTKKKTLKPKSKGQ-KMKLPNGKVVHS 294

>KLLA0A01133g 103746..104579 similar to sp|P43613 Saccharomyces
           cerevisiae YFR041c singleton, start by similarity
          Length = 277

 Score =  260 bits (665), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 161/226 (71%), Gaps = 3/226 (1%)

Query: 19  YCFTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN 75
           YCFT +E+EIFQLQ+E+  KYG   DFY+FLKLP  K ST  +I KN +KLA+KYHPDKN
Sbjct: 22  YCFTRDEIEIFQLQQELHTKYGSNMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKN 81

Query: 76  PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFV 135
           PK++KLY R+NL TK+L++   RKTYDYYLKNGFP YD+ KGGFFF R  P  WF   F+
Sbjct: 82  PKYRKLYERINLITKLLSDEGHRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFL 141

Query: 136 LLVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLR 195
            ++A   H ++LKL  N+N++RI  F+   +EQDTT+ LGE  L FK+ ED   K+L++R
Sbjct: 142 YVLAGVIHLVLLKLHNNANKKRIENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLLVR 201

Query: 196 FGDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKL 241
           FG+VFVI+ D S + IS D I +P + D LL K    + N+T+GK 
Sbjct: 202 FGEVFVIQPDESLAKISTDDIIDPGINDTLLVKLPKWIWNKTLGKF 247

>Kwal_47.19198
          Length = 300

 Score =  245 bits (626), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 177/275 (64%), Gaps = 6/275 (2%)

Query: 20  CFTAEEVEIFQLQKEIAKKYGD---FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNP 76
            FT EEV+IFQLQ+E+  KYGD    YK LKLP  + ST + I KN RKL++KYHPDKN 
Sbjct: 22  AFTPEEVQIFQLQQEVKNKYGDKVDLYKLLKLPKLRESTSQDIRKNFRKLSKKYHPDKNK 81

Query: 77  KHKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFVL 136
            +KK+Y  +NLATKIL++ S RKTYDYYLKNGFP YDF KGGF+F R QPKTWFI+ F+ 
Sbjct: 82  NYKKVYELINLATKILSDDSQRKTYDYYLKNGFPKYDFKKGGFYFSRVQPKTWFILAFIY 141

Query: 137 LVATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLRF 196
           +     HY++LKLQ ++N+ RI RF++  + QD T+GLGEK L F+Q  +D GKE+++R 
Sbjct: 142 VACGLIHYVLLKLQNDANKTRIERFLREVRAQDDTNGLGEKRLLFRQSIEDEGKEIIVRL 201

Query: 197 GDVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFXXXXXXXXXXXXXX 256
           GDVF ++ DGSE+ I+ + ++ P L D+ L         +T+G+L               
Sbjct: 202 GDVFAVQPDGSEAQITTEGLKNPGLADSALVSLPLWFWKKTLGRL--ASGKNDSKKSAPS 259

Query: 257 IDVAEDNSNDDKKPKAEMKIKPGQKKMTLPNGKVI 291
            D     S    K K+ M+ +     + LPNG+V+
Sbjct: 260 TDKGTKKSTTAPK-KSGMRARKEGDSLKLPNGQVV 293

>AFR246C [3438] [Homologous to ScYFR041C - SH] (883075..883941) [867
           bp, 288 aa]
          Length = 288

 Score =  230 bits (587), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 172/288 (59%), Gaps = 39/288 (13%)

Query: 21  FTAEEVEIFQLQKEIAKKYG---DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPK 77
           FTA+E EIF LQK +  KYG   + Y+FLKL   + S  ++I + +R LA+KYHPDKNPK
Sbjct: 20  FTADEAEIFNLQKVLTDKYGKDMNLYRFLKLEKLEKSDGREITRQMRALAKKYHPDKNPK 79

Query: 78  HKKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFVLL 137
           +KKLY RL+LA +ILT+   RKTYDYYL  GFP+Y   K GF FQR QPKTW ++ FVL+
Sbjct: 80  YKKLYERLHLAAQILTDGEKRKTYDYYLDYGFPEYRVDKRGFVFQRVQPKTWVVLAFVLV 139

Query: 138 VATAFHYIILKLQYNSNRRRIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLRFG 197
             +A H+ +LKLQ+ S  RR+  F++  KEQD T GLGEK L  +  + DP +E+V+RFG
Sbjct: 140 ATSAIHWTVLKLQHRSRVRRVEGFLREVKEQDDTLGLGEKRLQLQLGDSDP-QEVVVRFG 198

Query: 198 DVFVIEEDGSESLISEDTIEEPKLTDALLFKFLNAVKNRTVGKLFXXXXXXXXXXXXXXI 257
           DVFV++E+ +E+ I  + +  P L D L+F    A+    VG++                
Sbjct: 199 DVFVVQENNTETRICAEELRAPGLLDTLMF----ALPMWAVGRV---------------- 238

Query: 258 DVAEDNSNDDKKPKAEMKIKPG------------QKKMTLPNGKVIYS 293
                      +P+A ++ +P              +K  LPNGKV+YS
Sbjct: 239 ---RAPFRKQTEPEAPVRTEPAAVKKKSPKPKGKGQKWQLPNGKVLYS 283

>KLLA0E01628g 155088..155783 weakly similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 231

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 46/70 (65%), Gaps = 4/70 (5%)

Query: 35  IAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKLYARLNLATKIL 92
           ++K   +FY+ LK+  GKS++E  I K  RKLA K HPDKN  P+  + + ++N A ++L
Sbjct: 16  LSKDKHEFYEMLKV--GKSASESDIKKAYRKLAIKLHPDKNRHPRASEAFKKINRAFEVL 73

Query: 93  TNHSSRKTYD 102
           ++ S R+ +D
Sbjct: 74  SDDSKRRIFD 83

>CAGL0F03729g complement(362972..364057) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1, hypothetical
           start
          Length = 361

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 42/72 (58%), Gaps = 5/72 (6%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           D+Y  L L   K +++K+I    R+L++KYHPDKNP  ++ + +   +  A  IL +   
Sbjct: 20  DYYAILGL--SKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEK 77

Query: 98  RKTYDYYLKNGF 109
           RKTYD +  + F
Sbjct: 78  RKTYDVHGADAF 89

>YMR161W (HLJ1) [4116] chr13 (577717..578391) Endoplasmic reticulum
           membrane protein, member of the DnaJ family of putative
           protein chaperones [675 bp, 224 aa]
          Length = 224

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 35  IAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKLYARLNLATKIL 92
           ++K   +FY+ LK+   + +T+ +I K  RKLA K HPDKN  PK  + +  +N A ++L
Sbjct: 15  LSKDKHEFYEILKV--DRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVL 72

Query: 93  TNHSSRKTYD 102
           +N   R  YD
Sbjct: 73  SNEEKRSIYD 82

>YNL064C (YDJ1) [4526] chr14 complement(505866..507095) Protein
           involved in protein import into mitochondria and ER,
           homolog of E. coli DnaJ [1230 bp, 409 aa]
          Length = 409

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRK 99
           FY  L +P   ++T+ +I K  RK A KYHPDKNP  +    +   + A +IL++   R 
Sbjct: 7   FYDILGVPV--TATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRD 64

