Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02079g26526112541e-177
YFR043C2372362441e-24
Sklu_2433.142502602003e-18
AFR248C3042461691e-13
KLLA0A01089g2332281502e-11
Kwal_47.192042502381441e-10
Scas_699.392612621151e-06
AFR587C77333681.3
YBL105C (PKC1)115177652.9
Kwal_23.500262260643.5
CAGL0K02277g56764643.5
KLLA0E18700g37420618.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02079g
         (261 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces c...   487   e-177
YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein...    99   1e-24
Sklu_2433.14 YFR043C, Contig c2433 23715-24467                         82   3e-18
AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [...    70   1e-13
KLLA0A01089g 102036..102737 weakly similar to sp|P43615 Saccharo...    62   2e-11
Kwal_47.19204                                                          60   1e-10
Scas_699.39                                                            49   1e-06
AFR587C [3779] [Homologous to ScYGR071C - SH; ScYLR373C (VID22) ...    31   1.3  
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...    30   2.9  
Kwal_23.5002                                                           29   3.5  
CAGL0K02277g 202931..204634 similar to sp|P40077 Saccharomyces c...    29   3.5  
KLLA0E18700g 1652892..1654016 weakly similar to sp|P38757 Saccha...    28   8.1  

>CAGL0C02079g 213832..214629 similar to sp|P43615 Saccharomyces
           cerevisiae YFR043c, hypothetical start
          Length = 265

 Score =  487 bits (1254), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/261 (95%), Positives = 249/261 (95%)

Query: 1   MLDESSSSDESRATELPVSSEDECEEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ 60
           MLDESSSSDESRATELPVSSEDECEEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ
Sbjct: 1   MLDESSSSDESRATELPVSSEDECEEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ 60

Query: 61  DQGNIVKQLSWDTKYYAVEYDLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDS 120
           DQGNIVKQLSWDTKYYAVEYDLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDS
Sbjct: 61  DQGNIVKQLSWDTKYYAVEYDLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDS 120

Query: 121 TQDTKEYNSVLYDFIQGXXXXXXXXXXXXARQVKDTYDEFLELDASSIEFINYHDDRVEK 180
           TQDTKEYNSVLYDFIQG            ARQVKDTYDEFLELDASSIEFINYHDDRVEK
Sbjct: 121 TQDTKEYNSVLYDFIQGNSVSVISVNTNSARQVKDTYDEFLELDASSIEFINYHDDRVEK 180

Query: 181 ETNECKGMARLKEIIDTHPWTDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLS 240
           ETNECKGMARLKEIIDTHPWTDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLS
Sbjct: 181 ETNECKGMARLKEIIDTHPWTDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLS 240

Query: 241 NGSDGFSEEAEQFALQMATDI 261
           NGSDGFSEEAEQFALQMATDI
Sbjct: 241 NGSDGFSEEAEQFALQMATDI 261

>YFR043C (YFR043C) [1725] chr6 complement(239101..239814) Protein of
           unknown function [714 bp, 237 aa]
          Length = 237

 Score = 98.6 bits (244), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 120/236 (50%), Gaps = 19/236 (8%)

Query: 35  NKVLVVFEGESTLFRDQLLDTVFGVQDQG-NIVKQLSWDTKYYAVEYDLYVDECVDIHGW 93
           NK+LV+ +      + Q L  +F     G +IVK  +W+ +YY V +DLY+D C +I  W
Sbjct: 8   NKILVLSDHPHNFLKTQFLQDLFHCSSTGISIVKDQTWENRYYKVHFDLYIDSCKEIPVW 67

Query: 94  LNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGXXXXXXXXXXXXARQV 153
           + E  + + E LR+++  II++     T+  +    +L+ F+                +V
Sbjct: 68  VEEFITPECEPLRNVMAGIILITDIRQTKPQE----LLHQFMIAAHRNTFVVLANVNEEV 123

