Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0C02057g1191186093e-83
ADR232W85573700.13
Kwal_55.2126856834670.28
YKL179C (COY1)67989650.63
YLR187W102657640.80
Scas_570.2125834631.2
KLLA0E06028g77867593.0
YOR191W (RIS1)161938593.4
AGL142C149738594.1
CAGL0F02739g125835577.5
KLLA0A02255g121034568.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0C02057g
         (118 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0C02057g complement(213180..213539) no similarity, hypotheti...   239   3e-83
ADR232W [1973] [Homologous to ScYKR090W (PXL1) - SH] complement(...    32   0.13 
Kwal_55.21268                                                          30   0.28 
YKL179C (COY1) [3093] chr11 complement(110469..112508) Golgi mem...    30   0.63 
YLR187W (YLR187W) [3590] chr12 (524867..527947) Protein containi...    29   0.80 
Scas_570.2                                                             29   1.2  
KLLA0E06028g complement(549775..552111) some similarities with s...    27   3.0  
YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in...    27   3.4  
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    27   4.1  
CAGL0F02739g complement(266337..270113) similar to sp|Q04183 Sac...    27   7.5  
KLLA0A02255g 199863..203495 similar to sp|Q04183 Saccharomyces c...    26   8.9  

>CAGL0C02057g complement(213180..213539) no similarity, hypothetical
           start
          Length = 119

 Score =  239 bits (609), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 118/118 (100%), Positives = 118/118 (100%)

Query: 1   MIWYYKDIEKVAGTQPVFQPQEIPEYQPQAPRPVGEPVEQWINSDAYAVELPIRNYSMII 60
           MIWYYKDIEKVAGTQPVFQPQEIPEYQPQAPRPVGEPVEQWINSDAYAVELPIRNYSMII
Sbjct: 1   MIWYYKDIEKVAGTQPVFQPQEIPEYQPQAPRPVGEPVEQWINSDAYAVELPIRNYSMII 60

Query: 61  HPQWQPPIEKQDEEKNQKLSILHKIGKVIWRPAVLDGIFVTICAIGIIYIIFMLFKYD 118
           HPQWQPPIEKQDEEKNQKLSILHKIGKVIWRPAVLDGIFVTICAIGIIYIIFMLFKYD
Sbjct: 61  HPQWQPPIEKQDEEKNQKLSILHKIGKVIWRPAVLDGIFVTICAIGIIYIIFMLFKYD 118

>ADR232W [1973] [Homologous to ScYKR090W (PXL1) - SH]
           complement(1108261..1110828) [2568 bp, 855 aa]
          Length = 855

 Score = 31.6 bits (70), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 8/73 (10%)

Query: 7   DIEKVAGTQPVFQPQEIPEYQPQAPRPVGEPVEQWINSDAYAVELPIRNYSMIIHPQWQP 66
           D E    ++ + Q      Y   AP    EPV        ++V  P+    M++    QP
Sbjct: 304 DFENQKNSRAISQSNASSTYPTPAPDDTQEPV--------FSVLDPVERSFMMLTQNSQP 355

Query: 67  PIEKQDEEKNQKL 79
            +E +DEE  Q L
Sbjct: 356 DMEDKDEEDGQSL 368

>Kwal_55.21268
          Length = 568

 Score = 30.4 bits (67), Expect = 0.28,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 5   YKDIEKVAGTQPV----FQPQEIPEYQPQAPRPV 34
           YKD+ +    +P+    FQ   IPEY+P+ P P+
Sbjct: 430 YKDVIEHTNRKPLYSLAFQHSPIPEYRPKGPFPI 463

>YKL179C (COY1) [3093] chr11 complement(110469..112508) Golgi
           membrane protein, member of CASP family of Golgi
           proteins, shows genetic interaction with GOS1 [2040 bp,
           679 aa]
          Length = 679

 Score = 29.6 bits (65), Expect = 0.63,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 10/89 (11%)

Query: 33  PVGEPVEQWINSDAYAVELPIRNYSMIIHPQWQPPIEKQDEEKNQKLSILHKI----GKV 88
           PV +  E+      Y+     R Y   +HP       + +  KN+KLS L K+     KV
Sbjct: 551 PVNQSTERIDVESQYS-----RVYDESLHPMANFRQNELNHYKNKKLSALEKLFSSFAKV 605

Query: 89  IWRPAVLDGIFVTICAIGIIYIIFMLFKY 117
           I +  +   +F+  C IG+  ++FM+  Y
Sbjct: 606 ILQNKMTRMVFLFYC-IGLHGLVFMMSMY 633