Query: 100 TYDYYLKNGF 109
            YD + ++G 
Sbjct: 65  IYDQFGEDGL 74

>Scas_542.2
          Length = 280

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 34  EIAKKYGDFYKFLKLPNGKSSTE------KQINKNLRKLARKYHPDKNPKHKKL---YAR 84
           +I K   + Y  L++P    + E        I K  R LA KYHPDK+P   ++   + +
Sbjct: 7   QIIKDGVNLYSVLEIPTEPRAKELSKILPTDIKKRYRTLALKYHPDKHPNEPEIVHKFYQ 66

Query: 85  LNLATKILTNHSSRKTYDYYL 105
           L++AT ILTN + +K YD +L
Sbjct: 67  LSVATHILTNEALKKRYDTWL 87

>CAGL0I09526g 911127..912017 weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c, hypothetical start
          Length = 296

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 45/86 (52%), Gaps = 9/86 (10%)

Query: 41  DFYKFLKL------PNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKIL 92
           D YK L+L       N  ++T   + K  RKL+ +YHPDKNP  + +  +  LNLA  +L
Sbjct: 14  DLYKLLELNYKDYKGNDDAATTHSLKKQYRKLSLRYHPDKNPGPEYIDRFHLLNLAITVL 73

Query: 93  TNHSSRKTYDYYLKNG-FPDYDFSKG 117
            + + +  YD ++    +PD   S+ 
Sbjct: 74  ADPAKKAEYDQWVAQYLYPDNGLSEA 99

>Scas_669.2
          Length = 224

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 35  IAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKLYARLNLATKIL 92
           I+K    FY+ LK+   K++ + +I K  RKLA K HPDKN  PK  + +  +N A ++L
Sbjct: 16  ISKDKHAFYEILKVE--KTANDNEIKKAYRKLAVKLHPDKNPHPKASEAFKIINRAFEVL 73

Query: 93  TNHSSRKTYD 102
           ++   R+ YD
Sbjct: 74  SDVEKRQLYD 83

>Scas_692.34
          Length = 375

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 43/67 (64%), Gaps = 5/67 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           D+Y+ L +   K +T+K+I    R+L++K+HPDKNP ++  + +   +  A ++L++   
Sbjct: 21  DYYQILGI--AKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQK 78

Query: 98  RKTYDYY 104
           R+T+D +
Sbjct: 79  RQTFDQF 85

>CAGL0J09966g complement(976568..977791) highly similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1, start by
           similarity
          Length = 407

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRK 99
            Y  L +  G S  E  I K  RK A KYHPDKNP  +    +  ++ A +IL++   R+
Sbjct: 7   LYDTLGVSPGASDAE--IKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDSQKRE 64

Query: 100 TYDYYLKNGF 109
            YD + + G 
Sbjct: 65  VYDQFGEEGL 74

>CAGL0H04499g complement(427509..428207) similar to sp|P48353
           Saccharomyces cerevisiae YMR161w HLJ1, start by
           similarity
          Length = 232

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKLYARLNLATKILTNHSSRK 99
           FY  L +   +SS++  I K  RKLA K HPDKN  PK  + +  +N A ++L++   R+
Sbjct: 22  FYDILNVE--RSSSDVDIKKAYRKLAIKLHPDKNPYPKAHEAFKLINRAFEVLSDSQKRQ 79

Query: 100 TYD 102
            YD
Sbjct: 80  IYD 82

>AER346W [2847] [Homologous to ScYMR214W (SCJ1) - SH]
           complement(1271436..1272539) [1104 bp, 367 aa]
          Length = 367

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL---YARLNLATKILTNHSS 97
           D+Y  L +   + +TEK I    R+L++KYHPDKNP        +  +  A + L++   
Sbjct: 21  DYYAILGV--DREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEK 78

Query: 98  RKTYDYY 104
           R+ YD Y
Sbjct: 79  RRIYDQY 85

>YMR214W (SCJ1) [4170] chr13 (695349..696482) Homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with Kar2p [1134 bp, 377 aa]
          Length = 377

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 40/67 (59%), Gaps = 5/67 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           D+Y  L++   K +TEK+I    R+L++KYHPDKN   ++ + +   +  A  +L++   
Sbjct: 23  DYYAILEID--KDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEK 80

Query: 98  RKTYDYY 104
           +K YD +
Sbjct: 81  KKIYDQF 87

>KLLA0C07260g complement(632987..634093) similar to sp|P25303
           Saccharomyces cerevisiae YMR214w SCJ1 homolog of E. coli
           DnaJ, functions in the endoplasmic reticulum by
           interaction with KAR2P, start by similarity
          Length = 368

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 5/67 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL---YARLNLATKILTNHSS 97
           D+Y  L +   K ++EK+I    R+L++KYHPDKNP + +    +  +  A  +L++   
Sbjct: 20  DYYAILGVD--KQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEK 77

Query: 98  RKTYDYY 104
           R+ YD +
Sbjct: 78  RQIYDRH 84

>YGL128C (CWC23) [1858] chr7 complement(269297..270148) Protein
           possibly involved in pre-mRNA splicing, has similarity
           to E. coli DnaJ and other DnaJ-like proteins [852 bp,
           283 aa]
          Length = 283

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 33  KEIAKKYGDFYKFLKLPNGKSSTE-----KQINKNLRKLARKYHPDKNPKHKKLYARLNL 87
           +++  +  + Y  L+LP             QI +  R LA KYHPDK+P +  +  + +L
Sbjct: 7   EDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRTLALKYHPDKHPDNPSIIHKFHL 66

Query: 88  ---ATKILTNHSSRKTYDYYL 105
              AT ILTN   R  YD +L
Sbjct: 67  LSTATNILTNADVRPHYDRWL 87

>Kwal_14.2452
          Length = 607

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 13/92 (14%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNP--------KHKKLYARLNLATKIL 92
           ++YK L +P  + +T K I K+   + RKYHPDK          K+++  + +N A +IL
Sbjct: 505 NYYKVLGVP--QQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEIL 562

Query: 93  TNHSSRKTYDYYLKNGFPD---YDFSKGGFFF 121
           ++   RK YD       P      F +GGF F
Sbjct: 563 SDEGKRKEYDDQRSGRAPQGQGSPFGQGGFPF 594

>AFL190C [3005] [Homologous to ScYMR161W (HLJ1) - SH] (84145..84852)
           [708 bp, 235 aa]
          Length = 235

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 39/63 (61%), Gaps = 4/63 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKLYARLNLATKILTNHSSRK 99
           FY+ L++   + +++  I K  RK+A K HPDKN  P+  + + ++N A ++L++   R+
Sbjct: 25  FYELLQVD--EKASDGDIKKAYRKMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKRR 82

Query: 100 TYD 102
            YD
Sbjct: 83  VYD 85

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 44/89 (49%), Gaps = 15/89 (16%)

Query: 52  KSSTEKQINKNLRKLARKYHPDK------NPKHKKLYARLNLATKILTNHSSRKTYDYYL 105
           K +TE +I K  RKLA KYHPDK          + ++  +  A +IL++   +  YD Y 
Sbjct: 81  KDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140

Query: 106 K-------NGFP--DYDFSKGGFFFQRAQ 125
                   NGFP  D++F     FFQ+ Q
Sbjct: 141 DSAFGSGGNGFPEDDHEFDDFMNFFQQYQ 169

>Kwal_26.9024
          Length = 375

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 40/68 (58%), Gaps = 7/68 (10%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNP----KHKKLYARLNLATKILTNHS 96
           D+Y  L +   K +++K+I    R+L++K+HPDKNP     H K +  +  A ++L++  
Sbjct: 25  DYYGILGVS--KDASDKEIKSAYRQLSKKFHPDKNPGDEDAHHK-FIEVGEAYEVLSDDQ 81

