Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B04169g86184839160.0
YPR112C (MRD1)88788525940.0
Scas_705.2286987825250.0
KLLA0D14949g87888024140.0
Kwal_23.398587687223280.0
ADR035C83885922730.0
Scas_88.12562459521e-123
CAGL0E03245g4251831774e-13
Scas_621.104151781764e-13
YGR159C (NSR1)4141791694e-12
KLLA0C11495g4451831675e-12
AFR107W3961791641e-11
Sklu_1879.44211791596e-11
CAGL0L11792g5791721562e-10
YER165W (PAB1)5771711552e-10
Scas_576.75751711525e-10
KLLA0C17600g592911472e-09
Sklu_1838.35892091453e-09
AGR122C5851711454e-09
Kwal_56.23486587841349e-08
AFL224W206801252e-07
Sklu_2442.114642041241e-06
AEL016C6781781222e-06
CAGL0I08943g6021731213e-06
YNL110C (NOP15)220751147e-06
YNL016W (PUB1)4531681169e-06
Kwal_26.8458219781121e-05
Kwal_33.15208186771101e-05
KLLA0F07799g5241001142e-05
KLLA0F23650g312751122e-05
CAGL0L03806g255751112e-05
YCL011C (GBP2)4271781132e-05
Scas_637.23771731122e-05
YBR212W (NGR1)672761132e-05
CAGL0K06655g802761133e-05
Scas_666.11224741084e-05
AAL018W3372581104e-05
Sklu_2407.3221631074e-05
Scas_565.8322901095e-05
ADL160W526491115e-05
Scas_635.7581691105e-05
Kwal_55.21960597691097e-05
KLLA0C05522g540761097e-05
KLLA0D11792g685721098e-05
Scas_701.3321601078e-05
Sklu_2182.3371951088e-05
YOL123W (HRP1)534691071e-04
CAGL0M03795g513691071e-04
CAGL0D05236g443781071e-04
Sklu_1790.3473801071e-04
AGL250W729751072e-04
Scas_717.41379961052e-04
KLLA0C12925g570481043e-04
YHR015W (MIP6)6592851043e-04
CAGL0E01947g452481034e-04
KLLA0A08338g766691034e-04
CAGL0H10604g416921015e-04
CAGL0I09900g211183977e-04
KLLA0B00847g26956997e-04
CAGL0J11154g380191999e-04
Scas_598.1516481000.001
Kwal_56.24709828931000.001
Sklu_2307.2697931000.001
Kwal_27.1183268672990.001
ADL063W32060980.001
CAGL0H04763g38393980.001
Scas_671.444386980.001
Scas_558.1435210970.002
ADR183C32068960.002
Kwal_47.1857236376960.002
Kwal_0.25021672940.002
ABL134C37582960.002
Scas_316.148347960.002
Kwal_26.717945681960.003
Kwal_27.11447439185950.003
Sklu_2353.525247940.003
CAGL0H03861g44380950.003
YPL178W (CBC2)20867920.004
KLLA0D08206g39147940.004
Sklu_1706.1672178940.004
Scas_697.10610178940.005
YPL043W (NOP4)68547940.005
YDR432W (NPL3)41494930.005
ADR017W17389900.005
Kwal_33.1446339372930.005
CAGL0D06182g28072920.005
YOL041C (NOP12)45947920.006
Kwal_0.370560152930.006
AFR649W31080910.006
AGR390C378168920.007
CAGL0E03630g74664930.007
Sklu_1715.139682910.009
KLLA0B00979g34280900.009
Scas_696.32445113910.010
CAGL0L12672g682201910.010
Scas_376.140456900.011
AEL217W83478910.011
YHL024W (RIM4)71359910.011
Scas_643.1644889900.012
Kwal_27.1109620165870.012
Sklu_2221.828156890.013
YIR005W (IST3)14872850.013
Sklu_905.151581900.014
ACR274W42681890.017
CAGL0B04807g419200880.018
Kwal_26.752226270870.018
YIL061C (SNP1)30060870.020
Scas_665.421974860.021
AFL050W21883860.023
Sklu_2249.430981860.027
ADR189W26957860.027
KLLA0E11011g432125870.028
AGL038C71255870.028
Kwal_27.10364443130870.029
KLLA0D05016g26278850.032
CAGL0C01529g23660850.034
CAGL0M12573g29953850.036
YGL044C (RNA15)29672850.041
KLLA0E08745g47593850.047
YNL175C (NOP13)40372840.056
KLLA0C08019g30160840.058
Sklu_1984.328472830.059
KLLA0D13420g16662810.062
KLLA0B10472g19867810.068
YFR023W (PES4)611178840.076
Kwal_14.185153589830.084
Sklu_2213.425772810.094
Kwal_23.586427847810.097
KLLA0F14861g589135830.10
YIR001C (SGN1)25069810.10
Sklu_2375.520767800.11
AER285C426103810.12
Kwal_27.1233720952790.13
Kwal_33.1349633077810.13
KLLA0F18216g70851820.13
Scas_621.1631470810.13
Scas_709.2*17193780.14
CAGL0H02123g55583810.14
Kwal_55.2097213572770.15
Scas_582.10283100790.18
Scas_720.224560780.21
CAGL0H04675g27460790.21
YDR429C (TIF35)27457790.22
Sklu_2257.418862770.24
CAGL0F01023g39658790.25
Scas_530.468455790.28
Sklu_2085.220974770.28
KLLA0C08041g57432790.29
AGR010C26647770.29
Kwal_56.2394580668780.37
Kwal_55.2041428479770.38
AAR151W48162780.38
Kwal_55.2103911966730.38
YHR086W (NAM8)52367780.39
YPL190C (NAB3)80273780.43
Kwal_55.2090314764730.46
ADR307W56659770.47
KLLA0A05346g87473770.48
YNL004W (HRB1)429194770.48
KLLA0D13772g34572760.49
CAGL0J02200g14447730.50
CAGL0H03267g77573760.67
Kwal_30.1289028055750.67
ADR001C32472750.75
Scas_714.5923355740.79
YGR250C78185750.83
Scas_611.5*78771750.97
Scas_157.123289731.0
Kwal_55.2015452273741.1
KLLA0F09383g25847731.1
Sklu_2391.176165741.2
CAGL0J01914g16972711.2
ADL064W64632741.2
Scas_241.118659711.3
KLLA0C07194g29772721.6
Scas_645.1471733721.8
ACL071C29872712.2
AFL070C75785712.5
YOR319W (HSH49)21361692.6
Scas_701.461232712.7
CAGL0F08217g67895703.3
Sklu_2345.451371703.4
CAGL0A04213g63983693.9
Scas_591.5*29068684.6
YBL051C (PIN4)66831686.1
AER349C21856658.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B04169g
         (848 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...  1513   0.0  
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...  1003   0.0  
Scas_705.22                                                           977   0.0  
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...   934   0.0  
Kwal_23.3985                                                          901   0.0  
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...   880   0.0  
Scas_88.1                                                             371   e-123
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    73   4e-13
Scas_621.10                                                            72   4e-13
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    70   4e-12
KLLA0C11495g complement(990832..992169) some similarities with s...    69   5e-12
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    68   1e-11
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         66   6e-11
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...    65   2e-10
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...    64   2e-10
Scas_576.7                                                             63   5e-10
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    61   2e-09
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement         60   3e-09
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...    60   4e-09
Kwal_56.23486                                                          56   9e-08
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    53   2e-07
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      52   1e-06
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...    52   2e-06
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...    51   3e-06
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    49   7e-06
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    49   9e-06
Kwal_26.8458                                                           48   1e-05
Kwal_33.15208                                                          47   1e-05
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    49   2e-05
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    48   2e-05
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    47   2e-05
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    48   2e-05
Scas_637.2                                                             48   2e-05
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    48   2e-05
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    48   3e-05
Scas_666.11                                                            46   4e-05
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    47   4e-05
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         46   4e-05
Scas_565.8                                                             47   5e-05
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    47   5e-05
Scas_635.7                                                             47   5e-05
Kwal_55.21960                                                          47   7e-05
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    47   7e-05
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    47   8e-05
Scas_701.3                                                             46   8e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            46   8e-05
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    46   1e-04
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    46   1e-04
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    46   1e-04
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            46   1e-04
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    46   2e-04
Scas_717.41                                                            45   2e-04
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    45   3e-04
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    45   3e-04
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    44   4e-04
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...    44   4e-04
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    44   5e-04
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    42   7e-04
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    43   7e-04
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    43   9e-04
Scas_598.1                                                             43   0.001
Kwal_56.24709                                                          43   0.001
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         43   0.001
Kwal_27.11832                                                          43   0.001
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    42   0.001
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    42   0.001
Scas_671.4                                                             42   0.001
Scas_558.1                                                             42   0.002
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    42   0.002
Kwal_47.18572                                                          42   0.002
Kwal_0.250                                                             41   0.002
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    42   0.002
Scas_316.1                                                             42   0.002
Kwal_26.7179                                                           42   0.003
Kwal_27.11447                                                          41   0.003
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          41   0.003
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    41   0.003
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    40   0.004
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    41   0.004
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                            41   0.004
Scas_697.10                                                            41   0.005
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    41   0.005
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    40   0.005
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    39   0.005
Kwal_33.14463                                                          40   0.005
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    40   0.005
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    40   0.006
Kwal_0.370                                                             40   0.006
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    40   0.006
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    40   0.007
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    40   0.007
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          40   0.009
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    39   0.009
Scas_696.32                                                            40   0.010
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    40   0.010
Scas_376.1                                                             39   0.011
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    40   0.011
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    40   0.011
Scas_643.16                                                            39   0.012
Kwal_27.11096                                                          38   0.012
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       39   0.013
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    37   0.013
Sklu_905.1 YMR268C, Contig c905 196-1743                               39   0.014
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    39   0.017
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    39   0.018
Kwal_26.7522                                                           38   0.018
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    38   0.020
Scas_665.4                                                             38   0.021
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    38   0.023
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         38   0.027
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    38   0.027
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    38   0.028
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    38   0.028
Kwal_27.10364                                                          38   0.029
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    37   0.032
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    37   0.034
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    37   0.036
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    37   0.041
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    37   0.047
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    37   0.056
KLLA0C08019g complement(704199..705104) some similarities with s...    37   0.058
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         37   0.059
KLLA0D13420g complement(1157491..1157991) some similarities with...    36   0.062
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    36   0.068
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    37   0.076
Kwal_14.1851                                                           37   0.084
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         36   0.094
Kwal_23.5864                                                           36   0.097
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    37   0.10 
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    36   0.10 
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       35   0.11 
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    36   0.12 
Kwal_27.12337                                                          35   0.13 
Kwal_33.13496                                                          36   0.13 
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    36   0.13 
Scas_621.16                                                            36   0.13 
Scas_709.2*                                                            35   0.14 
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    36   0.14 
Kwal_55.20972                                                          34   0.15 
Scas_582.10                                                            35   0.18 
Scas_720.2                                                             35   0.21 
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    35   0.21 
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    35   0.22 
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         34   0.24 
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    35   0.25 
Scas_530.4                                                             35   0.28 
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            34   0.28 
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    35   0.29 
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    34   0.29 
Kwal_56.23945                                                          35   0.37 
Kwal_55.20414                                                          34   0.38 
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    35   0.38 
Kwal_55.21039                                                          33   0.38 
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    35   0.39 
YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear p...    35   0.43 
Kwal_55.20903                                                          33   0.46 
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    34   0.47 
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    34   0.48 
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    34   0.48 
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    34   0.49 
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    33   0.50 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    34   0.67 
Kwal_30.12890                                                          33   0.67 
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    33   0.75 
Scas_714.59                                                            33   0.79 
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    33   0.83 
Scas_611.5*                                                            33   0.97 
Scas_157.1                                                             33   1.0  
Kwal_55.20154                                                          33   1.1  
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    33   1.1  
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          33   1.2  
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    32   1.2  
ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH] complement(...    33   1.2  
Scas_241.1                                                             32   1.3  
KLLA0C07194g 624694..625587 no similarity, hypothetical start          32   1.6  
Scas_645.14                                                            32   1.8  
ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C (R...    32   2.2  
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...    32   2.5  
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    31   2.6  
Scas_701.4                                                             32   2.7  
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    32   3.3  
Sklu_2345.4 YEL015W, Contig c2345 7938-9479 reverse complement         32   3.4  
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    31   3.9  
Scas_591.5*                                                            31   4.6  
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    31   6.1  
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    30   8.4  