Query: 154 -KDTYDEFLELDASS----IEFINYHDDRVEKETN---ECKGMARLKEIIDTHPWTDCKV 205
            +D  DE  E+ +++    IEF+N+   +     N   E  G+ R++EIIDTH W +C+V
Sbjct: 124 EQDEIDELNEIWSNAFTNVIEFVNWKRSKPTVNHNDYGEKLGLDRIQEIIDTHDWLNCEV 183

Query: 206 VLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATDI 261
               K    +  N+  LE +I  L+ A++ Y+ + N S     EA+ FA +MA ++
Sbjct: 184 QPATK-IREEIPNEMPLEQIIRNLQSARLKYKSIENSS-----EADAFANEMADEL 233

>Sklu_2433.14 YFR043C, Contig c2433 23715-24467
          Length = 250

 Score = 81.6 bits (200), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/260 (25%), Positives = 126/260 (48%), Gaps = 26/260 (10%)

Query: 13  ATELPVSSEDECEEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ-DQG-NIVKQLS 70
             ELP     E E +   K+  NK+LVV   E    +  ++ ++F    D G +I+K LS
Sbjct: 2   TAELP-----EVEGIKTTKIPRNKILVVCSAEIE-NKVSIISSLFNTNVDSGCSILKNLS 55

Query: 71  WDTKYYAVEYDLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSV 130
           W  KYY    D+Y+D+   +  W  E    +Y +LR++L  +I++ ++ S Q    +  +
Sbjct: 56  WQNKYYKTNIDVYIDDYDSLDEWTREFQQSEYNDLREVLAGVILLFNYRSEQTFSHFLDI 115

Query: 131 LYDFIQGXXX---XXXXXXXXXARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKG 187
           +    Q                A + +   D ++   A  +E IN+ ++  +    +  G
Sbjct: 116 INSTSQNDEKFYIACNVSSKIDAEEWESLSDNYI---AHGLELINW-EESGKNAFGDKLG 171

Query: 188 MARLKEIIDTHPWTDCKVVLKNKESTS------DKVNKPDLEYLIDTLKKAKIHYQKLSN 241
           + R++EIIDTH WT C++ +K + +        D+  +  LE +++ L +A+  YQ ++N
Sbjct: 172 LERIREIIDTHEWTQCELDVKEQPTIGVGSLLQDESAEFTLEEVLEKLNEARSRYQSMNN 231

Query: 242 GSDGFSEEAEQFALQMATDI 261
                 +EAE FA +++ ++
Sbjct: 232 -----KDEAEMFAQEISEEL 246

>AFR248C [3440] [Homologous to ScYFR043C - SH] (884696..885610) [915
           bp, 304 aa]
          Length = 304

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/246 (21%), Positives = 118/246 (47%), Gaps = 22/246 (8%)

Query: 25  EEVTDAKVLPNKVLVVFEGESTLFRDQLLDTVFGVQ--DQGNIVKQLSWDTKYYAVEYDL 82
           E+     VLP   +++       ++ +++  +F ++  +   IV+ + W  KYY V+ DL
Sbjct: 65  EQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEASESDRIVRDVKWSNKYYEVDLDL 124

Query: 83  YVDECVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGXXXXX 142
           Y+D    +  W  E  SD+  +LRD++  I +V  F+ T+D + +  ++ D         
Sbjct: 125 YIDSYESLQTWGAEFCSDECADLRDVVAGIFLV--FEETEDAETFQQLIEDCHFTDERVL 182

Query: 143 XXXXXXXARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTD 202
                  A     + +  LE+    +  + +  +R   E  E +G  R++E++D HPW++
Sbjct: 183 VACDLSSAEH-PASLERALEV--HDVALVRWR-ERGTNELGEQQGRERVRELLDIHPWSE 238

Query: 203 CKVVLKNKESTSDKVNKPD-------LEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFAL 255
              +L+   ST+  + + D       L+ ++  +K+A+  Y ++++        A+++A 
Sbjct: 239 --RMLRMHASTAAALAELDPLQADIPLDSVVTRIKQARERYLEITD-----VHAADEYAA 291