Query: 97  SRKTYDYY 104
            R+ YD +
Sbjct: 82  KRQIYDQH 89

>CAGL0H03707g complement(341230..342279) highly similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 349

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+ E++I K  RK A KYHPDK     + +  ++ A +IL++   R+ YD Y
Sbjct: 16  SANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQKREVYDQY 67

>Kwal_23.4830
          Length = 411

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRK 99
           FY  L +     + + QI K  RK A K+HPDKNP  +    +  L +A +IL++   R 
Sbjct: 7   FYDLLGV--SPDANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDSQKRD 64

Query: 100 TYD 102
            YD
Sbjct: 65  IYD 67

>KLLA0F03333g complement(313991..315220) similar to sp|P25491
           Saccharomyces cerevisiae YNL064c YDJ1 mitochondrial and
           ER import protein, start by similarity
          Length = 409

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRK 99
            Y  L +  G  + + QI K  RK A K+HPDKNP  +    +  +  A +IL++   R+
Sbjct: 7   LYDLLGVSPG--ADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDSQKRE 64

Query: 100 TYDYYLKNGF 109
            YD +   G 
Sbjct: 65  VYDQFGLEGL 74

>KLLA0D04818g complement(411615..412679) similar to sp|P25294
           Saccharomyces cerevisiae YNL007c SIS1 heat shock
           protein, start by similarity
          Length = 354

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+ E +I K  RK A KYHPDK     + +  ++ A +IL++   R+ YD Y
Sbjct: 16  SAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQKREVYDTY 67

>Kwal_47.18133
          Length = 393

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 60/154 (38%), Gaps = 18/154 (11%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           ++Y  L L    S+T+  I K  RK A   HPDK+P   +  A+   +  A ++L++   
Sbjct: 6   EYYDLLGLQPDASATD--IKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSDPDL 63

Query: 98  RKTYDYYLK-NGFPDYDFSKGGFFFQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRR 156
           R  YD + K N  P   F     FF              +    AF   I    +  N  
Sbjct: 64  RSRYDEFGKENAVPQQGFEDAAEFFT------------TIFGGDAFQGWIGDFAFLKNLT 111

Query: 157 RIARFIQSCKEQDTTDGLGEKSLFFKQHEDDPGK 190
           + A  +   KE+ T +     +    QH+   GK
Sbjct: 112 KGAEIMGEDKEETTAEAANASTSEVVQHDGTSGK 145

>Scas_471.1
          Length = 79

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%), Gaps = 2/36 (5%)

Query: 41 DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNP 76
          D+Y+ L +   K +T+K+I    R+L++K+HPDKNP
Sbjct: 36 DYYQILGI--AKDATDKEIKSAYRQLSKKFHPDKNP 69

>ADR124C [1865] [Homologous to ScYJL073W (JEM1) - SH]
           (926131..927966) [1836 bp, 611 aa]
          Length = 611

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 10/102 (9%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--------PKHKKLYARLNLATKIL 92
           ++YK L +  G  +  K I +    L +KYHPDK          K ++  + +N A ++L
Sbjct: 509 NYYKILGI--GNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVL 566

Query: 93  TNHSSRKTYDYYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGF 134
           ++ S RK YD     G   +    G  F++ + P   F  GF
Sbjct: 567 SDESKRKEYDMLRSGGGSQHAGGNGQQFYRNSGPMFNFKKGF 608

>ADL257C [1484] [Homologous to ScYNL064C (YDJ1) - SH]
           (249514..250746) [1233 bp, 410 aa]
          Length = 410

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 54  STEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRKTYD 102
           + + QI K  RK A KYHPDKNP  +    + ++  A +IL++   R+ YD
Sbjct: 17  ANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDSQKREMYD 67

>KLLA0E07876g complement(709306..710793) weakly similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 495

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 53  SSTEKQINKNLRKLARKYHPDKN---PKHKKLYARLNLATKILTNHSSRKTYDYY 104
           ++TE++I K  RK A K+HPDKN    +  KL+  ++ A + L+N + R+ YD Y
Sbjct: 16  TATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSNSNKRELYDQY 70

>Sklu_2422.10 YNL227C, Contig c2422 20011-22047 reverse complement
          Length = 678

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 7/78 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH----KKLYARLNLATKILTNHSS 97
           +Y+ L + +  S  E  + K  RK A KYHPDKNP +     + +A + LA ++L++   
Sbjct: 5   YYELLGVESIASDLE--LKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 98  RKTYDYYLKNGFPDYDFS 115
           R  YD + KN   D D++
Sbjct: 63  RAWYDSH-KNQILDDDYN 79

>Scas_695.14
          Length = 327

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           ++ E+++ K  RK A KYHPDK     + +  ++ A +IL + ++R+ YD Y
Sbjct: 16  TANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNTREVYDQY 67

>Scas_694.20
          Length = 410

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKL--YARLNLATKILTNHSSRKTYD 102
           ++ + +I K  RK A KYHPDKNP  +    +  ++ A +IL++   R+ YD
Sbjct: 16  TAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDSEKREIYD 67

>AAL103W [84] [Homologous to ScYOR254C (SEC63) - SH]
           complement(161385..163394) [2010 bp, 669 aa]
          Length = 669

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 14/80 (17%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH---------KKLYARLNLATKI 91
           D Y+ L++  G  +T+++I    RKL+ K+HPDK  K          ++ Y  +  A K 
Sbjct: 115 DPYELLQV--GSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKA 172

Query: 92  LTNHSSRKTYDYYLKNGFPD 111
           LT+ ++R   D +L+ G PD
Sbjct: 173 LTDDATR---DNFLRYGHPD 189

>YNL007C (SIS1) [4578] chr14 complement(618506..619564) Protein
           required for initiation of translation, member of DnaJ
           family of protein chaperones [1059 bp, 352 aa]
          Length = 352

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+ E+++ K  RK A KYHPDK     + +  ++ A +IL +   R+ YD Y
Sbjct: 16  SANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>AAL008W [179] [Homologous to ScYNL007C (SIS1) - SH]
           complement(327127..328176) [1050 bp, 349 aa]
          Length = 349

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+++ ++ K  RK A KYHPDK     + +  ++ A +IL++ + R+ YD Y
Sbjct: 16  SASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNKREVYDTY 67

>Kwal_26.8879
          Length = 656

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 40/80 (50%), Gaps = 14/80 (17%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH---------KKLYARLNLATKI 91
           D Y  L +    SST+++I    RKL+ K+HPDK  K          ++ Y  +  A K 
Sbjct: 117 DPYALLDV--SASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKA 174

Query: 92  LTNHSSRKTYDYYLKNGFPD 111
           LT+  +R+    YLK G PD
Sbjct: 175 LTDEVTREN---YLKYGHPD 191

>Kwal_0.207
          Length = 353

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+ E ++ K  RK A KYHPDK     + +  ++ A +IL +   R+ YD Y
Sbjct: 16  SAQETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQKREVYDTY 67

>ABL194C [398] [Homologous to ScYNL227C - SH] (42210..43868) [1659
           bp, 552 aa]
          Length = 552