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 1513 bits (3916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 755/848 (89%), Positives = 755/848 (89%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
           MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY
Sbjct: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60

Query: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXXXXXXXXXXXX 120
           KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSM                    
Sbjct: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMKEKKREALKRLREKEEKLLE 120

Query: 121 XXXXXXXVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEEQ 180
                  VQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEEQ
Sbjct: 121 EKNKKLKVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEEQ 180

Query: 181 ELDDEESSNVNPLLKHALSMKKGDENDSDDEYMSFNNADSKAGSDESNEEEKMISLSELP 240
           ELDDEESSNVNPLLKHALSMKKGDENDSDDEYMSFNNADSKAGSDESNEEEKMISLSELP
Sbjct: 181 ELDDEESSNVNPLLKHALSMKKGDENDSDDEYMSFNNADSKAGSDESNEEEKMISLSELP 240

Query: 241 VQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQDKESEENSQ 300
           VQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQDKESEENSQ
Sbjct: 241 VQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQDKESEENSQ 300

Query: 301 ATPAXXXXXXXXXXXQAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDT 360
           ATPA           QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDT
Sbjct: 301 ATPAEELQEEIPDEEQAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDT 360

Query: 361 RTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLK 420
           RTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLK
Sbjct: 361 RTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLK 420

Query: 421 KQRELXXXXXXXXXTFSWNSLYMNQDAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEA 480
           KQREL         TFSWNSLYMNQDAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEA
Sbjct: 421 KQRELKKKAAASKATFSWNSLYMNQDAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEA 480

Query: 481 HVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLER 540
           HVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLER
Sbjct: 481 HVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLER 540

Query: 541 LLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHD 600
           LLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHD
Sbjct: 541 LLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHD 600

Query: 601 EEKSAKEAGPSSADLLXXXXXXXXXXXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRF 660
           EEKSAKEAGPSSADLL                    GPTVSIFIKNLNFKTTSQQLTDRF
Sbjct: 601 EEKSAKEAGPSSADLLESVSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRF 660

Query: 661 KVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKL 720
           KVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKL
Sbjct: 661 KVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKL 720

Query: 721 SHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGF 780
           SHRQGNAGSQE             LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGF
Sbjct: 721 SHRQGNAGSQEKKKAKNGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGF 780

Query: 781 AFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPXXXXXXXXXXXXXRMTKKVRKQAAVSEI 840
           AFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP             RMTKKVRKQAAVSEI
Sbjct: 781 AFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAEQEAANAEEELERMTKKVRKQAAVSEI 840

Query: 841 AAMTRNAG 848
           AAMTRNAG
Sbjct: 841 AAMTRNAG 848

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/885 (59%), Positives = 637/885 (71%), Gaps = 50/885 (5%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDG----LITDLRILKNREGKSRRFA 56
           MSR+IVKGLP+YLT+  L++HF KRL   H+   V+G    LITD++IL++R G+SRRF 
Sbjct: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60

Query: 57  FIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXXXXXXXX 116
           FIGY+NE+DA DAV YF+GSFI TSKIEV MAKSFADPRVP+ M                
Sbjct: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120

Query: 117 XXXXXXXXXXXVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGL 176
                        D     NID EI K+KQL+EF+ETMKPS+Q +SW+K+      +  +
Sbjct: 121 KLLQEENRKKKKVDENKHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVG----IDKSI 176

Query: 177 AEEQELDDEESSNV--NPLLKHALSMKKGD----------ENDSDDEYMSFN-NADSKAG 223
            +E+   +EE S+V  N LL HAL++K+ +          EN+SDDEY + N N D    
Sbjct: 177 EDEKLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDE--D 234

Query: 224 SDESNEEEKMISLSELP-----VQNEESSAEPKEDD---GLAKNEEISDMDWIKQRRVRI 275
            +++ EEEKMIS+S L      + N++++++ KE++    LA++E++SD+DW KQRRVRI
Sbjct: 235 QEDAGEEEKMISISNLKDTDIGLVNDDANSDEKENEKRRNLAQDEKVSDLDWFKQRRVRI 294

Query: 276 RENGEKVGEE---FAT----NVQDKESEENSQATPAXXXXXXXXXXXQAIAKIQKTGRLF 328
           +E+  +  E+   +AT    ++  K+ E+  +A P             AI KI +TGRLF
Sbjct: 295 KESEAETREKSSSYATEQNESLDTKKEEQPERAVPQKTDEEL------AIEKINQTGRLF 348

Query: 329 LRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDK 388
           LRNILY+S E+DF+KLFSP+GEL+EVHVA+DTRTG SKGFAYVLF   + AV AY+ELDK
Sbjct: 349 LRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVELDK 408

Query: 389 QIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQDAV 448
           QIFQGRLLHIL  +E K HRLDEFDLKNMPLKKQ+EL         TFSWNSLYMNQDAV
Sbjct: 409 QIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQDAV 468

Query: 449 LGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQ 508
           LGSVAAKLG++K+ LID ENS+SAVKQALAEAHVIGDVRKYFE+KGVDLTKFS LKS +Q
Sbjct: 469 LGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKSTNQ 528

Query: 509 RDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLA 568
           RDD+VILVKNFPFGTTREELGE+F+P+GKLERLLMPPAGTIAIVQFRD  S R+AF+KL+
Sbjct: 529 RDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFTKLS 588

Query: 569 FKRFKGTVIYLEKGPKDCFTKAASNEDAMEH---DEEKSAKEAGPSSADLLXXXXXXXXX 625
           +KRFK  +IYLE+GPKDCFTK A  +D + +    EE++  E  PSS DL+         
Sbjct: 589 YKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEG 648

Query: 626 XXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLS 685
                      GPTVSIFIKNLNF TT+Q LTDRFKVF+GFVVAQVKTKPDPK + K LS
Sbjct: 649 SSNAHDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLS 708

Query: 686 MGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQG--NAGSQEXXXXXXXXXXXX 743
           MGFGFVEFRTKEQA AVI+AMDGTVIDGHKIQLKLSHRQ   +  ++             
Sbjct: 709 MGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIVK 768

Query: 744 XLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
            LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEF+LPKEAENAMDQL GVHL
Sbjct: 769 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHL 828

Query: 804 LGRRLVMQPXXXXXXXXXXXXXRMTKKVRKQAAVSEIAAMTRNAG 848
           LGRRLVMQ              RMTKKVRKQ A +E+AA+ RN G
Sbjct: 829 LGRRLVMQYAEEDAVDAEEEIARMTKKVRKQVATNEMAAL-RNGG 872

>Scas_705.22
          Length = 869

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/878 (60%), Positives = 619/878 (70%), Gaps = 57/878 (6%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
           MSR+IVKGLP +LT+  L++HF KRL  TH    ++ LITD++IL+NREG+SR+FAFIGY
Sbjct: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60

Query: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXX-XXXXXXXXX 119
            NE+DA DAVNYF+GS+I T+K+EV MAKSFADPRVP+ M                    
Sbjct: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120

Query: 120 XXXXXXXXVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEE 179
                   V++ + +++IDAEI K+KQL+EFIETMKPS+Q  SW+K      P S    E
Sbjct: 121 ESDKKKQKVKEKERRLSIDAEISKNKQLQEFIETMKPSSQVPSWEK------PVSHKNAE 174

Query: 180 QELDDEESSNVNPLLKHALSMKKGD--------ENDSDDEYMSFNNADSKAGSDESNEEE 231
           +  D+EESS  NPLL  AL +  GD        EN+SDDEY  FN    K   DE  E+E
Sbjct: 175 E--DNEESS--NPLL--AL-LNNGDDDKKPLLKENESDDEYADFN----KDQKDE-QEDE 222

Query: 232 KMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQ 291
            M+ L +L           +EDD LA++E++SD++W KQRRVRIRE     GE  A    
Sbjct: 223 PMMKLDDLNTTETTEKKT-REDDHLAQDEKVSDLNWFKQRRVRIRE-----GESEAAKPS 276

Query: 292 DKESEENSQATPAXXXXXXXXXXXQ-----------------AIAKIQKTGRLFLRNILY 334
               E N++   +                             A+ KI KTGRLFLRNILY
Sbjct: 277 SLSKEGNTEGNASLKENTDSENKNDEEEKKEEQEPQQTPEDIAMEKISKTGRLFLRNILY 336

Query: 335 SSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGR 394
           ++TEDDF+KLF P+GEL+EVHVA+DTRTG SKGFAY+LF  P+EAVQAYIELDKQIFQGR
Sbjct: 337 TTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGR 396

Query: 395 LLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQDAVLGSVAA 454
           LLHIL AD  K HRLDEFDLKNMPLKKQREL         TFSWNSLYMNQDAVLGSVAA
Sbjct: 397 LLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAA 456

Query: 455 KLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVI 514
           KLG++K+DLIDPE+SNSAVKQALAEAH+IGDVRKYFE+KGVDLTKF+  KSP QRD +VI
Sbjct: 457 KLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVI 516

Query: 515 LVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKG 574
           LVKNFP+GTTREE+GELF+PFGKL+RLLMPP+GTIAIV++RD  SGRSAF+KLAFKRFK 
Sbjct: 517 LVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKD 576

Query: 575 TVIYLEKGPKDCFTKAASNEDAMEHDE-EKSAKEAGPSSADLLXXXXXXXXXXXXXXXXX 633
            +IYLEKGPKDCFT+ A   D +E D  E++  E   +  +++                 
Sbjct: 577 GIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIM--DSTDKTSNEEHEDEH 634

Query: 634 XXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEF 693
              GPTVSIFIKNLNF TTS +L+ RFK FSGFVVAQVKTKPDPK  +K LSMGFGF EF
Sbjct: 635 VADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEF 694

