Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02101g1971948531e-118
YFR042W2001704734e-60
Kwal_47.192032351734661e-58
Sklu_2433.152101744327e-54
KLLA0A01111g2091713901e-47
Scas_687.172221723902e-47
AFR247W2111733511e-41
Sklu_2377.3103247690.63
Kwal_47.18929830113671.1
Sklu_1247.314531631.9
Scas_556.4*71450624.0
KLLA0B01760g60650624.3
CAGL0M03971g78141624.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02101g
         (194 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02101g complement(214712..215305) similar to sp|P43614 Sac...   333   e-118
YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknow...   186   4e-60
Kwal_47.19203                                                         184   1e-58
Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement     171   7e-54
KLLA0A01111g complement(102802..103431) similar to sp|P43614 Sac...   154   1e-47
Scas_687.17                                                           154   2e-47
AFR247W [3439] [Homologous to ScYFR042W - SH] complement(884059....   139   1e-41
Sklu_2377.3 YPL125W, Contig c2377 4947-8045                            31   0.63 
Kwal_47.18929                                                          30   1.1  
Sklu_1247.3 YPL187W, Contig c1247 1905-2342                            29   1.9  
Scas_556.4*                                                            28   4.0  
KLLA0B01760g complement(139684..141504) weakly similar to sp|P32...    28   4.3  
CAGL0M03971g 442995..445340 similar to sp|P42843 Saccharomyces c...    28   4.4  

>CAGL0C02101g complement(214712..215305) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w, hypothetical start
          Length = 197

 Score =  333 bits (853), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 177/194 (91%), Positives = 177/194 (91%)

Query: 1   MFTHKXXXXXXXXXXXXXXXXXGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWS 60
           MFTHK                 GRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWS
Sbjct: 1   MFTHKLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWS 60

Query: 61  LYFHGLRGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHW 120
           LYFHGLRGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHW
Sbjct: 61  LYFHGLRGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHW 120

Query: 121 CRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLI 180
           CRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLI
Sbjct: 121 CRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLI 180

Query: 181 LYFPMALTVYKRHL 194
           LYFPMALTVYKRHL
Sbjct: 181 LYFPMALTVYKRHL 194

>YFR042W (YFR042W) [1724] chr6 (238445..239047) Protein of unknown
           function [603 bp, 200 aa]
          Length = 200

 Score =  186 bits (473), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 98/170 (57%), Positives = 129/170 (75%), Gaps = 2/170 (1%)

Query: 24  RWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGLR-GFISQRVLKSLNYLY 82
           RWL+LMPLVGSR+LPGGIHE+L YL+   S+ EV+W L FHG + G +S+  LK LN++Y
Sbjct: 28  RWLILMPLVGSRFLPGGIHEFLIYLMFYSSIMEVIWLLRFHGFKYGLLSRTFLKDLNFIY 87

Query: 83  LVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYWKFISY 142
           LV  +HFYDDYEHA +LK ++YS+FII +SL ++Y HWC+LFKR    K  T  WK  ++
Sbjct: 88  LVSVIHFYDDYEHALILKNASYSSFIISLSLSQAYCHWCKLFKR-KGVKERTLVWKVNTF 146

Query: 143 VMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYKR 192
           V LP LYLSEF LLLLN Q+ N+H+T  L+++N VVL+ YFP+ LT YK+
Sbjct: 147 VTLPILYLSEFALLLLNIQVKNYHSTPTLDIINRVVLLAYFPVLLTAYKK 196

>Kwal_47.19203
          Length = 235

 Score =  184 bits (466), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 124/173 (71%), Gaps = 2/173 (1%)

Query: 23  GRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGL-RGFISQRVLKSLNYL 81
            RW VL PLVGS++LPGGIHE+LCYL++    FE++W+  F G  R  +S+ +LK +++L
Sbjct: 61  ARWAVLFPLVGSKFLPGGIHEFLCYLMLYAGFFEIVWTYAFRGFKRTLLSRTLLKDVSFL 120

Query: 82  YLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYWKFIS 141
           Y V  LHFYDDYEHA +LK  +YSTFI+ + L ++Y HWC+LFK  P+  R T  WK  +
Sbjct: 121 YWVGILHFYDDYEHALVLKNISYSTFIVTLGLSQTYCHWCKLFK-SPSKNRNTILWKIDT 179