Query: 256 QMATDI 261
           ++A ++
Sbjct: 292 RIAHEL 297

>KLLA0A01089g 102036..102737 weakly similar to sp|P43615
           Saccharomyces cerevisiae YFR043c hypothetical protein
           singleton, hypothetical start
          Length = 233

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 111/228 (48%), Gaps = 20/228 (8%)

Query: 35  NKVLVVFEGESTLFRDQL--LDTVFGVQ--DQGNIVKQLSWDTKYYAVEYDLYVDECVDI 90
           +KVL++   ES   ++ +  + T+F  Q  +  +I + + W TKYY    DLY+D    +
Sbjct: 4   HKVLILL-PESLEIQEHIAFISTIFQKQYDETESIARDVQWKTKYYETTLDLYIDTYDVL 62

Query: 91  HGWLNEVNSDDYEELRDLLTMIIIV-RSFDSTQDTKEYNSVLYDFIQGXXXXXXXXXXXX 149
             W+N+  SD+ +ELRD+++ II V +  D     +   +++ + I+             
Sbjct: 63  QEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKNLIDERIEDFTAKFFIGCYFN 122

Query: 150 ARQVKDTYDEFLELDA----SSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTDCKV 205
              +++  DE  EL++     + E +N+ D      + +  G  R+KEIID HPW     
Sbjct: 123 ENVIEE--DELYELNSDLLVQNFEIVNWFDK--PDPSMDKVGSERIKEIIDVHPWLSHPE 178

Query: 206 VLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQF 253
            LK  +   + ++  DL+  +  L++AK  YQ   +     S+EAE F
Sbjct: 179 TLKKNQGQIN-ISPIDLDSFMTKLEQAKERYQTFDD-----SKEAELF 220

>Kwal_47.19204
          Length = 250

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 107/238 (44%), Gaps = 18/238 (7%)

Query: 33  LP--NKVLVVFEGESTLFRDQ--LLDTVFGV--QDQGNIVKQLSWDTKYYAVEYDLYVDE 86
           LP  +K++V F   S    DQ  ++  +FG+  +D   I   L W TKYY+V+ DLY+D 
Sbjct: 18  LPIRDKIIVCF---SNYVHDQAEVISDLFGISFKDDQRIHHDLEWTTKYYSVKIDLYIDS 74

Query: 87  CVDIHGWLNEVNSDDYEELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGXXXXXXXXX 146
              +  W+ +  + + +ELRD+L  +++V          E  + L D +           
Sbjct: 75  FDSLRDWVQQFCNSECDELRDVLAGLVLVVPCKVEDADLETFTQLADCMADAESFFVVLK 134

Query: 147 XXXARQVKDTYDEFLELDASSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTDCKVV 206
                  + T     +L A+ +E +    D    E  E  G  R++EIIDT+ W    + 
Sbjct: 135 ARSNPSEECTDSSENKLLANGVEIV-CRGDSGRNEYGEVIGTNRVREIIDTYDWQTQLLK 193

Query: 207 LKNKESTS---DKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATDI 261
           L+   +T    D  +   L  ++  L++A+  Y  + +     SEE E FA  +A ++
Sbjct: 194 LRQPSATKELEDTSSGLPLNEIMTRLQEARTKYLAMDS-----SEEREIFARDVAHEL 246

>Scas_699.39
          Length = 261

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 109/262 (41%), Gaps = 41/262 (15%)

Query: 27  VTDAKVLPNKVLVVFEG---ESTLFRDQL---LDTVFGVQDQGNIVKQLSWDTKYYAVEY 80
           +T   V  NK+LVVF       TL R+ L    D         +I+K + W  KY+ ++ 
Sbjct: 1   MTAVGVPQNKILVVFNKNRIPQTLQREFLQRTFDLPIENDSSDSIIKGIIWKNKYFELQL 60

Query: 81  DLYVDECVDIHGWLNEVNSDDYEELRDLLTMIIIV--------------RSFDSTQDTKE 126
           DLY+DE  D   ++ E   D+  ELR ++  III+                 DS  +T  
Sbjct: 61  DLYIDEFEDFEEFVYEYCLDEMSELRSVIAGIIIIDDTYHFEDNKLVNKLQTDSGSETSS 120