Query: 694 RTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAG---SQEXXXXXXXXXXXXXLPFEAT 750
           RTKEQA AVISA+DGTVIDGH+IQLKLSHRQG++    S +             LPFEAT
Sbjct: 695 RTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEAT 754

Query: 751 RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
           RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEF+LPKEAENAMDQLQGVHLLGRRLVM
Sbjct: 755 RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

Query: 811 QPXXXXXXXXXXXXXRMTKKVRKQAAVSEIAAMTRNAG 848
           Q              RMTKKV+KQ   SE+AA+ RN+G
Sbjct: 815 QYAQEEAADAEEEIARMTKKVKKQVVSSELAAL-RNSG 851

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/880 (56%), Positives = 614/880 (69%), Gaps = 51/880 (5%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
           MSRVIVKGLPIYL E  L+    KRL   H +++V   ++D++++KNR+G+SRRFAFIG+
Sbjct: 1   MSRVIVKGLPIYLKEDRLRDLIEKRLTQKHQSTDVQSYLSDVKLMKNRDGESRRFAFIGF 60

Query: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXXXXXXXXXXXX 120
           ++E+DA D VNYF+G+F+ TSKIEV MAKSFADPRVP+ M                    
Sbjct: 61  RDEEDAFDCVNYFNGTFVDTSKIEVSMAKSFADPRVPQPMREKRREALKRLREREELLLA 120

Query: 121 XXXXXXXV------QDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPES 174
                          D   K +IDAEI K+KQL+EFI TMKPS+Q +SW    ET +   
Sbjct: 121 DKKDSQKKQKSDSNNDGGKKHDIDAEIAKNKQLQEFINTMKPSSQVTSW----ETVQSSK 176

Query: 175 GLAEEQELDDEESSNV--NPLLKHALSMK----KGDE---------NDSDDEYMSFNNAD 219
              E++E  D+E   +  NPLL  AL++K      DE         N+SDDEY+S N   
Sbjct: 177 TQGEDEEAADDEVGEMSSNPLLSQALALKGNSRDADEDTDMFKLPGNESDDEYVSLNGGS 236

Query: 220 SKAGSDESNEEEKMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENG 279
           + A +DE   E +M+SL          +A P   D +AK+E +SD+DW+K RRVRI++  
Sbjct: 237 NNANTDEP--EPQMMSLDTF------DTAGPTSTDDMAKDEAVSDLDWLKNRRVRIKDGA 288

Query: 280 EK-VGEEFATNVQDKESEENSQATPAXXXXXXXXXXXQAIAKIQKTGRLFLRNILYSSTE 338
           +  V ++      +++  E ++   +           +++ KI++TGRLFLRNILY++TE
Sbjct: 289 DTPVSKQQQQPDTEQQQPEETEVETS-----QESEEEKSLKKIRETGRLFLRNILYTATE 343

Query: 339 DDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           DDF+KLFSPYGEL+EVH+AVDTRTG SKGFAYVLF   + A  A++ELDKQIFQGRLLHI
Sbjct: 344 DDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVELDKQIFQGRLLHI 403

Query: 399 LAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQDAVLGSVAAKLGV 458
           L AD  K H+LDEFDLKN+PLKKQREL         TFSWNSLYMNQDAVL SVA KLG+
Sbjct: 404 LPADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSLYMNQDAVLSSVADKLGM 463

Query: 459 QKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKN 518
           +K++LID ENS+SAVKQALAEA VIGDVRK+FET+GVDLTKF+ LK+ S+RDDRVILVKN
Sbjct: 464 KKSELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLTKFAQLKN-SERDDRVILVKN 522

Query: 519 FPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIY 578
           FP+GTTREE+ ELF+PFGKL+RLL+PP+GTIAI+QFRD+ + R+AFSK+++KRFK  +IY
Sbjct: 523 FPYGTTREEIAELFLPFGKLQRLLLPPSGTIAILQFRDVPAARAAFSKISYKRFKDGIIY 582

Query: 579 LEKGPKDCFTKAASNEDAMEHD---EEKSAKEAGPSSADLLXXXX----XXXXXXXXXXX 631
           LEKGP DCFT+ A  ++ +E +   ++ +AKEA  S ADLL                   
Sbjct: 583 LEKGPSDCFTRDAQGDELVESETDIQKATAKEAKISGADLLEAQSLPAADKDDHDDDDDD 642

Query: 632 XXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFV 691
                GPTVSIFIKNLNF TTSQQLT++FK F+GFVVAQVKTKPDPKQ  K LSMGFGF 
Sbjct: 643 DDVQAGPTVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFA 702

Query: 692 EFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXX---XXLPFE 748
           EF+TKEQA AVISAM+GT++DGHK+QLKLSHRQG + +                  LPFE
Sbjct: 703 EFKTKEQANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFE 762

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           ATRKDVFELF+SFGQLKSVRVPKKFDKSARGFAFVEF+LPKEAENAMDQLQGVHLLGRRL
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 822

Query: 809 VMQPXXXXXXXXXXXXXRMTKKVRKQAAVSEIAAMTRNAG 848
           VM+              +MT+KV+KQ   ++IA M RN+G
Sbjct: 823 VMEFVEQDPEDVEQQIEKMTRKVKKQVNTTKIANM-RNSG 861

>Kwal_23.3985
          Length = 876

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/872 (54%), Positives = 595/872 (68%), Gaps = 39/872 (4%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
           MSRVIVKG+P YLTE +L+ HF KRL T H   N+   +TD++ILKNR G+SRRFAF+G+
Sbjct: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60

Query: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXXXXXXXXXXXX 120
           K+E+DA DAVNYFD SFI TSKIEV MAKSFADPRVP+ M                    
Sbjct: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120

Query: 121 XXXXXXXVQDT-KSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEE 179
                   Q    +K N+DAEI+ + QL+EF++TMKPSAQ +SWD +    +  +   + 
Sbjct: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAAN---DA 177

Query: 180 QELDDEESSNVNPLLKHALSMKKGD--------ENDSDDEYMSFNNADSKAGSDESNEEE 231
           Q     ++   N LL  AL+MK G+        EN+SDDEY   NN  +  G+++  EEE
Sbjct: 178 QNTVSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKANDGGNEDGGEEE 237

Query: 232 KMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEK--------VG 283
           +M+ L +          E K  + +A++E++SD +W+KQ R+RI+EN E         V 
Sbjct: 238 QMVKLDDF---------EDKTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVT 288

Query: 284 EEFATNVQDK---ESEENSQATPAXXXXXXXXXXXQAIAKIQKTGRLFLRNILYSSTEDD 340
               ++++++   ES E+ ++T             + I KI+ TGRLFLRNILY++TEDD
Sbjct: 289 ARPKSDIREEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDD 348

Query: 341 FKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILA 400
           F+KLF+P+GEL+EVHVA+DTRTG SKGFAYV+F  P +A  AY+ELDKQIFQGRLLHIL 
Sbjct: 349 FRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILP 408

Query: 401 ADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQDAVLGSVAAKLGVQK 460
            ++ K HRLDEFDLKN+PLKKQR L         TFSWNSLYMNQDAVLGSVAAKLGVQK
Sbjct: 409 GEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVAAKLGVQK 468

Query: 461 ADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFP 520
           +DLID  ++++AVKQALAEAHVIGDVRKYFE+KG+DLTKF   KSPS RDD V+LVKNFP
Sbjct: 469 SDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKNFP 528

Query: 521 FGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLE 580
           FGTT  EL +LF+PFGKL+RLL+PPA TIA+VQ+RD  S R+AFSKL++KRFK  ++YLE
Sbjct: 529 FGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFKDGILYLE 588

Query: 581 KGPKDCFTKAASNEDAMEHD---EEKSAKEAGPSSADLLXXXXXXXXXXXXXXXXXXXXG 637
           KGPK+CF++    ++ M  +   +  + KEA  +  +++                     
Sbjct: 589 KGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTDDVVDG-- 646

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           PTVSIF+KNLNF TT ++LT++FK F GFVVAQVKTKPDPK  NK LSMGFGF EF+T+E
Sbjct: 647 PTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTRE 706

Query: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXX-XXXXLPFEATRKDVFE 756
           QA AVI AMDG V+DGH+IQLKLSHRQG   S                LPFE  RK +FE
Sbjct: 707 QALAVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFE 766

Query: 757 LFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPXXXX 816
           LF+SFGQLKSVR+PKKFDKSARGFAFVEF+LPKEAENAM+QLQGVHLLGRRLVMQ     
Sbjct: 767 LFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEE 826

Query: 817 XXXXXXXXXRMTKKVRKQAAVSEIAAMTRNAG 848
                    RMTKKVR Q    E AA+ RN G
Sbjct: 827 PQDAEEQIARMTKKVRSQVTTREHAAL-RNGG 857

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/859 (55%), Positives = 575/859 (66%), Gaps = 49/859 (5%)

Query: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
           MSRVIVKGLPIYL E  L+ HF KRL      S  +  ITD++I+K++ G SRRFAFIGY
Sbjct: 1   MSRVIVKGLPIYLEEARLRAHFLKRLQQQGRGS--EDQITDVKIVKDKSGNSRRFAFIGY 58

Query: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMXXXXXXXXXXXXXXXXXXXX 120
           ++EQDA DA+ YF+GSFI T++IEV MAKSFADPRVP  M                    
Sbjct: 59  RSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKRREALKRLREREDRILA 118

Query: 121 XXXXXXXVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEEQ 180
                   + TK +  IDAEI K+KQL+EFIETM P    ++ + +   AE         
Sbjct: 119 EKRQ----KQTKPQHGIDAEISKNKQLQEFIETMNPKMAAAAANPMARAAE--------- 165

Query: 181 ELDDEESSNVNPLLK--HA------LSMKKGDENDSDDEYMSFNNADSKAGSDESNEEEK 232
                + ++ NPLL   H       + M +  E +SDDEY   +     A  DE  E   
Sbjct: 166 -----QPASANPLLSALHGAEDDEEVDMFQLSEQESDDEYTDLHQRPQSAEEDELEEPAV 220

Query: 233 MISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQD 292
              L         + A    +DG+A N+E+SD++W+K RR+RIR+     GE+       
Sbjct: 221 GQDLDA-------APAPDAAEDGMATNQEVSDLEWLKNRRIRIRD-----GEDAEAAPAP 268

Query: 293 KESEENSQATPAXXXXXXXXXXXQAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELK 352
           +E      A               A+ KI+ TGRLFLRNILY +TE+DFK+LFSPYGEL+
Sbjct: 269 QEQAAEEPAEQEVPQEDEVSAEEAALTKIRATGRLFLRNILYDATEEDFKQLFSPYGELE 328

Query: 353 EVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKDHRLDEF 412
           EVHVAVDTRTG SKGFAYVLF  PE A  AYIELDKQIFQGRLLHIL AD  K HRLDEF
Sbjct: 329 EVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIELDKQIFQGRLLHILPADAKKTHRLDEF 388

Query: 413 DLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQDAVLGSVAAKLGVQKADLIDPENSNSA 472
           DLKN+PLKKQREL         TFSWNSL+MNQDAVL SVAAKLG++K+ LIDPENS SA
Sbjct: 389 DLKNLPLKKQRELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSA 448