Query: 142 YVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYKRHL 194
           ++ LP LYLSEF LLLLN Q PN H+   LE+VN VVLI++ P++L  +++ L
Sbjct: 180 FLTLPILYLSEFYLLLLNVQTPNFHSYHWLEIVNKVVLIIFIPISLHAFRKQL 232

>Sklu_2433.15 YFR042W, Contig c2433 24495-25127 reverse complement
          Length = 210

 Score =  171 bits (432), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 88/174 (50%), Positives = 120/174 (68%), Gaps = 4/174 (2%)

Query: 23  GRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGLRGFI-SQRVLKSLNYL 81
            RWLVL+PLVG+++LPGGIHEYLCYL++  S  E+     FHGL G + S  +LK+LN L
Sbjct: 36  ARWLVLLPLVGTKFLPGGIHEYLCYLILYASFGELFCLFGFHGLFGALTSSTLLKNLNML 95

Query: 82  YLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYW-KFI 140
           Y V  +HFYDDYEHAP+LK S+YS+FIIG+S  + Y HW +LFK    + R+   W K  
Sbjct: 96  YFVAVMHFYDDYEHAPVLKNSSYSSFIIGLSFTQMYCHWKKLFKH--THGRKNSIWRKVD 153

Query: 141 SYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYKRHL 194
           +  M+P  YLSEF L LLN Q PN H+T  L+ +N  VL+ + P++L ++K+ +
Sbjct: 154 TLAMMPLFYLSEFYLFLLNVQNPNFHSTLLLDRLNKFVLVAFIPLSLHMFKKQI 207

>KLLA0A01111g complement(102802..103431) similar to sp|P43614
           Saccharomyces cerevisiae YFR042w hypothetical protein
           singleton, start by similarity
          Length = 209

 Score =  154 bits (390), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 115/171 (67%), Gaps = 3/171 (1%)

Query: 24  RWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGLRGFISQR-VLKSLNYLY 82
           RWLVL+PLV  +YLPGGIH +LC L+V  +V  +LW +   GL   I  R  LK++N +Y
Sbjct: 34  RWLVLLPLVSRKYLPGGIHRFLCCLMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIY 93

Query: 83  LVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYW--KFI 140
           LV  LHFYDD+EH+PLLK ++YS+FI+G+S  + Y HW R+FK      R ++    +  
Sbjct: 94  LVAILHFYDDFEHSPLLKNTSYSSFIVGLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLN 153

Query: 141 SYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYK 191
           +++M+P LYLSEF LLLLN ++ N+H   +  L N  VL+++ P+ L +YK
Sbjct: 154 AFIMIPLLYLSEFYLLLLNTEIDNYHNGPKTVLFNKFVLVVFIPLCLHLYK 204

>Scas_687.17
          Length = 222

 Score =  154 bits (390), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 126/172 (73%), Gaps = 2/172 (1%)

Query: 23  GRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGLRGFI-SQRVLKSLNYL 81
            RWL++ PL G+R+LPGG+HE+LCYL++  SV E++W   F+ L+  I S+ +LK LN++
Sbjct: 49  ARWLIIFPLAGARFLPGGVHEFLCYLMIYASVGEIIWLFKFYPLKSVIFSKTLLKDLNFI 108

Query: 82  YLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYWKFIS 141
           Y VL LHFYDDYEHA +LK  +YS FIIG+SL ++Y HWC+LFKR    K+ T  +K  +
Sbjct: 109 YFVLVLHFYDDYEHALVLKNISYSVFIIGLSLNQAYHHWCKLFKRS-GRKKNTLVFKVNN 167

Query: 142 YVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYKRH 193
            +  P LYLSE+ LLLLN Q PN H+T  L+++N ++LI+YFP+AL VY+  
Sbjct: 168 LLGSPLLYLSEYYLLLLNVQNPNFHSTPLLDIINRIILIIYFPIALAVYRNQ 219

>AFR247W [3439] [Homologous to ScYFR042W - SH]
           complement(884059..884694) [636 bp, 211 aa]
          Length = 211

 Score =  139 bits (351), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 112/173 (64%), Gaps = 3/173 (1%)