>YLR187W (YLR187W) [3590] chr12 (524867..527947) Protein containing
           a pleckstrin homology (PH) domain, which mediate
           protein-protein and protein-lipid interactions, has
           moderate similarity to uncharacterized S. cerevisiae
           Caf120p [3081 bp, 1026 aa]
          Length = 1026

 Score = 29.3 bits (64), Expect = 0.80,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 5/57 (8%)

Query: 27  QPQAPRPVGEPVEQWINSDAYAVELPIR---NYSMIIHPQWQPPIEKQDEEKNQKLS 80
           QPQAP PVG P+ + I +    V+ P++   N SM      Q       + +NQ LS
Sbjct: 882 QPQAPYPVGRPLGK-IRTGPLTVQ-PMQQGGNSSMYSFQSSQHRFHSSQQRQNQSLS 936

>Scas_570.2
          Length = 1258

 Score = 28.9 bits (63), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%)

Query: 77  QKLSILHKIGKVIWRPAVLDGIFVTICAIGIIYI 110
           + +S+LHKI   IW  + LDG  V++C I + Y+
Sbjct: 276 EAVSLLHKIRDYIWLGSALDG--VSLCFILLSYL 307

>KLLA0E06028g complement(549775..552111) some similarities with
           sp|P47134 Saccharomyces cerevisiae YJR089w BIR1 member
           of the inhibitor of apoptosis family, participate in
           chromosome segregation events singleton, hypothetical
           start
          Length = 778

 Score = 27.3 bits (59), Expect = 3.0,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 16/67 (23%)

Query: 27  QPQAPRPVGEPVEQWINSDAYAVELPIRNYSM---IIHPQWQPPIEKQDEEKNQKLSILH 83
           Q QAPR  G P +             +R+ +    I  P+ +PP +K +++KNQ  S   
Sbjct: 307 QTQAPRKRGRPKK-------------LRDETAEPKIKRPRGRPPKDKDNKDKNQSASNTE 353

Query: 84  KIGKVIW 90
           K+ +  W
Sbjct: 354 KLPENQW 360

>YOR191W (RIS1) [4987] chr15 (692475..697334) Protein involved in
            silencing, member of Snf2p DNA-dependent ATPase family
            [4860 bp, 1619 aa]
          Length = 1619

 Score = 27.3 bits (59), Expect = 3.4,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 22/38 (57%)

Query: 48   AVELPIRNYSMIIHPQWQPPIEKQDEEKNQKLSILHKI 85
             + L   N+ +I+ P W P +E+Q +++  ++S   K+
Sbjct: 1527 GLTLTCANHVVIVDPFWNPYVEEQAQDRCYRISQTKKV 1564

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
           (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 27.3 bits (59), Expect = 4.1,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 14  TQPVFQPQEIPEYQPQAPRPVGEPVEQWINSDAYAVEL 51
           T P F+ +  P Y+ + PR   E  E W+ S  +AV +
Sbjct: 409 TSP-FERKSQPGYEDKVPRTAREFYEYWLRSPEHAVAM 445

>CAGL0F02739g complement(266337..270113) similar to sp|Q04183
           Saccharomyces cerevisiae YDR407c TRS120, start by
           similarity
          Length = 1258

 Score = 26.6 bits (57), Expect = 7.5,   Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 76  NQKLSILHKIGKVIWRPAVLDGIFVTICAIGIIYI 110
           N+ + +L+++  ++W  + LDG  V ICA+ + Y+
Sbjct: 286 NEAVILLYRVRDLLWLGSALDG--VAICAVILSYL 318

>KLLA0A02255g 199863..203495 similar to sp|Q04183 Saccharomyces
           cerevisiae YDR407c TRS120 TRAPP subunit of 120 kDa
           involved in targeting and fusion of ER to golgi
           transport vesicles, start by similarity
          Length = 1210

 Score = 26.2 bits (56), Expect = 8.9,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 81  ILHKIGKVIWRPAVLDGIFVTICAIGIIYIIFML 114
           ILHKI   IW  + L+GI   I  I  + + F +
Sbjct: 282 ILHKIHDYIWLGSSLEGILTCIILISYLQLPFQV 315

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.142    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,405,412
Number of extensions: 185120
Number of successful extensions: 599
Number of sequences better than 10.0: 26
Number of HSP's gapped: 587
Number of HSP's successfully gapped: 27
Length of query: 118
Length of database: 16,596,109
Length adjustment: 88
Effective length of query: 30
Effective length of database: 13,549,725
Effective search space: 406491750
Effective search space used: 406491750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)