Query: 473 VKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELF 532
           VKQALAEAHVIGDVRKYFE +GVDLT+F   K  ++RDDR+ILVKNFP GTTREEL ELF
Sbjct: 449 VKQALAEAHVIGDVRKYFEARGVDLTQFEKFKKVTERDDRIILVKNFPHGTTREELAELF 508

Query: 533 VPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAAS 592
           +PFGK+ER+LMPP+GTIAI+Q+RD+ + R AF+KL++KRFK  ++YLEKGPKDCF++   
Sbjct: 509 LPFGKIERMLMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPR 568

Query: 593 NEDAMEHDEE-KSAKEAGPSSADLLXXXXXXXXXXXXXXXXXXXXGPTVSIFIKNLNFKT 651
            ++ +E D   +  KE   S  D++                    GPTVSIF+KNLNF T
Sbjct: 569 GDELLEGDAAPEDVKEIKKSVEDVM-----DADSKTPSSEATAIDGPTVSIFVKNLNFST 623

Query: 652 TSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVI 711
           TS QL ++FK FSGFVVAQVKTKPDPK  +K LSMGFGF+EFRTKEQA AVI+AMDG VI
Sbjct: 624 TSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVI 683

Query: 712 DGHKIQLKLSHRQGN--AGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRV 769
           DGHKIQLK+SH+Q +    S+              LPFEATRKDVFELF+SFGQLKSVRV
Sbjct: 684 DGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRV 743

Query: 770 PKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPXXXXXXXXXXXXXRMTK 829
           PKKFDKSARGFAFVEF+LP EAENAMDQLQGVHLLGRRLVMQ              +MT 
Sbjct: 744 PKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESDDVEEQISKMTM 803

Query: 830 KVRKQAAVSEIAAMTRNAG 848
           K++KQAAVS++ A+ RN+G
Sbjct: 804 KMKKQAAVSKMGAL-RNSG 821

>Scas_88.1
          Length = 256

 Score =  371 bits (952), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 178/245 (72%), Positives = 205/245 (83%), Gaps = 2/245 (0%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           RLF+  I       DF +LFSPYGEL+EVHVA+DTRTG SKGFAY++F  PE AV AYIE
Sbjct: 2   RLFVHFIHCKGI--DFXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 386 LDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQ 445
           LDKQIFQGRLLHIL A+  K HRLDEFDLKN+PLKKQREL         TFSWNSLYMNQ
Sbjct: 60  LDKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKRKANASQQTFSWNSLYMNQ 119

Query: 446 DAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKS 505
           DAVL SVA+KLG++K++LIDP NS SAVKQALAEAHVIGDVRK+FE++GVDLTKF   KS
Sbjct: 120 DAVLSSVASKLGMEKSELIDPTNSGSAVKQALAEAHVIGDVRKFFESRGVDLTKFVEYKS 179

Query: 506 PSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFS 565
           PS+RD+ V+LVKNFPFGTT+EEL ELF+PFGKL+RLLMPPAGTIAIVQFRD+ + R+AF+
Sbjct: 180 PSERDECVMLVKNFPFGTTKEELAELFLPFGKLQRLLMPPAGTIAIVQFRDMTAARAAFT 239

Query: 566 KLAFK 570
           K+  K
Sbjct: 240 KIPTK 244

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 84/183 (45%), Gaps = 14/183 (7%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   ++F+  L++    + L   F+   G V A+V       ++    S G+G+V+F  K
Sbjct: 173 GEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMY-----ERGTDRSRGYGYVDFEDK 227

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX--------XLPFE 748
             A   +  M G  IDG  I + +S  +     +E                     L F 
Sbjct: 228 SYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFN 287

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
           A R +++E+F  FG++ SVR+P   + +  +GF +V++    +A+ A++ LQG ++  R 
Sbjct: 288 ADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRP 347

Query: 808 LVM 810
           + +
Sbjct: 348 VRL 350

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F      + + F  F   +  ++ T P+ +Q       GFG+V++ + +
Sbjct: 275 PSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPK-----GFGYVQYTSID 329

Query: 698 QATAVISAMDGTVIDGHKIQLKLS 721
            A   + A+ G  ID   ++L  S
Sbjct: 330 DAKKALEALQGEYIDNRPVRLDYS 353

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LFL N+ +++  D+  ++F  +GE+  V +     T   KGF YV +   ++A +A   L
Sbjct: 279 LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

Query: 387 DKQIFQGRLLHI 398
             +    R + +
Sbjct: 339 QGEYIDNRPVRL 350

>Scas_621.10
          Length = 415

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 85/178 (47%), Gaps = 13/178 (7%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   +IF+  L++    + L   F+   G V A+V       ++    S G+G+V+F  K
Sbjct: 159 GEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIM-----ERGTDRSRGYGYVDFEDK 213

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXX-------XXXXXXXXXXXLPFEA 749
             A   I  M G  IDG +I + +S  +  AG+ +                    L F A
Sbjct: 214 SYAEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNA 273

Query: 750 TRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
            R  + ELF+ +G++ SVR+P   + +  +GF +V++   ++A+ A++ LQG ++  R
Sbjct: 274 DRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNR 331

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LFL N+ +++  D   +LFS YGE+  V +     T   KGF YV +   E+A +A   L
Sbjct: 264 LFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

Query: 387 DKQIFQGRLLHI 398
             +    R + +
Sbjct: 324 QGEYIDNRPVRL 335

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F      +++ F  +   +  ++ T P+ +Q       GFG+V++   E
Sbjct: 260 PSETLFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPK-----GFGYVQYTNVE 314

Query: 698 QATAVISAMDGTVIDGHKIQLKLS 721
            A   +  + G  ID   ++L  S
Sbjct: 315 DAKKALEGLQGEYIDNRPVRLDYS 338

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + +S  ++  KK F   G +    V ++  T  S+G+ YV F     A +A  E+
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 387 DKQIFQGRLLHI 398
             +   GR +++
Sbjct: 224 QGKEIDGREINV 235

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 83/179 (46%), Gaps = 14/179 (7%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            +IF+  L++    + L   F+   G + A+V       ++    S G+G+V+F  K  A
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIY-----ERGTDRSRGYGYVDFENKSYA 222

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXX-------LPFEATRK 752
              I  M G  IDG  I   +S  +  AG+ +                    L F A R 
Sbjct: 223 EKAIQEMQGKEIDGRPINCDMSTSK-PAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRD 281

Query: 753 DVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
            +FELF   G++ SVR+P   + +  +GF +V+F   ++A+ A+D LQG ++  R + +
Sbjct: 282 AIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F      + + F      V  ++ T P+ +Q       GFG+V+F   E
Sbjct: 265 PSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQ-----PKGFGYVQFSNME 319

Query: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGN 726
            A   + A+ G  ID   ++L  S  + N
Sbjct: 320 DAKKALDALQGEYIDNRPVRLDFSSPRPN 348

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LFL N+ +++  D   +LF+ +GE+  V +     T   KGF YV F+  E+A +A   L
Sbjct: 269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

Query: 387 DKQIFQGRLLHI 398
             +    R + +
Sbjct: 329 QGEYIDNRPVRL 340

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 83/183 (45%), Gaps = 14/183 (7%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   +IF+  L++    + L   F+   G + A+V       ++    S G+G+V+F  K
Sbjct: 193 GEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMY-----ERGTDRSRGYGYVDFEDK 247

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX--------XLPFE 748
             A   I  M G  IDG  I   +S  +     ++                     L FE
Sbjct: 248 SYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFE 307

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
           A R +++E+F  +G++ SVR+P   + +  +GF +V++   ++A  A + LQG ++  R 
Sbjct: 308 ADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRP 367

Query: 808 LVM 810
           + +
Sbjct: 368 VRL 370

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LFL N+ + +  D+  ++F  YGE+  V +     T   KGF YV +   E+A +A+  L
Sbjct: 299 LFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

Query: 387 DKQIFQGRLLHI 398
             +    R + +
Sbjct: 359 QGEYINNRPVRL 370

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F+     L + F  +   V  ++ T P+ +Q       GFG+V++ + E
Sbjct: 295 PSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPK-----GFGYVQYGSIE 349

Query: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQE 731
            AT     + G  I+   ++L  S  + N G+ +
Sbjct: 350 DATKAFEGLQGEYINNRPVRLDYSIPKQNFGNNQ 383

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + +S  ++  K  F P G +    V  +  T  S+G+ YV F     A +A  E+
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 387 DKQIFQGRLLHI 398
             +   GR ++ 
Sbjct: 258 HGKEIDGRPINC 269

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 79/179 (44%), Gaps = 14/179 (7%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   +IF+  L++    + L   F    G V A+V       ++    S G+G+V+F   
Sbjct: 164 GQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIY-----ERGTDKSRGYGYVDFEDV 218

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX--------XLPFE 748
             A   +  M G  IDG  I   +S  +  +  +E                     L F 
Sbjct: 219 SYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFN 278

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           A R  +FELF+  G + SVR+P   + +  +GF +V++   +EA+ A+D LQG ++  R
Sbjct: 279 ADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNR 337

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F      L + F      +  ++ T P+  Q       GFG+V++ + E
Sbjct: 266 PSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPK-----GFGYVQYGSVE 320

Query: 698 QATAVISAMDGTVIDGHKIQLKLS 721
           +A A + A+ G  ID   +++  S
Sbjct: 321 EAQAALDALQGEYIDNRPVRIDFS 344

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           Q +  LFL N+ +++  D   +LFS +G +  V +     +   KGF YV +   EEA  
Sbjct: 265 QPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQA 324

Query: 382 AYIELDKQIFQGRLLHI 398
           A   L  +    R + I
Sbjct: 325 ALDALQGEYIDNRPVRI 341

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 14/179 (7%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   +IF+  L++    + L   F    G V A+V       ++    S G+G+V+F  K
Sbjct: 170 GEPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIY-----ERGSDRSRGYGYVDFEDK 224

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX--------XLPFE 748
             A   +  M G  IDG  I   +S  +  A  ++                     L F 
Sbjct: 225 HYAEKAVKEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFN 284

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           A R ++FE+F+  G++ SVR+P   + +  +GF +V++    +A+ A + LQG ++  R
Sbjct: 285 ADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNR 343

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           Q +  LFL N+ +++  D+  ++FS +GE+  V +     T   KGF YV +   ++A +
Sbjct: 271 QPSDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKK 330

Query: 382 AYIELDKQIFQGRLLHI 398
           A+  L  +    R + +
Sbjct: 331 AFEALQGEYIDNRPVRL 347

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 6/90 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+ ++F+ NL+F      L + F      +  ++ T P+ +Q       GFG+V++ + +
Sbjct: 272 PSDTLFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPK-----GFGYVQYGSID 326

Query: 698 QATAVISAMDGTVIDGHKIQLKLS-HRQGN 726
            A     A+ G  ID   ++L  S  RQ N
Sbjct: 327 DAKKAFEALQGEYIDNRPVRLDYSIPRQNN 356