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 6/67 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN----PKHKKLYARLNLATKILTNHSS 97
           +Y+ L + +G S T+  + K  R+ A +YHPDKN     +  +++A +  A ++L++   
Sbjct: 5   YYELLGVDSGASDTD--LKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQE 62

Query: 98  RKTYDYY 104
           R  YD +
Sbjct: 63  RAWYDAH 69

>Scas_488.3
          Length = 367

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           ++ E+++ K  RK A KYHPDK     + +  ++ A +IL +   R+ YD Y
Sbjct: 16  TANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDQY 67

>Sklu_2442.1 YNL007C, Contig c2442 2508-3554 reverse complement
          Length = 348

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYDYY 104
           S+ E ++ K  RK A KYHPDK     + +  ++ A +IL +   R+ YD Y
Sbjct: 16  SADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQKREIYDSY 67

>Sklu_2109.4 YOR254C, Contig c2109 4786-6762
          Length = 658

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 33  KEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPK------HKKLYARLN 86
           KE A    D Y  L +    S+T+K++    RKL+ K+HPDK  K        +L  +  
Sbjct: 108 KEAASGLFDPYTLLGV--ATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYV 165

Query: 87  LATKILTNHSSRKTYDYYLKNGFPD 111
           L TK     +   T + YLK G PD
Sbjct: 166 LITKAYKALTDEITKENYLKFGHPD 190

>YOR254C (SEC63) [5042] chr15 complement(805031..807022) Component
           of ER protein-translocation subcomplex, which includes
           Sec62p, Sec63p, Sec66p, and Sec72p, member of DnaJ
           protein family [1992 bp, 663 aa]
          Length = 663

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 14/88 (15%)

Query: 33  KEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDK-----NPKHKKL----YA 83
           K+ A K  D Y+ L +    S++++ I    RKL+ K+HPDK      P  K +    Y 
Sbjct: 117 KDAATKLFDPYEILGI--STSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYV 174

Query: 84  RLNLATKILTNHSSRKTYDYYLKNGFPD 111
           ++  A + LT+   R+    YLK G PD
Sbjct: 175 QITKAYESLTDELVRQN---YLKYGHPD 199

>KLLA0E04345g complement(400495..401781) similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1 dnaJ homolog,
           start by similarity
          Length = 428

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN---PKHKKLYARLNLATKILTNHSSR 98
           +Y  L++    S  E  I K+ RKLA K HPDKN   P+ +  +  L  A ++L +   R
Sbjct: 7   YYDILQVSVDASPQE--IKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLIDDDLR 64

Query: 99  KTYDYY 104
           K YD +
Sbjct: 65  KKYDQF 70

>CAGL0J02750g complement(270406..271554) highly similar to sp|P39101
           Saccharomyces cerevisiae YER048c CAJ1, start by
           similarity
          Length = 382

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 6/85 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNL---ATKILTNHSS 97
           +FY  L +     +T  +I K  RK+A   HPDK+P   +  A+      A ++L + + 
Sbjct: 6   EFYDVLGI--SPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLNDPAL 63

Query: 98  RKTYDYYLK-NGFPDYDFSKGGFFF 121
           RK YD + K N  P   F     +F
Sbjct: 64  RKQYDEFGKDNAVPQQGFEDAEEYF 88

>AGR084C [4394] [Homologous to ScYLR090W (XDJ1) - SH]
           (885026..886309) [1284 bp, 427 aa]
          Length = 427

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 10/85 (11%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYA------RLNLATKILTN 94
           D Y+ L + +  S++E+++ +  R+LA +YHPDK     +  A       ++ A  +L++
Sbjct: 4   DLYEVLGIAS--SASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSD 61

Query: 95  HSSRKTYDYY--LKNGFPDYDFSKG 117
              R  YD +  +  G+   +F  G
Sbjct: 62  EQKRAEYDQFGTVDGGYGHDEFGHG 86

>KLLA0C09823g 848641..850650 similar to sp|P14906 Saccharomyces
           cerevisiae YOR254c SEC63 ER protein-translocation
           complex subunit singleton, start by similarity
          Length = 669

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 14/87 (16%)

Query: 34  EIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH---------KKLYAR 84
           +IA    D Y+ L +    SST+K+I    RKL+ K+HPDK  K          ++ +  
Sbjct: 104 QIAAAAFDPYELLGV--TLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVM 161

Query: 85  LNLATKILTNHSSRKTYDYYLKNGFPD 111
           +N A K LT+  +++ Y  Y   G PD
Sbjct: 162 INKAYKALTDEITKENYRKY---GHPD 185

>KLLA0D06402g 547385..549280 weakly similar to sp|P40358
           Saccharomyces cerevisiae YJL073w JEM1 singleton,
           hypothetical start
          Length = 631

 Score = 36.2 bits (82), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 46/90 (51%), Gaps = 14/90 (15%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--------PKHKKLYARLNLATKIL 92
           D+YK L +   KS+T K + ++  +L +K+HPDK          K+++  A +N A +IL
Sbjct: 528 DYYKILGV--DKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEIL 585

Query: 93  TNHSSRKTYDYYLKNGFPDYDFSKGGFFFQ 122
           ++   R  YD    N   +   S+G   F+
Sbjct: 586 SDDDKRTKYD----NARANSRNSRGAHGFE 611

>Kwal_56.23782
          Length = 414

 Score = 35.8 bits (81), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 54  STEKQINKNLRKLARKYHPDK------NPKHKKLYARLNLATKILTNHSSRKTYDYYL-K 106
           +T+ +I K  R+LA ++HPDK        + +  +  +  A ++L+N   R+ YD Y   
Sbjct: 13  ATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKRRNYDTYGDT 72

Query: 107 NGFPDYDFSKGGF 119
           NG+ D   S GGF
Sbjct: 73  NGYSD---SYGGF 82

>Kwal_33.13451
          Length = 287

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 58  QINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSRKTYDYYLKNGF 109
           Q  ++ R+ A K+HPDKNP +    +R   LN+A  IL +   R+ Y+ +    F
Sbjct: 59  QFRRSFRQQALKFHPDKNPDNAAAVSRFHDLNVALNILCDPVQREKYNSWFIQTF 113

>YJL073W (JEM1) [2839] chr10 (303097..305034) DnaJ-like protein
           required for the nuclear fusion step of karyogamy [1938
           bp, 645 aa]
          Length = 645

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 10/70 (14%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDK-----NPKHKKLY---ARLNLATKIL 92
           D+YK L +    S++ K+I K    L +KYHPDK     N K + ++   +++N A + L
Sbjct: 538 DYYKILGV--SPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETL 595

Query: 93  TNHSSRKTYD 102
           ++   RK YD
Sbjct: 596 SDDDKRKEYD 605

>CAGL0G07469g complement(708261..710267) similar to sp|P14906
           Saccharomyces cerevisiae YOR254c SEC63, start by
           similarity
          Length = 668

 Score = 35.4 bits (80), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 19/120 (15%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH---------KKLYARLNLATKI 91
           D Y  L +    S+++K I    R+L+ K+HPDK  K          +++Y +++ A + 
Sbjct: 125 DPYDLLGI--SPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEA 182

Query: 92  LTNHSSRKTYDYYLKNGFPDYDFSKG-----GFFFQRAQPKTWFIIGFVLLVATAFHYII 146
           LT+   R+    YLK G PD   S         F          +I +V L+     Y++
Sbjct: 183 LTDPIVREN---YLKYGHPDGPQSTTHGIAIPSFMVSGSASPLLVIFYVSLLGVVLPYLV 239