Query: 23  GRWLVLMPLVGSRYLPGGIHEYLCYLLVIVSVFEVLWSLYFHGL-RGFISQRVLKSLNYL 81
            RWL L PLVG+R++PGGIH +L YLL   +V EVLW ++F+   +G  ++ +LK  N L
Sbjct: 39  ARWLALFPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANML 98

Query: 82  YLVLNLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYWKFIS 141
           Y V  +HFYDDYEHAP+LK   YS FI+ + + ++  H  RLF+     +         +
Sbjct: 99  YFVAVMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHHGGRLFRGRRRRRSWWWRSD--T 156

Query: 142 YVMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTVYKRHL 194
           +V+ P LY+S+F LLLLN Q P+ H+T +L+++N  VL+ Y P+AL  ++R L
Sbjct: 157 FVLQPALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLVAYVPLALQCFRRQL 209

>Sklu_2377.3 YPL125W, Contig c2377 4947-8045
          Length = 1032

 Score = 31.2 bits (69), Expect = 0.63,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 137 WKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTE-QLELVNTVVLILY 182
           W F  Y   P  YL++FV L L + LP    TE +L ++NT+  ++Y
Sbjct: 566 WDFNKYTFQP--YLNDFVTLFLRKMLPAVSLTETRLYVLNTLSDVIY 610

>Kwal_47.18929
          Length = 830

 Score = 30.4 bits (67), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query: 86  NLHFYDDYEHAPLLKTSAYSTFIIGVSLVESYQH---WCRLFKRGPNYKRETRYWKFISY 142
           ++H  DD+ + PL++  +   +    ++   Y H   +C L    P  +RE  Y K + Y
Sbjct: 263 DIHNSDDFAYMPLVRGKSLDKYPREETMTNYYAHVFRYCHL----PYKRREYFYNKSVDY 318

Query: 143 VMLPCLYLSEFVLLLLNRQLPNHHTTEQLELVNTVVLILYFPMALTV-YKRHL 194
              P +  S+               ++QL+ ++     LYFP  + + + RH+
Sbjct: 319 CQYPIVRDSD---------------SQQLQTLSQGKQELYFPQNIPIDFLRHM 356

>Sklu_1247.3 YPL187W, Contig c1247 1905-2342
          Length = 145

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 119 HWCRLFKRGPNYKRETRYWKFISYVMLPCLY 149
           HW    K  P YKRE+  W ++S+ +   LY
Sbjct: 115 HWLSFSKGEPLYKRESEAWHWLSFSLGEPLY 145

>Scas_556.4*
          Length = 714

 Score = 28.5 bits (62), Expect = 4.0,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%)

Query: 123 LFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQLE 172
           +F+  P Y   +RYW  I    +   Y++   L LL R   +H     L+
Sbjct: 386 IFEGTPTYPNHSRYWDIIDEYNVTQFYVAPTALRLLKRAGNSHLENNSLK 435

>KLLA0B01760g complement(139684..141504) weakly similar to sp|P32500
           Saccharomyces cerevisiae YML031w NDC1 nuclear envelope
           protein singleton, start by similarity
          Length = 606

 Score = 28.5 bits (62), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%)

Query: 121 CRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNRQLPNHHTTEQ 170
           C  F  G   ++ +++++F    M+P LY  + VLL L+R   N+    Q
Sbjct: 134 CCFFTPGTGSRKHSQHYEFCCQFMVPFLYSIQHVLLDLDRLTFNYGAQHQ 183

>CAGL0M03971g 442995..445340 similar to sp|P42843 Saccharomyces
           cerevisiae YNL311c, start by similarity
          Length = 781

 Score = 28.5 bits (62), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 64  HGLRGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTSAY 104
           +G RG  S +  KS N  +LV ++ F +   H  LLK S +
Sbjct: 117 NGTRGSTSPQENKSQNVRFLVRSVEFVNPQSHDSLLKYSKF 157

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.331    0.145    0.471 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,743,892
Number of extensions: 229134
Number of successful extensions: 697
Number of sequences better than 10.0: 23
Number of HSP's gapped: 684
Number of HSP's successfully gapped: 23
Length of query: 194
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 98
Effective length of database: 13,272,781
Effective search space: 1300732538
Effective search space used: 1300732538
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)