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 83/172 (48%), Gaps = 9/172 (5%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +IFIKNL+    ++ L D F VF   + ++V T    K K      GFG+V F   E A+
Sbjct: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSK------GFGYVHFEEDESAS 177

Query: 701 AVISAMDGTVIDGHKIQL--KLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF 758
             I A++G +++G +I +   LS ++  +  +E             +  E T K+  EL 
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKN-INTETTDKEFEELV 236

Query: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
             FG+  SV + +  +   +GF FV FV  ++A   +++L      G+ L +
Sbjct: 237 AKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYV 288

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 90/409 (22%), Positives = 159/409 (38%), Gaps = 53/409 (12%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +  L++ ++  S +E     +FSP G +  + V  D  T  S G+AYV F   + A  A 
Sbjct: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93

Query: 384 IELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYM 443
            +L+    +G+L  I+ +   +D  L +    N+ +K              TFS     +
Sbjct: 94  EKLNFTPIKGKLCRIMWSQ--RDPSLRKKGAGNIFIKNLHP-DIDNKALYDTFSVFGNIL 150

Query: 444 NQDAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGD---VRKYFETKGVDLTKF 500
           +            G       + E+++ A+  AL    + G    V  +   K  + +KF
Sbjct: 151 SSKVATDETGKSKGFGYVHFEEDESASEAI-DALNGMLLNGQEIYVGPHLSKKERE-SKF 208

Query: 501 SNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLM--PPAG---TIAIVQFR 555
             +K+    +   + +KN    TT +E  EL   FGK + +++   P G       V F 
Sbjct: 209 EEMKA----NFTNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENKGFGFVNFV 264

Query: 556 DIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADL 615
           +         +L    FKG  +Y+ +  K    +    +       EK AK  G      
Sbjct: 265 NHEDAVKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQG------ 318

Query: 616 LXXXXXXXXXXXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKP 675
                                   +++FIKNL+     ++L + F  +     A+V T  
Sbjct: 319 ------------------------INLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTE 354

Query: 676 DPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
           + K K      GFGFV F T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 355 NGKSK------GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 3/91 (3%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  +   ++ F+PYG +    V + T  G SKGF +V F+ PE
Sbjct: 313 MAKYQGI-NLFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFSTPE 370

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 371 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 400

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 10/174 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           + S+++ +L+   +   L D F       V+ ++   D   K    S+G+ +V F   + 
Sbjct: 34  SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRDAITKT---SLGYAYVNFNDHDA 88

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF 758
           A   I  ++ T I G   ++  S R                     L  +   K +++ F
Sbjct: 89  AKTAIEKLNFTPIKGKLCRIMWSQR-----DPSLRKKGAGNIFIKNLHPDIDNKALYDTF 143

Query: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
           + FG + S +V       ++GF +V F   + A  A+D L G+ L G+ + + P
Sbjct: 144 SVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAIDALNGMLLNGQEIYVGP 197

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 74/183 (40%), Gaps = 19/183 (10%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            +++IKN+N +TT ++  +    F       V  +  P+ +NK    GFGFV F   E A
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGK--TDSVVLERTPEGENK----GFGFVNFVNHEDA 269

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATR-------- 751
              +  ++ T   G  + +  + ++     QE               ++           
Sbjct: 270 VKCVEELNNTEFKGQPLYVNRAQKKYER-QQELKKQYEATRMEKMAKYQGINLFIKNLDD 328

Query: 752 ----KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
               K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ +     + G+ 
Sbjct: 329 SIDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388

Query: 808 LVM 810
           L +
Sbjct: 389 LYV 391

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 79/171 (46%), Gaps = 7/171 (4%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +IFIKNL+    ++ L D F VF   + +++ T  + K K      GFGFV F  +  A 
Sbjct: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSK------GFGFVHFEEEGAAK 180

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EXXXXXXXXXXXXXLPFEATRKDVFELFN 759
             I A++G +++G +I +     +    SQ E             +  E T +   ELF 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
            FG + S  + K  D   +GF FV +   ++A  A++ L    L G +L +
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 3/91 (3%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  ++ F+PYG +    V + T  G SKGF +V F+ PE
Sbjct: 316 MAKYQGV-NLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFSTPE 373

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 374 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 403

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 80/182 (43%), Gaps = 17/182 (9%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++++KN+N +TT +Q  + F  F   V A ++   D K K      GFGFV +   E A
Sbjct: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLK------GFGFVNYEKHEDA 272

Query: 700 TAVISAMDGTVIDGHKI----------QLKLSHRQGNAGSQEXXXXXXXXXX-XXXLPFE 748
              + A++ + ++G K+          ++ +  +Q  A   E              L   
Sbjct: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
              + + E F  +G + S +V +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392

Query: 809 VM 810
            +
Sbjct: 393 YV 394

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 71/174 (40%), Gaps = 10/174 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           + S+++ +L    +   L D F       V+ ++   D   K    S+G+ +V F   E 
Sbjct: 37  SASLYVGDLEPSVSEAHLYDIFSPIGS--VSSIRVCRDAITKT---SLGYAYVNFNDHEA 91

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF 758
               I  ++ T I G   ++  S R                     L  +   K +++ F
Sbjct: 92  GRKAIEQLNYTPIKGRLCRIMWSQR-----DPSLRKKGSGNIFIKNLHPDIDNKALYDTF 146

Query: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
           + FG + S ++    +  ++GF FV F     A+ A+D L G+ L G+ + + P
Sbjct: 147 SVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP 200

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V++F+KNL+     ++L + F  +     A+V    + K K      GFGFV F T E+A
Sbjct: 322 VNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGKSK------GFGFVCFSTPEEA 375

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQ 724
           T  I+  +  ++ G  + + ++ R+
Sbjct: 376 TKAITEKNQQIVAGKPLYVAIAQRK 400

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +  L++ ++  S +E     +FSP G +  + V  D  T  S G+AYV F   E   +A 
Sbjct: 37  SASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAI 96

Query: 384 IELDKQIFQGRLLHIL 399
            +L+    +GRL  I+
Sbjct: 97  EQLNYTPIKGRLCRIM 112

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           L+++NI   +T++ F++LF+ +G +    +  D   G  KGF +V + K E+AV+A   L
Sbjct: 221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEAL 279

Query: 387 DKQIFQGRLLHILAADEMKDHRL 409
           +     G  L++  A + K+ R+
Sbjct: 280 NDSELNGEKLYVGRA-QKKNERM 301

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%)

Query: 37  GLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89
           G I    + K+ +GK + F F+ Y+  +DA+ AV   + S +   K+ V  A+
Sbjct: 243 GPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQ 295

>Scas_576.7
          Length = 575

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 80/171 (46%), Gaps = 7/171 (4%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +IFIKNL+    ++ L + F VF   + +++ T    K K      GFGFV F  +  A 
Sbjct: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSK------GFGFVHFEHESSAK 177

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EXXXXXXXXXXXXXLPFEATRKDVFELFN 759
             I A++G +++G +I +     +    SQ E             +  E T ++  ELF 
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFA 237

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
            +G + S  + K  D   +GF FV+F   ++A  A+++L G     + L +
Sbjct: 238 KYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFV 288

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 3/91 (3%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  K+ F+PYG +  V V + T  G SKGF +V F+ PE
Sbjct: 313 MAKYQGV-NLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFSTPE 370

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 371 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 400

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 77/183 (42%), Gaps = 19/183 (10%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++++KN+N +TT ++  + F  +   + + ++   D K K      GFGFV+F   E A
Sbjct: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK------GFGFVDFEKHEDA 269

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFEL-- 757
              +  ++GT      + +  + ++     QE               ++     V  L  
Sbjct: 270 AKAVEELNGTEFKDQTLFVSRAQKKYER-MQELKKQYEASRLEKMAKYQGVNLFVKNLDD 328

Query: 758 ----------FNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
                     F  +G + SVRV +  +  ++GF FV F  P+EA  A+ +     + G+ 
Sbjct: 329 SIDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKP 388

Query: 808 LVM 810
           L +
Sbjct: 389 LYV 391

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 69/173 (39%), Gaps = 10/173 (5%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            S+++  L+   +   L D F       V+ ++   D   K    S+G+ +V F   E  
Sbjct: 35  ASLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRDAVTKT---SLGYAYVNFNDHEAG 89

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFN 759
              I  ++ T I G   ++  S R                     L  +   K +FE F+
Sbjct: 90  KKAIEQLNYTPIKGRLCRIMWSQR-----DPALRKKGSGNIFIKNLHPDIDNKALFETFS 144

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
            FG + S ++       ++GF FV F     A+ A+D L G+ L G+ + + P
Sbjct: 145 VFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP 197

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 6/85 (7%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V++F+KNL+     ++L + F  +      +V    + K K      GFGFV F T E+A
Sbjct: 319 VNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTDNGKSK------GFGFVCFSTPEEA 372

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQ 724
           T  I+  +  ++ G  + + ++ R+
Sbjct: 373 TKAITEKNQQIVAGKPLYVAIAQRK 397

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 344 LFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHIL 399
           +FSP G +  + V  D  T  S G+AYV F   E   +A  +L+    +GRL  I+
Sbjct: 54  IFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIM 109

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G +F++N+          + FS +G +    +A D  TG SKGF +V F     A +A 
Sbjct: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180

Query: 384 IELDKQIFQGRLLHI 398
             L+  +  G+ +++
Sbjct: 181 DALNGMLLNGQEIYV 195

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 37  GLITDLRILKNREGKSRRFAFIGYKNEQDALDAV 70
           G IT +R+++   GKS+ F F+ +   ++A  A+
Sbjct: 343 GTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAI 376

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 23  NKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSK 82
           NK L  T +   V G I   +I  +  GKS+ F F+ +++E  A +A++  +G  +   +
Sbjct: 136 NKALFETFS---VFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQE 192

Query: 83  IEV 85
           I V
Sbjct: 193 IYV 195

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 55/91 (60%), Gaps = 3/91 (3%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  K+ F+PYG +    V  D + GNSKGF +V F+ PE
Sbjct: 328 LAKFQGV-NLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRD-QEGNSKGFGFVCFSSPE 385

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 386 EATKAMTEKNQQIVAGKPLYVAIA-QRKDVR 415

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 7/161 (4%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +IFIKNL+    ++ L + F  F   +  +V    +        S GFGFV F+ +  A 
Sbjct: 139 NIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGN------SRGFGFVHFKEESDAK 192

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EXXXXXXXXXXXXXLPFEATRKDVFELFN 759
             I A++G +++G ++ + +   + +  S+ E             +  E T ++  +LF+
Sbjct: 193 DAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQLFS 252

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQG 800
            +G++ S  + K  +   +GF FV FV    A  A+++L G
Sbjct: 253 QYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNG 293

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 84/404 (20%), Positives = 152/404 (37%), Gaps = 49/404 (12%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           L++  +  + TE     +FSP G +  + V  D  T  S G+AYV +   E   +A  EL
Sbjct: 52  LYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQEL 111

Query: 387 DKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQD 446
           +     GR   I+ ++  +D  + +    N+ +K              TFS     ++  
Sbjct: 112 NYAEINGRPCRIMWSE--RDPAIRKKGSGNIFIKNLHP-AIDNKALHETFSTFGEVLSCK 168