>Scas_532.2
          Length = 616

 Score = 35.0 bits (79), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKH----KKLYARLNLATKILTNHSSRKTYDYY 104
           ++T+ ++ K  RK A ++HPDKNP +     +++A +  A ++L++   R  YD +
Sbjct: 14  TATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQERAWYDAH 69

>Sklu_2257.6 YIR004W, Contig c2257 8880-10169 reverse complement
          Length = 429

 Score = 35.0 bits (79), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 13/80 (16%)

Query: 42  FYKFLKL-PNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           +Y  L + PN +     +I K  RK + + HPDKNP       R   ++ A ++L+N   
Sbjct: 7   YYDLLGVSPNARPI---EIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSNEEL 63

Query: 98  RKTYDYYLK------NGFPD 111
           R  YD + K      NGF D
Sbjct: 64  RTKYDKFGKEEAVPQNGFED 83

>Sklu_2174.6 YER048C, Contig c2174 7478-8659
          Length = 393

 Score = 35.0 bits (79), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 39/85 (45%), Gaps = 6/85 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           ++Y  L +    + TE  I K  RK A   HPDK+P      A+   +  A ++L++   
Sbjct: 6   EYYDALGISPDATPTE--IKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSDPGL 63

Query: 98  RKTYDYYLK-NGFPDYDFSKGGFFF 121
           R  YD + K +  P   F   G FF
Sbjct: 64  RSRYDEFGKDDAVPQQGFEDAGEFF 88

>YJR097W (YJR097W) [2989] chr10 (612330..612848) Protein containing
           a DnaJ domain, which are part of a chaperone (protein
           folding) system that mediates interaction with heat
           shock proteins, has moderate similarity to
           uncharacterized C. albicans Orf6.2114p [519 bp, 172 aa]
          Length = 172

 Score = 33.9 bits (76), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 49/115 (42%), Gaps = 25/115 (21%)

Query: 43  YKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPK--HKKL----YARLNLATKILTNHS 96
           Y+ L++P+   +T+ +I K  R      HPDK  K  H  +      ++  A KIL+N  
Sbjct: 10  YEILRIPS--DATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIK 67

Query: 97  SRKTYDY-----YLKNGF------------PDYDFSKGGFFFQRAQPKTWFIIGF 134
           +R+ YD      Y + GF             D+ F +    F    P+  F+ GF
Sbjct: 68  TRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVGGF 122

>CAGL0J01936g complement(190181..191458) highly similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1, start by
           similarity
          Length = 425

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 11/82 (13%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSR 98
           +Y  L +  G ++T  +I K  RK + + HPDKNP       R   ++ A ++L++   R
Sbjct: 7   YYDLLGI--GPTATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSSEELR 64

Query: 99  KTYDYYLKN-GFPDYDFSKGGF 119
             YD + K    P     KGGF
Sbjct: 65  AKYDKFGKQEAIP-----KGGF 81

>AFR507W [3699] [Homologous to ScYFL016C (MDJ1) - SH]
           complement(1347615..1349039) [1425 bp, 474 aa]
          Length = 474

 Score = 34.7 bits (78), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 4/66 (6%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPD--KNPKHKKLYARLNLATKILTNHSSR 98
           D Y+ L +   K ++  QI K   KLA+++HPD  K+   +K +  L  A +IL++ + R
Sbjct: 41  DPYETLGV--AKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKR 98

Query: 99  KTYDYY 104
           + YD +
Sbjct: 99  RQYDQF 104

>ADR015W [1756] [Homologous to ScYIR004W (DJP1) - SH]
           complement(732201..733511) [1311 bp, 436 aa]
          Length = 436

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 40/80 (50%), Gaps = 13/80 (16%)

Query: 42  FYKFLKL-PNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           +Y  L + P+ K+    +I K  RK + + HPDKNP   K   R   ++ A ++L++   
Sbjct: 7   YYDLLGVSPDAKAI---EIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSSDEL 63

Query: 98  RKTYDYYLK------NGFPD 111
           R  YD + K      NGF D
Sbjct: 64  RAKYDKFGKEEAVPQNGFED 83

>AFR659W [3852] [Homologous to ScYGL128C (CWC23) - NSH]
           complement(1640183..1641004) [822 bp, 273 aa]
          Length = 273

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 58  QINKNLRKLARKYHPDK---NPKHKKLYARLNLATKILTNHSSRKTYDYYL 105
           Q+    R+LA +YHPDK   + +    +  +  A  IL+N S R TY+ +L
Sbjct: 37  QLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILSNSSLRATYNRWL 87

>Scas_564.1*
          Length = 457

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 32  QKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDK----NPKHKKL----YA 83
           +K+   K  D Y  L +    ++T+  I K  RKLA ++HPDK    N   ++     + 
Sbjct: 334 EKQQRPKMTDLYAVLGV--ASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFK 391

Query: 84  RLNLATKILTNHSSRKTYDYY 104
            ++ A +IL++   R  YD Y
Sbjct: 392 EISAAYEILSDEDKRAHYDLY 412

>Kwal_47.17957
          Length = 478

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 21  FTAEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKH 78
            TA  V +F +  ++  +  D Y  L + N  S+T  +I K   KLA+KYHPD N     
Sbjct: 19  LTAPHVRLFHVSSKLLDELKDPYSTLGVSN--SATSSEIKKAYYKLAKKYHPDINKAADA 76

Query: 79  KKLYARLNLATKILTNHSSRKTYDYYLKNGFPDYD 113
           +K +  L  A +IL++   R+ +D Y    F   D
Sbjct: 77  QKKFHDLQNAYEILSDDCKRQQWDQYGPAAFSQGD 111

>CAGL0J07370g 711363..713234 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 623

 Score = 33.9 bits (76), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH----KKLYARLNLATKILTNHSS 97
           +Y  L++ +  S  +  + K  R+ A +YHPDKNP +      ++A +  A ++L++   
Sbjct: 5   YYDLLEVRSDASDLD--LKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 98  RKTYDYY 104
           R  YD +
Sbjct: 63  RAWYDSH 69

>CAGL0I06226g 597520..598887 some similarities with sp|P46997
           Saccharomyces cerevisiae YJL162c, hypothetical start
          Length = 455

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 49/115 (42%), Gaps = 15/115 (13%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHK--KLYARLNLATKILTNHSSRK 99
           +Y  L +P   S+ E  I K+  KLA+K HPDK       +L+  +  A  IL N   R 
Sbjct: 13  YYSILGVPTNASTNE--IRKSYMKLAKKLHPDKTKSEHTAELFKLVVDAHSILNNDQLRA 70

Query: 100 TYDYYL---------KNGF--PDYDFSKGGFFFQRAQPKTWFIIGFVLLVATAFH 143
            YD  L         ++G    + D  KG  F + ++P      GF + V    H
Sbjct: 71  EYDKKLILEGRFELHQHGAKQKNKDIRKGYTFKRNSKPYEQQPYGFGVQVPKGPH 125

>AEL112C [2394] [Homologous to ScYJL162C - SH] (412116..413723)
           [1608 bp, 535 aa]
          Length = 535

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHK--KLYARLNLATKILTNHSSRK 99
           +Y  L LP G S  E  I K   +LAR+ HPDK+   +  +L+  +  A  +LT+   R 
Sbjct: 13  YYSLLGLPFGAS--ELHIRKAYMRLARELHPDKSKSKEAAELFKVVAHAHSVLTDKEKRL 70