Query: 127 YNSVLYDFIQGXXXXXXXXXXXXARQV---KDTYDEFLELDASSIEFINYHDDRVEKET- 182
              V+ +F               +  +   +D   E++ LD            R+EK + 
Sbjct: 121 SFMVIGNFEGDYEEEDIAQWRFPSESMTNDEDIIAEYVPLDKHF---------RMEKNSL 171

Query: 183 NECKGMARLKEIIDTHPWT-DCKVV-LKNKESTSDKVNK-PDLEYLIDTLKKAKIHYQKL 239
            +  G+  +KE +D H W  +C +  L   + T    N   D+  +I+ L+ A+I++Q  
Sbjct: 172 GDKVGVPGIKEKLDLHEWNPNCNIQKLDQIQPTHPPSNMDVDISAIINQLRDARINFQTH 231

Query: 240 SNGSDGFSEEAEQFALQMATDI 261
            +      EEA+  A  +A  I
Sbjct: 232 KD-----QEEAKSIATALAESI 248

>AFR587C [3779] [Homologous to ScYGR071C - SH; ScYLR373C (VID22) -
           SH] (1493491..1495812) [2322 bp, 773 aa]
          Length = 773

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 37  VLVVFEGESTLFRDQLLDTVFGVQDQGNIVKQL 69
           VL  F   +TLF DQLL TVFG +    I+  +
Sbjct: 486 VLASFLVPTTLFDDQLLATVFGTESLPKIINSV 518

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
           regulates MAP kinase cascade involved in regulating cell
           wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 42/77 (54%), Gaps = 8/77 (10%)

Query: 177 RVEKETNECKGMARLKEIIDTHPWTDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHY 236
           ++  E N  +G + LK+           V++  K +T+ +  + +LEYL D+LKK ++  
Sbjct: 13  KIAVEENIIRGASALKKKTSN-------VMVIQKCNTNIREARQNLEYLEDSLKKLRLKT 65

Query: 237 QKLSNGSDGFSEEAEQF 253
            + S G +G SE+ E+F
Sbjct: 66  AQQSQGENG-SEDNERF 81

>Kwal_23.5002
          Length = 622

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 30/60 (50%)

Query: 201 TDCKVVLKNKESTSDKVNKPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATD 260
           +D K+V +N+    DK+  PDL ++I+  ++      +  N    F+   +  A++M  D
Sbjct: 290 SDLKLVFQNERELCDKLLFPDLNFIINNWREPSFDLWEEVNAQHFFTALCQLKAVKMGWD 349

>CAGL0K02277g 202931..204634 similar to sp|P40077 Saccharomyces
           cerevisiae YER124c, start by similarity
          Length = 567

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 15/64 (23%)

Query: 30  AKVLPNKVLVVFEGESTLFRDQLLDTVFGVQDQGNIVKQLSWD-TKYYAVEYDLYVDECV 88
           AK+LPNK   V E  S  +     DT+F   DQGNI+   +WD T    +EY      C 
Sbjct: 342 AKILPNKG--VIEHLSYHYET---DTLFSSDDQGNII---AWDLTNLDRLEY------CG 387

Query: 89  DIHG 92
            +HG
Sbjct: 388 LVHG 391

>KLLA0E18700g 1652892..1654016 weakly similar to sp|P38757
           Saccharomyces cerevisiae YHR004c NEM1 required for
           nuclear morphology, hypothetical start
          Length = 374

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 6/20 (30%), Positives = 14/20 (70%)

Query: 77  AVEYDLYVDECVDIHGWLNE 96
            + Y +++D  + +HGW+N+
Sbjct: 318 PISYAMHLDNAIQVHGWIND 337

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,465,215
Number of extensions: 364721
Number of successful extensions: 1121
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1115
Number of HSP's successfully gapped: 34
Length of query: 261
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 161
Effective length of database: 13,134,309
Effective search space: 2114623749
Effective search space used: 2114623749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)