Query: 447 AVLGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSP 506
             L       G       +  ++  A++       ++  +  Y         + S L+  
Sbjct: 169 VALDENGNSRGFGFVHFKEESDAKDAIE--AVNGMLMNGLEVYVAMHVPKKDRISKLEE- 225

Query: 507 SQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLM------PPAGTIAIVQFRDIASG 560
           ++ +   I VKN    TT EE  +LF  +G++    +       P G    V F D  + 
Sbjct: 226 AKANFTNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKG-FGFVNFVDHNAA 284

Query: 561 RSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLXXXX 620
             A  +L  K FK   +Y+ +  K         +   ++  EK AK  G           
Sbjct: 285 AKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQG----------- 333

Query: 621 XXXXXXXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQK 680
                              V++FIKNL+     ++L + F  +     A+V    +   K
Sbjct: 334 -------------------VNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRDQEGNSK 374

Query: 681 NKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
                 GFGFV F + E+AT  ++  +  ++ G  + + ++ R+
Sbjct: 375 ------GFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRK 412

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/183 (20%), Positives = 75/183 (40%), Gaps = 19/183 (10%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            +I++KN++ +TT ++    F  +   V A ++   + K K      GFGFV F     A
Sbjct: 231 TNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPK------GFGFVNFVDHNAA 284

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATR-------- 751
              +  ++G       + +  + ++    ++E               F+           
Sbjct: 285 AKAVEELNGKEFKSQALYVGRAQKKYER-AEELKKQYEQYRLEKLAKFQGVNLFIKNLDD 343

Query: 752 ----KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
               + + E F  +G + S RV +  + +++GF FV F  P+EA  AM +     + G+ 
Sbjct: 344 SIDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKP 403

Query: 808 LVM 810
           L +
Sbjct: 404 LYV 406

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 69/167 (41%), Gaps = 10/167 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
             S+++  L+   T   L D F       ++ ++   D   K    S+G+ +V +   E 
Sbjct: 49  NASLYVGELDPNITEALLYDVFSPLG--PISSIRVCRDAVTK---ASLGYAYVNYTDYEA 103

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF 758
               I  ++   I+G   ++  S R                     L      K + E F
Sbjct: 104 GKKAIQELNYAEINGRPCRIMWSER-----DPAIRKKGSGNIFIKNLHPAIDNKALHETF 158

Query: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLG 805
           ++FG++ S +V    + ++RGF FV F    +A++A++ + G+ + G
Sbjct: 159 STFGEVLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNG 205

 Score = 38.5 bits (88), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G +F++N+  +       + FS +GE+    VA+D   GNS+GF +V F +  +A  A 
Sbjct: 137 SGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALD-ENGNSRGFGFVHFKEESDAKDAI 195

Query: 384 IELDKQIFQGRLLHI 398
             ++  +  G  +++
Sbjct: 196 EAVNGMLMNGLEVYV 210

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 30  HATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDM 87
           H T +  G +   ++  +  G SR F F+ +K E DA DA+   +G  +   ++ V M
Sbjct: 155 HETFSTFGEVLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAM 212

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 23/34 (67%)

Query: 37  GLITDLRILKNREGKSRRFAFIGYKNEQDALDAV 70
           G IT  R+++++EG S+ F F+ + + ++A  A+
Sbjct: 358 GTITSARVMRDQEGNSKGFGFVCFSSPEEATKAM 391

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/209 (23%), Positives = 90/209 (43%), Gaps = 15/209 (7%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +IFIKNL+    ++ L D F VF   +  ++ T      K      GFGFV F  +  A 
Sbjct: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSK------GFGFVHFEEEYSAK 182

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EXXXXXXXXXXXXXLPFEATRKDVFELFN 759
             + A++G +++G ++ +     + +  S+ E             +  E T+++   LF 
Sbjct: 183 EAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFT 242

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPXXXXXXX 819
            FG++ S  + +  +   RGF F+ F   + A  A+D+L       +RL +         
Sbjct: 243 QFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV--------G 294

Query: 820 XXXXXXRMTKKVRKQAAVSEIAAMTRNAG 848
                    +++RKQ  VS +  + +  G
Sbjct: 295 RAQKKYERLQELRKQYEVSRLEKLAKYQG 323

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 53/91 (58%), Gaps = 3/91 (3%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  +  F+P+G +    V  D   GNSKGF +V F+ PE
Sbjct: 318 LAKYQGV-NLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFSTPE 375

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHR 408
           EA +A  E ++QI  G+ L++  A + KD R
Sbjct: 376 EATKAITEKNQQIVAGKPLYVAIA-QRKDVR 405

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 83/217 (38%), Gaps = 43/217 (19%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLM------PPAGTIAIVQFRDIASGRSAFSKL 567
           I VKN    TT+EE   LF  FGK+   ++       P G    + F D  S   A  +L
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281

Query: 568 AFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLXXXXXXXXXXX 627
               FK   +Y+ +  K         +       EK AK  G                  
Sbjct: 282 NDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQG------------------ 323

Query: 628 XXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMG 687
                       V++F+KNL+     ++L D F  F     A+V       + +   S G
Sbjct: 324 ------------VNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------RDDAGNSKG 365

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
           FGFV F T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 366 FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 55/99 (55%), Gaps = 9/99 (9%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++++NI   +T+++F+ LF+ +G++    +  D+  G  +GF ++ F   E A +A  EL
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281

Query: 387 DKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQREL 425
           +   F+ + L++  A + K  RL E       L+KQ E+
Sbjct: 282 NDTDFKSQRLYVGRA-QKKYERLQE-------LRKQYEV 312

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G +F++N+  +         FS +G +    +A D   GNSKGF +V F +   A +A 
Sbjct: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAV 185

Query: 384 IELDKQIFQGRLLHILAADEMKDHR 408
             ++  +  G+ +++      KD +
Sbjct: 186 DAINGMLLNGQEVYVAPHVSKKDRQ 210

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +  L++  +  + TE     LFSP G +  + V  D  T  S G+AYV F   +    A 
Sbjct: 39  SASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAI 98

Query: 384 IELDKQIFQGRLLHIL 399
            +L+    +GR   I+
Sbjct: 99  QKLNYTTIKGRPCRIM 114

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 30  HATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEV 85
           H T +V G I   +I  +  G S+ F F+ ++ E  A +AV+  +G  +   ++ V
Sbjct: 145 HDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYV 200

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 82/171 (47%), Gaps = 7/171 (4%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +I+IKNL+    ++ L + F  F   +  +V T      +N V S GFGFV F  +  A 
Sbjct: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT-----DENGV-SRGFGFVHFENESDAR 180

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EXXXXXXXXXXXXXLPFEATRKDVFELFN 759
             I A+DG +++  ++ + L   + +  S+ E             +  E ++++  ELF 
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
            +G++ S  + K  +   RGF FV F     A  A+D+L  +   G++L +
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  K+ F+P+G +    V  D  TGNS+GF +V F+ PE
Sbjct: 316 LAKYQGV-NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPE 373

Query: 378 EAVQAYIELDKQIFQGRLLHILAA 401
           EA +A  E ++QI  G+ L++  A
Sbjct: 374 EATKAITEKNQQIVAGKPLYVAIA 397

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 96/419 (22%), Positives = 160/419 (38%), Gaps = 64/419 (15%)

Query: 320 KIQKTG-RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEE 378
           K++ +G  L++  +  + +E     +FSP G +  + V  D  T  S G+AYV F   E 
Sbjct: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91

Query: 379 AVQAYIELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFS- 437
             +A  +L+  + +G+   I+ +   +D  L +    N+ +K              TFS 
Sbjct: 92  GPKAIEQLNYTLIKGKPCRIMWSQ--RDPSLRKKGSGNIYIKNLHP-AIDNKSLHETFST 148

Query: 438 -WNSLYMNQDAVLGSVAAKLG-VQKADLIDPENSNSAVKQALA---EAHVIGDVRKYFET 492
             N L          V+   G V   +  D  ++  AV   L    E +V   V K    
Sbjct: 149 FGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQ 208

Query: 493 KGVD--LTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAG--- 547
             ++    KF+N           + VKN    T++EE  ELF  +GK+   ++       
Sbjct: 209 SKLEEVKAKFTN-----------VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK 257

Query: 548 --TIAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSA 605
                 V F D A+   A  +L    FKG  +Y+ +  K         +       EK A
Sbjct: 258 LRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLA 317

Query: 606 KEAGPSSADLLXXXXXXXXXXXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSG 665
           K  G                              V++F+KNL+     ++L + F  F  
Sbjct: 318 KYQG------------------------------VNLFVKNLDDSIDDEKLKEEFAPFGT 347

Query: 666 FVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
              A+V       +     S GFGFV F T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 348 ITSAKVM------RDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 28  TTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDM 87
           + H T +  G I   ++  +  G SR F F+ ++NE DA DA+   DG  +   ++ V +
Sbjct: 141 SLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200

Query: 88  AKSFAD 93
             S  D
Sbjct: 201 HVSKKD 206

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 67/168 (39%), Gaps = 19/168 (11%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++++KN++ +T+ ++  + F  +     A ++   + K +      GFGFV F     A
Sbjct: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR------GFGFVNFEDHAAA 272

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFEL-- 757
              +  ++     G K+ +  + ++     QE               ++     V  L  
Sbjct: 273 AKAVDELNELEFKGQKLYVGRAQKKYER-LQELKKQYEAARLEKLAKYQGVNLFVKNLDD 331

Query: 758 ----------FNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAM 795
                     F  FG + S +V +    ++RGF FV F  P+EA  A+
Sbjct: 332 SIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379

>Kwal_56.23486
          Length = 587

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           +AK Q    LF++N+  S  ++  ++ F+P+G +  V V  D   G+SKGF +V F+ PE
Sbjct: 318 LAKYQGV-NLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFSTPE 375

Query: 378 EAVQAYIELDKQIFQGRLLHILAA 401
           EA +A  E ++QI  G+ L++  A
Sbjct: 376 EATKAITEKNQQIVAGKPLYVAIA 399

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 44/85 (51%), Gaps = 6/85 (7%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V++F+KNL+     ++L + F  F    +  VK   D    +K    GFGFV F T E+A
Sbjct: 324 VNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRDDAGSSK----GFGFVCFSTPEEA 377

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQ 724
           T  I+  +  ++ G  + + ++ R+
Sbjct: 378 TKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 68/168 (40%), Gaps = 19/168 (11%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++++KN++ +T   +    F  +     A ++T  + K +      GFGFV F     A
Sbjct: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGKLR------GFGFVNFEDHNAA 274

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFEL-- 757
              +  ++ T  +G K+ +  + ++     QE               ++     V  L  
Sbjct: 275 AKAVEELNDTDFNGQKLYVGRAQKKYER-LQELKKQYESSRMEKLAKYQGVNLFVKNLDD 333

Query: 758 ----------FNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAM 795
                     F  FG + SV+V +    S++GF FV F  P+EA  A+
Sbjct: 334 SIDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAI 381