Query: 100 TYDYYL 105
            YD  L
Sbjct: 71  KYDRQL 76

>YIR004W (DJP1) [2669] chr9 (363218..364516) Protein required for
           peroxisomal biogenesis, has similarity to E. coli DnaJ
           and other DnaJ-like proteins [1299 bp, 432 aa]
          Length = 432

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 11/83 (13%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSS 97
           ++Y  L +    SS E  I K  RK + + HPDKNP       R   ++ A ++L +   
Sbjct: 6   EYYDLLGVSTTASSIE--IKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDL 63

Query: 98  RKTYDYY-LKNGFPDYDFSKGGF 119
           R  YD Y  K   P     +GGF
Sbjct: 64  RAKYDKYGRKEAIP-----QGGF 81

>YNL077W (APJ1) [4513] chr14 (481390..482976) Protein induced by
           cell stress, member of the DnaJ family of predicted
           protein chaperones [1587 bp, 528 aa]
          Length = 528

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN---PKHKKLYARLNLATKILTNHSSR 98
            Y  L +    S++E  I K  R  A KYHPDKN    + K+ +  +  A +IL ++  R
Sbjct: 7   LYDSLNVTAAASTSE--IKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLR 64

Query: 99  KTYDYY 104
             YD Y
Sbjct: 65  ALYDQY 70

>YNL227C (YNL227C) [4378] chr14 complement(220658..222430) Member of
           the DnaJ family of protein chaperones, contains two
           C2H2-type zinc finger domains [1773 bp, 590 aa]
          Length = 590

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 6/67 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH----KKLYARLNLATKILTNHSS 97
           +Y+ L +    S  E  + K  RK A +YHPDKNP +     + +A +  A ++L++   
Sbjct: 5   YYELLGVETHASDLE--LKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 98  RKTYDYY 104
           R  YD +
Sbjct: 63  RAWYDSH 69

>YJL162C (YJL162C) [2759] chr10 complement(114176..115624) Protein
           that contains a DnaJ chaperonin domain [1449 bp, 482 aa]
          Length = 482

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPD--KNPKHKKLYARLNLATKILTNHSSRK 99
           +Y  L L +  +S+E  ++K+  KLAR  HPD  K+ K ++L+  +  A  ILT+   + 
Sbjct: 14  YYSILGLTSNATSSE--VHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKL 71

Query: 100 TYDYYLK-NGFPDYDFSKGGFFFQ 122
            YD  LK  G   Y   K    F+
Sbjct: 72  RYDRDLKIKGLHTYQPKKNCHIFK 95

>Scas_709.3
          Length = 414

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 11/79 (13%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSR 98
           +Y+ L +    S+T  +I K  RK + + HPDKNP       R   ++ A ++L++ + R
Sbjct: 7   YYELLGI--SPSATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSDDTLR 64

Query: 99  KTYDYYLK------NGFPD 111
             YD Y K       GF D
Sbjct: 65  LKYDKYGKKEAVPTGGFED 83

>CAGL0J10296g complement(1004500..1005939) similar to sp|P53940
           Saccharomyces cerevisiae YNL077w, start by similarity
          Length = 479

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 13/87 (14%)

Query: 54  STEKQINKNLRKLARKYHPDKN---PKHKKLYARLNLATKILTNHSSRKTYDYYLKNGFP 110
           +++  I K     A + HPDKN    + KK +  ++ A ++L++  SR+ YD Y   G  
Sbjct: 17  ASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSDPKSREMYDRY---GTT 73

Query: 111 DYD-------FSKGGFFFQRAQPKTWF 130
           D         F +G  F+    P   F
Sbjct: 74  DESAIASQEPFGEGMSFYSGGNPMHMF 100

>AER427W [2927] [Homologous to ScYNL077W - SH]
           complement(1456998..1458410) [1413 bp, 470 aa]
          Length = 470

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN---PKHKKLYARLNLATKILTNHSSR 98
            Y  L +  G S+ E  + K+ +  A +YHPDKN      K+ + ++  A ++L +   R
Sbjct: 7   LYDVLGVQPGVSAAE--LKKSYKLAALRYHPDKNGHSEASKQRFQQIADAYRVLGDERLR 64

Query: 99  KTYDYY 104
           K YD Y
Sbjct: 65  KIYDRY 70

>KLLA0D13464g complement(1159251..1160552) similar to sp|P40564
           Saccharomyces cerevisiae YIR004w DJP1 DnaJ-like protein
           involved specifically in peroxisomal protein import,
           start by similarity
          Length = 433

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 36/72 (50%), Gaps = 11/72 (15%)

Query: 51  GKSSTEKQIN--KNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSRKTYDYY- 104
           G ++  KQI+  K  RK + K HPDKNP       R   ++ A ++L++   R  YD + 
Sbjct: 12  GVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTATERFQAISEAYQVLSSEELRMKYDKFG 71

Query: 105 -----LKNGFPD 111
                 KNGF D
Sbjct: 72  KEEAMPKNGFED 83

>CAGL0G00154g 14591..15892 highly similar to sp|P32527 Saccharomyces
           cerevisiae YGR285c ZUO1, start by similarity
          Length = 433

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 40/91 (43%), Gaps = 14/91 (15%)

Query: 38  KYGDFYKFLKLPNGK-SSTEKQINKNLRKLARKYHPDKNPKHKK------LYARLNLATK 90
           K  D Y  + L   +  +TE QI K+ RK   KYHPDK   H         +  +  + +
Sbjct: 94  KTADLYAAMGLSKLRFRATENQIIKSHRKQVVKYHPDKQSAHGAGLDQDGFFKIIQKSFE 153

Query: 91  ILTNHSSRKTYDYYLKNG--FP-----DYDF 114
            LT+ + R+ YD    N    P     DYDF
Sbjct: 154 TLTDVTKRRQYDSCDFNADVLPPKKGTDYDF 184

>Scas_715.29
          Length = 387

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 53  SSTEKQINKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSRKTYDYYLKN-G 108
           ++T  +I K  R+ A + HPDK+P   +  A+   +  A ++L++   R  YD + K+  
Sbjct: 16  TATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSDPGLRSRYDEFGKDEA 75

Query: 109 FPDYDFSKGGFFF 121
            P   F     +F
Sbjct: 76  VPQQGFEDANEYF 88

>KLLA0B07271g complement(633724..635685) some similarities with
           sp|P46997 Saccharomyces cerevisiae YJL162c singleton,
           hypothetical start
          Length = 653

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHK--KLYARLNLATKILTNHSSRK 99
            Y  L L  G  +TE QI K   KLAR+ HPDK+   +  +L+ ++  A  ILT+   + 
Sbjct: 15  LYSVLNLKYG--ATEVQIRKAYMKLARELHPDKSKSEEAGELFKKVAHAHFILTDKKEKM 72

Query: 100 TYDY-YLKNGFPDY 112
            YD   L  G  DY
Sbjct: 73  KYDSKLLAKGLYDY 86

>Scas_711.40
          Length = 635

 Score = 32.7 bits (73), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 20/102 (19%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPK-----HKKL---YARLNLATKIL 92
           D+YK L +   K +  K I K+   L +K+HPDK  +      KK+    + +N A ++L
Sbjct: 527 DYYKILDV--SKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVL 584

Query: 93  TNHSSRKTYDY--------YLKNGFPDYDFSKGGFFFQRAQP 126
           ++ + R  YD             G  ++DF  G  F Q+  P
Sbjct: 585 SDETKRNEYDLNRSGNHNGMANGGAQNFDF--GRMFQQQGFP 624

>Scas_651.17
          Length = 491

 Score = 32.3 bits (72), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHK--KLYARLNLATKILTNHSSRK 99
           +Y  L L     +T+ +I K+  KLAR+ HPDK+      +L+  +  A  ILT+  +++
Sbjct: 8   YYSILGLT--PKATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEETKR 65

Query: 100 TYDYYL-KNGFPDYD 113
            YD  L   G   YD
Sbjct: 66  KYDTQLVMRGLGAYD 80

>CAGL0L12276g 1327171..1328529 similar to tr|Q12014 Saccharomyces
           cerevisiae YLR090w, hypothetical start
          Length = 452

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 13/76 (17%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL-----------YARLNLAT 89
           D+Y  L +  G+ +++ +I +  RKLA ++HPDK   ++             +  +  A 
Sbjct: 2   DYYGLLGV--GQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAY 59

Query: 90  KILTNHSSRKTYDYYL 105
           ++L++ S R  YD  L
Sbjct: 60  QVLSDASLRAEYDQKL 75

>CAGL0G01232g complement(114924..117116) similar to sp|P09620
           Saccharomyces cerevisiae YGL203c KEX1 carboxypeptidase,
           hypothetical start
          Length = 730

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 48/122 (39%), Gaps = 24/122 (19%)

Query: 107 NGFPDYDFSKGGFFFQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRRRIARFIQSCK 166
           NG  D D   GG ++Q    +      F L+++    +II+   Y      I+ +I+S +
Sbjct: 574 NGGLDNDLETGGEYYQDEDEEGSNFKAFFLILSLVSAFIIVAAFY------ISDYIKSRR 627

Query: 167 EQDTTDGLGEKSL-------------FFKQHEDDP-----GKELVLRFGDVFVIEEDGSE 208
                DG G   L              F   +DDP     G E  +   DVF I+E+  E
Sbjct: 628 HPILVDGDGRSRLNKSVTWASDIENGSFDIEDDDPEFGTEGMEDNMELEDVFSIDEEDEE 687

Query: 209 SL 210
            L
Sbjct: 688 QL 689

>KLLA0C02541g complement(226721..227533) weakly similar to sp|P52868
           Saccharomyces cerevisiae YGL128c singleton, start by
           similarity
          Length = 270

 Score = 31.2 bits (69), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 12/85 (14%)

Query: 35  IAKKYGDFYKFLKL-----PNGKSSTEKQINKNLRKLARKYHPDKNPKH-----KKLYAR 84
           +   + D Y+ L +      +  S T   INK  RKL+   HPDK+ +      +  +  
Sbjct: 6   VKDNHVDLYRILHIHVNDNEHLNSVTPTLINKQFRKLSLTLHPDKSNESDLNITRDRWDN 65

Query: 85  LNLATKILTNHSSRKTYDYYLKNGF 109
           L  A +IL+ H  +K YD + +  F
Sbjct: 66  LQSAYRILSEH--KKEYDIWYQRTF 88

>ADL327W [1414] [Homologous to ScYPR061C - SH]
           complement(123853..124770) [918 bp, 305 aa]
          Length = 305

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 38/92 (41%), Gaps = 22/92 (23%)

Query: 35  IAKKYGDFYKFLKLPNGKSST-------------EKQINKNLRKLARKYHPDKN------ 75
            A     +   L  P GK  T              +Q+ K   +LA+ YHPD        
Sbjct: 71  CASTVAGWQGGLSWPQGKQPTPYEVLGLVKTGVDARQLKKRYHELAKLYHPDTAGAAQQG 130

Query: 76  -PKHKKL--YARLNLATKILTNHSSRKTYDYY 104
             +H++L  +  +N A  +L++ S R+ YD Y
Sbjct: 131 LGEHERLRRFKLVNEAYALLSDASRRRMYDMY 162

>Kwal_33.13860
          Length = 578

 Score = 31.6 bits (70), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 54  STEKQINKNLRKLARKYHPDKNP--KHKKLYARLNLATKILTNHSSRKTYDYYL 105
           +TE QI K  RK+A   HPDKN      +L+  ++ A  +L +   R++Y+  L
Sbjct: 23  ATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKEQRQSYNRKL 76

>YER048C (CAJ1) [1475] chr5 complement(246981..248156) Homolog of E.
           coli DnaJ, has a leucine zipper [1176 bp, 391 aa]
          Length = 391

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 38  KYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNL---ATKILTN 94
           K  ++Y  L +    + TE  I K  R+ A + HPDK+P      A+      A ++L++
Sbjct: 3   KETEYYDILGIKPEATPTE--IKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 95  HSSRKTYDYYLK-NGFPDYDFSKGGFFF 121
              R  YD + K +  P   F     +F
Sbjct: 61  PGLRSKYDQFGKEDAVPQQGFEDASEYF 88

>KLLA0D19602g 1653096..1654958 similar to sp|P53863 Saccharomyces
           cerevisiae YNL227c, start by similarity
          Length = 620

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH----KKLYARLNLATKILTNHSS 97
           +Y  L + +  + T+  + +  RK A  YHPDKN  +     +++A++  A ++L++   
Sbjct: 5   YYDLLDVKSDATDTD--LKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 98  RKTYDYY 104
           R  YD +
Sbjct: 63  RAWYDAH 69

>CAGL0L00957g 110615..111736 similar to sp|P39101 Saccharomyces
           cerevisiae YER048c CAJ1, start by similarity
          Length = 373

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 54  STEKQINKNLRKLARKYHPDKNPKHKKLYARLNL---ATKILTNHSSRKTYD 102
           +T  +I K  R+ A + HPDK+P      A+      A ++L++   RK YD
Sbjct: 17  ATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSDDELRKRYD 68

>Scas_612.14
          Length = 431

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 7/72 (9%)

Query: 38  KYGDFYKFLKLPNGK-SSTEKQINKNLRKLARKYHPDKNP------KHKKLYARLNLATK 90
           K  D Y  + L   +  +TE QI K  RK   KYHPDK        +    +  +  A +
Sbjct: 94  KTADLYAAMGLSQVRFKATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDGFFKIIQKAFE 153

Query: 91  ILTNHSSRKTYD 102
            LT+ + R  YD
Sbjct: 154 TLTDSNKRAQYD 165

>Kwal_55.20965
          Length = 421

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 9/62 (14%)

Query: 59  INKNLRKLARKYHPDKNPKHKKLYAR---LNLATKILTNHSSRKTYDYY------LKNGF 109
           I K  RK + + HPDKNP       R   ++ A ++L+    R  YD Y       K GF
Sbjct: 23  IKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKEDLRAKYDKYGKEEAIPKEGF 82

Query: 110 PD 111
            D
Sbjct: 83  ED 84

>Kwal_14.1174
          Length = 284

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 39 YGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDK----NPKHKKLYARLNLATKILT 93
          + D   + +L    S +E Q+ K+ RK    YHPDK     P+ K+ + ++  A +ILT
Sbjct: 8  FPDLNPYEELQVETSVSEAQLRKSYRKRMLLYHPDKTKDWTPEAKEKFHKIQFAFEILT 66

>CAGL0H02827g 261006..262976 similar to sp|P40358 Saccharomyces
           cerevisiae YJL073w JEM, start by similarity
          Length = 656

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH---------KKLYARLNLATKI 91
           ++Y+ L +     +++K+I K    L +KYHPDK  K           +  + +N A ++
Sbjct: 541 NYYQILGIK--PEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEV 598

Query: 92  LTNHSSRKTYD 102
           L +   RK YD
Sbjct: 599 LNDEEKRKEYD 609

>YGR285C (ZUO1) [2230] chr7 complement(1061857..1063158) Zuotin
           (Z-DNA-binding protein), associates with Ssz1p to form
           the ribosome-associated complex (RAC), has region of
           similarity to E. coli DnaJ chaperonin [1302 bp, 433 aa]
          Length = 433

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 14/91 (15%)

Query: 38  KYGDFYKFLKLPNGK-SSTEKQINKNLRKLARKYHPDKNPK------HKKLYARLNLATK 90
           K  D Y  + L   +  +TE QI K  RK   KYHPDK             +  +  A +
Sbjct: 94  KTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFE 153

Query: 91  ILTNHSSRKTYDY--YLKNGFP-----DYDF 114
            LT+ + R  YD   ++ +  P     DYDF
Sbjct: 154 TLTDSNKRAQYDSCDFVADVPPPKKGTDYDF 184

>Scas_707.19
          Length = 519

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 5/97 (5%)

Query: 23  AEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPD--KNPKHKK 80
           +  +  F       ++  D YK L +   KS+T  +I K   KLA+KYHPD  K P  +K
Sbjct: 33  SNRIATFHTSAITHQEIKDPYKVLGI--NKSATSSEIKKAYYKLAKKYHPDINKEPTAEK 90

Query: 81  LYARLNLATKILTNHSSRKTYDYYLKNGFPDYDFSKG 117
            +  L  A +IL++ + +  YD +    F + D S G
Sbjct: 91  KFHDLQNAYEILSDETKKSQYDTFGSAAF-NQDGSGG 126

>Kwal_23.4420
          Length = 592

 Score = 30.0 bits (66), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 42  FYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN----PKHKKLYARLNLATKILTNHSS 97
           +Y+ L +    ++++  + K  RK A  YHPDKN     +   ++A +  A ++L +   
Sbjct: 5   YYELLGVET--TASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 98  RKTYDYY 104
           R  YD +
Sbjct: 63  RAWYDSH 69

>Scas_653.14
          Length = 669

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 19/128 (14%)

Query: 33  KEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPK---------HKKLYA 83
           K+ A    D Y+ L +    S++++ I    RKL+ K+HPDK  K          ++ Y 
Sbjct: 113 KQAAVGIFDPYELLGI--SVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYV 170

Query: 84  RLNLATKILTNHSSRKTYDYYLKNGFPD--YDFSKGGF---FFQRAQPKTWFIIGFVLLV 138
           ++  A + LT+   ++    +LK G PD     S G     F          I+ +V L+
Sbjct: 171 QITKAYEALTDEVIKEN---FLKYGHPDGPQSMSHGIALPKFLVEGSASPLLILFYVALL 227

Query: 139 ATAFHYII 146
                Y++
Sbjct: 228 GIILPYLV 235

>Kwal_23.3061
          Length = 458

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 5/67 (7%)

Query: 41  DFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKN--PKHKKL-YARLNLATKILTNHSS 97
           D Y  L +    +++ ++I K  R  A K+HPDKN   +  KL + ++  A +IL +   
Sbjct: 8   DLYDTLGV--AANASRQEIKKAYRLKALKHHPDKNGHSEQSKLKFQQICKAYEILGDDKK 65

Query: 98  RKTYDYY 104
           R+ YD +
Sbjct: 66  REMYDRF 72

>KLLA0D07656g 658179..659594 similar to sp|P35191 Saccharomyces
           cerevisiae YFL016c MDJ1 heat shock protein - chaperone,
           start by similarity
          Length = 471

 Score = 28.9 bits (63), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 29  FQLQKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKH--KKLYARLN 86
           F   + + +++ D YK L +   K+S++  I K   KLA+KYHPD N +   +K +  L 
Sbjct: 13  FHTARLLRQEFKDPYKVLGI--NKNSSQSDIKKAYYKLAKKYHPDINKEEDSQKKFHDLQ 70

Query: 87  LATKILTNHSSRKTYDYYLKNGF 109
            A +IL++   RK YD +    F
Sbjct: 71  NAYEILSDEDKRKQYDQFGAAAF 93

>Kwal_26.9495
          Length = 428

 Score = 28.9 bits (63), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 33/77 (42%), Gaps = 6/77 (7%)

Query: 38  KYGDFYKFLKLPNGK-SSTEKQINKNLRKLARKYHPDKNPKHKKL-----YARLNLATKI 91
           K  D Y  + L   +  +TE QI K  RK   K+HPDK      L     +  +  A + 
Sbjct: 93  KTADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYET 152

Query: 92  LTNHSSRKTYDYYLKNG 108
           LT+ + R  YD    N 
Sbjct: 153 LTDSNKRAQYDSCDSNA 169

>YLR090W (XDJ1) [3505] chr12 (320702..322081) Homolog of E. coli
           DnaJ [1380 bp, 459 aa]
          Length = 459

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 16/78 (20%)

Query: 52  KSSTEKQINKNLRKLARKYHPDK--NPKHKKL----YARLNLATKILTNHSSRKTYDYY- 104
           + +T ++I    RKLA K+HPDK  +   K++    +  +  A +IL++   +  YD Y 
Sbjct: 18  RDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLYG 77

Query: 105 ---------LKNGFPDYD 113
                      NGF D D
Sbjct: 78  DDNGAASSGGANGFGDED 95

>CAGL0J04224g 393253..394821 similar to sp|P35191 Saccharomyces
           cerevisiae YFL016c MDJ1 heat shock protein - chaperone,
           hypothetical start
          Length = 522

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 4/76 (5%)

Query: 29  FQLQKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPD--KNPKHKKLYARLN 86
           F     + +++ D Y+ L +   KSS++  I K   KLA+KYHPD  K    +K +  L 
Sbjct: 35  FHSTSSVKQEFKDPYETLGVK--KSSSQSDIKKAYYKLAKKYHPDINKEAGAEKKFHDLQ 92

Query: 87  LATKILTNHSSRKTYD 102
            A +IL++ S RK YD
Sbjct: 93  NAYEILSDESKRKQYD 108

>YNL311C (YNL311C) [4302] chr14 complement(49396..51687) Protein
           that may be involved in amino acid metabolism, contains
           an cyclin-associated F-box [2292 bp, 763 aa]
          Length = 763

 Score = 28.5 bits (62), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 22  TAEEVEIFQLQKEIAKKYGDFYKFLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKL 81
           T E++  FQL K+  K+Y    K+  LP  K    K  NK  R   R+ H      H+KL
Sbjct: 276 TNEDLRTFQLSKKFVKEYES--KYYSLPRLKILEIKANNKRQRTFNRQRH------HQKL 327

Query: 82  YARLNL 87
             R +L
Sbjct: 328 VLRPSL 333

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.138    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,546,964
Number of extensions: 420390
Number of successful extensions: 1509
Number of sequences better than 10.0: 119
Number of HSP's gapped: 1482
Number of HSP's successfully gapped: 119
Length of query: 293
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 192
Effective length of database: 13,099,691
Effective search space: 2515140672
Effective search space used: 2515140672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)