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 67/174 (38%), Gaps = 10/174 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           + S+++  L+   T   L D F       V+ ++   D   K    S+G+ +V F     
Sbjct: 39  SASLYVGELDPSVTEALLYDLFSPIGS--VSSIRVCRDAITKT---SLGYAYVNFHDHNA 93

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF 758
            T  I  ++ T I G   ++  S R                     L      K + + F
Sbjct: 94  GTTAIEKLNYTPIKGRPCRIMWSQR-----DPSLRKKGSGNVFIKNLHPAIDNKALHDTF 148

Query: 759 NSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
           + FG + S ++       +R F FV F   + A+ A+D + G+ L G  + + P
Sbjct: 149 SVFGNILSCKIATDETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNGLEVYVAP 202

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +  L++  +  S TE     LFSP G +  + V  D  T  S G+AYV F        A 
Sbjct: 39  SASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAI 98

Query: 384 IELDKQIFQGRLLHIL 399
            +L+    +GR   I+
Sbjct: 99  EKLNYTPIKGRPCRIM 114

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 47/80 (58%)

Query: 319 AKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEE 378
           A+   +G +++  + +   E +    F+ +G+LK+V +A + +TGNS+ +A++ FA P++
Sbjct: 72  ARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDD 131

Query: 379 AVQAYIELDKQIFQGRLLHI 398
           AV A   +   +  G LL +
Sbjct: 132 AVVAQETMHNYLLMGHLLQV 151

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 1/97 (1%)

Query: 713 GHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPK- 771
           GH I  +   R+  A  Q              LP     +++   F  FG LK VR+ + 
Sbjct: 53  GHTILPQQPARRSGAKKQAARTDLSGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARN 112

Query: 772 KFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           K   ++R +AF+EF  P +A  A + +    L+G  L
Sbjct: 113 KKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLL 149

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 76/204 (37%), Gaps = 39/204 (19%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P   +FI NL +    Q L D FK     + A VK   D        S G+G V ++TKE
Sbjct: 259 PGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDG------YSRGYGVVYYKTKE 312

Query: 698 QATAVIS-----AMDGTVIDGHKIQLKLS-------------------------HRQGNA 727
           +    I       ++G V+D H+ +L  +                         H   N 
Sbjct: 313 EVQVAIERYNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNT 372

Query: 728 GSQEXXX---XXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVE 784
              E                LP+   + D+F+LF + G++    +   ++    G A VE
Sbjct: 373 EFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVE 432

Query: 785 FVLPKEAENAMDQLQGVHLLGRRL 808
           +  P +AE  + +L   +  GR L
Sbjct: 433 YDNPADAEVCISRLNSYNYGGRDL 456

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE- 385
           +F+ N+ YS      K +F   G++    V +D R G S+G+  V++ K +E VQ  IE 
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLD-RDGYSRGYG-VVYYKTKEEVQVAIER 320

Query: 386 LDKQIFQGRLLHI 398
            +    +GR+L +
Sbjct: 321 YNGYELEGRVLDV 333

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 498 TKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLM------PPAGTIAI 551
           T+F+ + +        I V N P+ T + +L +LF   GK+ R  +       P+G  A+
Sbjct: 372 TEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGA-AV 430

Query: 552 VQFRDIASGRSAFSKLAFKRFKG 574
           V++ + A      S+L    + G
Sbjct: 431 VEYDNPADAEVCISRLNSYNYGG 453

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP---EEAVQAY 383
           +F+ N+ Y    +D K+ FS  GE+  V   + T  G+ +G   V F      +EA++ +
Sbjct: 164 IFVGNLTYDCQPEDLKEYFSQIGEV--VRADIITSRGHHRGMGTVEFTNADDVDEAIRRF 221

Query: 384 ---IELDKQIF 391
                LD++IF
Sbjct: 222 DGSTLLDREIF 232

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (43%), Gaps = 26/178 (14%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V++FI +L+ K T + L D F  F  FV A++    + K+     S+G+G++ F  +E A
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKK-----SLGYGYLNFSNEEDA 170

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQG----NAGSQEXXXXXXXXXXXXXLPFE---ATRK 752
             VI   +   I G ++++  S R      N G+               LP E    T +
Sbjct: 171 ERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIGTN---------VFFSNLPLENLALTTR 221

Query: 753 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
             ++ F  FG++ S ++ ++     +   FV F     A+ A+ +  G    G  ++ 
Sbjct: 222 VFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEFFGNNILC 274

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           LP       + + F+  G +KS+       K +  +AF+ F    +A++A+D L    LL
Sbjct: 332 LPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLL 390

Query: 805 GR 806
           GR
Sbjct: 391 GR 392

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 78/173 (45%), Gaps = 26/173 (15%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           +++F+ NL  + TS++LT+ FKV+  F+ A+V T  D  +     S+G G++ F  KE A
Sbjct: 64  IALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNR-----SLGHGYINFGNKEDA 118

Query: 700 TAVISAMDGTVIDGHKIQLKLSHR----QGNAGSQEXXXXXXXXXXXXXLPFE---ATRK 752
                  +   I G +I++  S R    + N G+               LP +    T +
Sbjct: 119 ERATEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTN---------IFFSNLPLQKEKLTHR 169

Query: 753 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLG 805
             +++F  +G + SV++      S++   FV F     A + + +      LG
Sbjct: 170 MFYDIFRKYGNVLSVKL-----DSSKNIGFVYFEDDTIARDVIKEFNNKEFLG 217

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 44/75 (58%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G +++  + +   E +  K F+ +G+LKEV +A + +TGNS+ + ++ F   E+A+ A 
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 384 IELDKQIFQGRLLHI 398
             ++  +  G LL +
Sbjct: 150 ESMNNYLLMGHLLQV 164

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP     K++ + F  FG LK VR+ + K   ++R + F+EFV  ++A  A + +    L
Sbjct: 98  LPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLL 157

Query: 804 LGRRL 808
           +G  L
Sbjct: 158 MGHLL 162

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 70/168 (41%), Gaps = 12/168 (7%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL+   T   L   F+V  G  +A +K   D   KN    + + FVE+     A  
Sbjct: 77  LYVGNLDKAITEDILKQYFQV--GGPIANIKIMIDKNNKN----VNYAFVEYHQSHDANI 130

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
            +  ++G  I+ + +++  + +     SQ+             L      + +   F  F
Sbjct: 131 ALQTLNGKQIENNIVKINWAFQ-----SQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDF 185

Query: 762 GQLKSVRVPKKFDK-SARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
               S  V       S+RG+ FV F    +A+NAMD +QG  L GR L
Sbjct: 186 PSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPL 233

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T  LF+ ++  +  ++  +  F  +      HV  D +TG+S+G+ +V F   ++A  A 
Sbjct: 161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM 220

Query: 384 IELDKQIFQGRLLHI 398
             +  Q   GR L I
Sbjct: 221 DSMQGQDLNGRPLRI 235

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 45/90 (50%), Gaps = 13/90 (14%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVF----SGFVVAQVKTKPDPKQKNKVLSMGFGFVEFR 694
           T ++F+ +LN     + L + FK F    SG V+  ++T           S G+GFV F 
Sbjct: 161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGS---------SRGYGFVSFT 211

Query: 695 TKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
           +++ A   + +M G  ++G  +++  + ++
Sbjct: 212 SQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241

>Kwal_26.8458
          Length = 219

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 6/78 (7%)

Query: 329 LRNILYSST------EDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           L  I+Y S       E +  K FS +G+L+EV +A + +TGNS+ + +V F   E++  A
Sbjct: 88  LSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVA 147

Query: 383 YIELDKQIFQGRLLHILA 400
              +   +  G LL ++A
Sbjct: 148 QETMHNYLLMGHLLQVVA 165

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP     +++ + F+ FG L+ VR+ + K   ++R + FVEFV  +++  A + +    L
Sbjct: 97  LPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETMHNYLL 156

Query: 804 LGRRL 808
           +G  L
Sbjct: 157 MGHLL 161

>Kwal_33.15208
          Length = 186

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 2/77 (2%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPY-GELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           T  +F+ NI  S T ++ + LF      +  V + V+   G +KGFAYV FA+P++ V A
Sbjct: 52  TRSVFVGNISQSITAEELQLLFKDVVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKD-VTA 110

Query: 383 YIELDKQIFQGRLLHIL 399
            +ELD   F GR L ++
Sbjct: 111 AVELDNVDFHGRRLRVV 127

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 778 RGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
           +GFA+VEF  PK+   A++ L  V   GRRL + P
Sbjct: 95  KGFAYVEFAQPKDVTAAVE-LDNVDFHGRRLRVVP 128

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ +   E+   K F P G+++ V +  D++T   KGFAYV F   +   +A +  
Sbjct: 361 VFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLLH 420

Query: 387 DKQIFQG---RLLHILAADEMKDHRLDEFDLKNMPLKKQR 423
           +K+I +G   R L I     M+  + ++  L+N  L  Q+
Sbjct: 421 EKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQ 460

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 44/75 (58%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G L++  +     E +  K FS +G+LK+V +A + +TGNS+ +A++ +   ++AV A 
Sbjct: 182 SGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQ 241

Query: 384 IELDKQIFQGRLLHI 398
             ++  +  G LL +
Sbjct: 242 ESMNNYLLMGHLLKV 256

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP     +++ + F+ FG LK VR+ + K   ++R +AF+E++   +A  A + +    L
Sbjct: 190 LPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQESMNNYLL 249

Query: 804 LGRRL 808
           +G  L
Sbjct: 250 MGHLL 254

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 12/67 (17%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGYKN 62
           + +  LP    E EL K+F++            G +  +R+ +N++ G SR +AF+ Y N
Sbjct: 185 LYISRLPQGFKERELSKYFSQF-----------GDLKQVRLARNKKTGNSRHYAFLEYIN 233

Query: 63  EQDALDA 69
           + DA+ A
Sbjct: 234 KDDAVVA 240

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 43/75 (57%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           +G +++  +     E +  K FS +G+LKEV +A + +TGNS+ + +V F   +++  AY
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 384 IELDKQIFQGRLLHI 398
             ++  +  G LL +
Sbjct: 184 DTMNNYLLMGHLLQV 198

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP     +++ + F+ FG LK VR+ + K   ++R + FV+FV   ++  A D +    L
Sbjct: 132 LPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLL 191

Query: 804 LGRRL 808
           +G  L
Sbjct: 192 MGHLL 196

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 65/178 (36%), Gaps = 21/178 (11%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           SIF++NL F  T + L + F      V A + T        K    G G VEF   E   
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-------KGHHRGMGTVEFTKNESVQ 175

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX----------XLPFEAT 750
             IS  DG +     +  KL  RQ N   +                        LP+   
Sbjct: 176 DAISKFDGALF----MDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMN 231

Query: 751 RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
            + + ++F   G +    V   F+  +RGF  V +    E   A+D   G+ + GR L
Sbjct: 232 WQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 289

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 97/264 (36%), Gaps = 62/264 (23%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ YS      K +F   G +    V +D   G S+GF  V++   +E ++A    
Sbjct: 221 VFIINLPYSMNWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDEMIRAIDTF 279

Query: 387 DKQIFQGRLLHILAADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYMNQD 446
           +    +GR+L      E+++ R ++   KN     QR                       
Sbjct: 280 NGMEVEGRVL------EVREGRFNK--RKNNDRYNQR----------------------- 308

Query: 447 AVLGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSP 506
                        + DL D   +   + Q  A  H+     K+  T+GV+         P
Sbjct: 309 -------------REDLEDTRGTEPGLAQDAA-VHIDETAAKF--TEGVN---------P 343

Query: 507 SQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPP-----AGTIAIVQFRDIASGR 561
               +  I   N PF T R +L +LF P GK+    + P        +A+V++ ++    
Sbjct: 344 GGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDAD 403

Query: 562 SAFSKLAFKRFKGTVIYLEKGPKD 585
               KL    + G  + +    +D
Sbjct: 404 FCIQKLNNYNYGGCSLQISYARRD 427

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+RN+ +  T +D K+LF   GE+ E  +   T  G+ +G   V F K E    A  + 
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADII--TSKGHHRGMGTVEFTKNESVQDAISKF 181

Query: 387 DKQIFQGRLLHI 398
           D  +F  R L +
Sbjct: 182 DGALFMDRKLMV 193

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 74/205 (36%), Gaps = 44/205 (21%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +FI NL +    Q L D FK     + A V+   +        S GFG V + T+++   
Sbjct: 221 VFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNG------FSRGFGSVIYPTEDEMIR 274

Query: 702 VISAMDGTVIDGHKIQLK---LSHRQGN-------------AGSQEXXXXXXXXX----- 740
            I   +G  ++G  ++++    + R+ N              G++               
Sbjct: 275 AIDTFNGMEVEGRVLEVREGRFNKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETA 334

Query: 741 -----------------XXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFV 783
                                LPF   R D+F+LF   G++ +  +  + +    G A V
Sbjct: 335 AKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVV 394

Query: 784 EFVLPKEAENAMDQLQGVHLLGRRL 808
           E+    +A+  + +L   +  G  L
Sbjct: 395 EYENLVDADFCIQKLNNYNYGGCSL 419

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           L F+ T +D+ ELF + G++    +        RG   VEF   +  ++A+ +  G   +
Sbjct: 129 LTFDCTPEDLKELFGTVGEVVEADIITS-KGHHRGMGTVEFTKNESVQDAISKFDGALFM 187

Query: 805 GRRLVMQ 811
            R+L+++
Sbjct: 188 DRKLMVR 194

>Scas_637.2
          Length = 377

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 68/173 (39%), Gaps = 14/173 (8%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
            IFI NL+F  T + L D F      V A+V +        +  S G G VEF     A 
Sbjct: 79  GIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSY-------RGRSKGMGTVEFTNPADAE 131

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXX-----XLPFEATRKDVF 755
             I   +G    G  I +K    Q   GS++                  LP+  T +++ 
Sbjct: 132 EAIRQYNGVPFMGRDIFVK--QDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLK 189

Query: 756 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           ++F   G +    V   ++  +RGF  V +   ++   A+D   G  L GR L
Sbjct: 190 DIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRIL 242

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           L F+AT +D+ + F+  G++ +  V   +   ++G   VEF  P +AE A+ Q  GV  +
Sbjct: 85  LSFDATEEDLRDFFSQVGEVVNAEV-MSYRGRSKGMGTVEFTNPADAEEAIRQYNGVPFM 143

Query: 805 GRRLVMQ 811
           GR + ++
Sbjct: 144 GRDIFVK 150

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 317 AIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
            + K  + G +F+ N+ + +TE+D +  FS  GE+  V+  V +  G SKG   V F  P
Sbjct: 71  GVEKHHENG-IFIGNLSFDATEEDLRDFFSQVGEV--VNAEVMSYRGRSKGMGTVEFTNP 127

Query: 377 EEAVQAYIELDKQIFQGRLLHI 398
            +A +A  + +   F GR + +
Sbjct: 128 ADAEEAIRQYNGVPFMGRDIFV 149

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           Q+    F+ N+ YS T  + K +F   G++    V +D   G S+GF  V++A  E+  +
Sbjct: 169 QQGYEAFVVNLPYSITWQNLKDIFRECGDVIRADVELDY-NGYSRGFGSVIYANEEDMFK 227

Query: 382 AYIELDKQIFQGRLLHI 398
           A    +    +GR+L +
Sbjct: 228 AIDSFNGAELEGRILEV 244

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 73/205 (35%), Gaps = 49/205 (23%)

Query: 643 FIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAV 702
           F+ NL +  T Q L D F+     + A V+            S GFG V +  +E     
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELD------YNGYSRGFGSVIYANEEDMFKA 228

Query: 703 ISAMDGTVIDGHKIQL---KLSH------------------------------------R 723
           I + +G  ++G  +++   K +H                                     
Sbjct: 229 IDSFNGAELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSFT 288

Query: 724 QGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFV 783
           +G +G  E             LP   T  D+++LF S G++    +      ++ G A V
Sbjct: 289 EGVSGDGERNNTVYCNN----LPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVV 344

Query: 784 EFVLPKEAENAMDQLQGVHLLGRRL 808
           E+     A+  +++L G +  GR L
Sbjct: 345 EYASQDAADVCINKLNGYNYGGRDL 369

 Score = 37.0 bits (84), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           ++   ++  N+  S+T  D   LF   GE+    +  D  TG S G A V +A  + A  
Sbjct: 296 ERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAADV 354

Query: 382 AYIELDKQIFQGRLLHILAA 401
              +L+   + GR LHI  A
Sbjct: 355 CINKLNGYNYGGRDLHITYA 374

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           LF+ ++  ++TE D   LF + +  +K V V  D  TG+S+ F +V F   +E  +A IE
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 386 LDKQIFQGRLLHILAA 401
           +  + FQGR L +  A
Sbjct: 254 MSGKWFQGRALRVAYA 269

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           LF+ ++  ++TE D   LF + +  +K V V  D  TG S+ F +V F   EE  +A IE
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 386 LDKQIFQGRLLHILAA 401
           ++   FQGR L +  A
Sbjct: 296 MNGVHFQGRTLRVAYA 311

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 749 ATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           AT  D+  LF + F  +K+VRV       ++R F FV F   +E   A+ ++ GVH  GR
Sbjct: 245 ATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEMNGVHFQGR 304

Query: 807 RL 808
            L
Sbjct: 305 TL 306

>Scas_666.11
          Length = 224

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 331 NILYSST------EDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYI 384
           +ILY S       E +  K FS +G+LKEV +A + +TGNS+ + ++ FA  ++A  A  
Sbjct: 94  SILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQD 153

Query: 385 ELDKQIFQGRLLHI 398
            ++  +  G LL +
Sbjct: 154 AMNNYLVMGHLLQV 167

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 661 KVFSGFV-VAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLK 719
           K FS F  + +V+   + K  N   S  +GF+EF  K+ A     AM+  ++ GH +Q++
Sbjct: 112 KYFSQFGDLKEVRLARNKKTGN---SRHYGFIEFANKDDANIAQDAMNNYLVMGHLLQVR 168

Query: 720 L 720
           L
Sbjct: 169 L 169

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/258 (20%), Positives = 98/258 (37%), Gaps = 48/258 (18%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ YS +    K +F    E+    V+VD   G S+GF  V     E  + A    
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDA-DGYSRGFGTVYVTTRENQIAAIERW 167

Query: 387 DKQIFQGRLLHIL---AADEMKDHRLDEFDLKNMPLKKQRELXXXXXXXXXTFSWNSLYM 443
           +    +GR+L +      D     R D +  K +P                ++ ++  Y 
Sbjct: 168 NGYELEGRILEVREGKGTDVGSAGRGDSYVPKQIP----------------SYDYDGEYR 211

Query: 444 NQDAVLGSVAAKLGVQKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNL 503
             +     V A+L         P + N++V        V G     +E       +F++ 
Sbjct: 212 GTE-----VRAEL---------PHSENASVS-------VSGKASPEYEQYTPSDVEFTSK 250

Query: 504 KSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLLMP------PAGTIAIVQFRDI 557
            +P    +R+I  +N P  T   +L +LF   GK+ R  +       P G+ ++ +F  +
Sbjct: 251 AAPGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGS-SVCEFETV 309

Query: 558 ASGRSAFSKLAFKRFKGT 575
           A  +    +L    + G 
Sbjct: 310 ADAQECIERLNNYHYGGC 327

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           IF+ NL +  + Q L D FK  S  + A V    D        S GFG V   T+E   A
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDADG------YSRGFGTVYVTTRENQIA 162

Query: 702 VISAMDGTVIDGHKIQLK 719
            I   +G  ++G  ++++
Sbjct: 163 AIERWNGYELEGRILEVR 180

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 39/63 (61%)

Query: 338 EDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLH 397
           E +  K FS +G+LK+V +A + +TGNS+ +A++ F   ++A+ A   ++  +  G LL 
Sbjct: 105 ERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLILGHLLK 164

Query: 398 ILA 400
           ++ 
Sbjct: 165 VVV 167

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP     +++ + F+ FG LK VR+ + K   ++R +AF+EFV   +A  A D +    +
Sbjct: 99  LPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLI 158

Query: 804 LGRRL 808
           LG  L
Sbjct: 159 LGHLL 163

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 12/78 (15%)

Query: 2   SRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGY 60
           S + V  LP    E EL K+F++            G +  +R+ +N++ G SR +AFI +
Sbjct: 92  SIIYVSRLPQGFHERELSKYFSQF-----------GDLKQVRLARNKKTGNSRHYAFIEF 140

Query: 61  KNEQDALDAVNYFDGSFI 78
            N+ DAL A +  +   I
Sbjct: 141 VNKDDALVAQDTMNNYLI 158

>Scas_565.8
          Length = 322

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 15/90 (16%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGN----------SKGFAYVLF 373
           T +L   N+ +++++ + ++L  P+G+     V+V T T +          S G+AYV+F
Sbjct: 16  THKLVFTNVRFNTSDAELEELLKPFGK-----VSVLTPTESLFGFRGTKVVSIGYAYVIF 70

Query: 374 AKPEEAVQAYIELDKQIFQGRLLHILAADE 403
             P+ A  A+ EL K  F+GR L+I   +E
Sbjct: 71  ETPQLAATAFNELHKTEFKGRTLYIKPYEE 100

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 35/78 (44%), Gaps = 13/78 (16%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPA------GT------IAIVQFRDIASGR 561
           ++  N  F T+  EL EL  PFGK+  +L P        GT       A V F       
Sbjct: 19  LVFTNVRFNTSDAELEELLKPFGKV-SVLTPTESLFGFRGTKVVSIGYAYVIFETPQLAA 77

Query: 562 SAFSKLAFKRFKGTVIYL 579
           +AF++L    FKG  +Y+
Sbjct: 78  TAFNELHKTEFKGRTLYI 95

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 32/49 (65%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFA 374
           ++F+  + + +TED+ ++ FS YG + EV +  D  TG S+GF ++ FA
Sbjct: 164 KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFA 212

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
             + +K G++F+  I       +F++ FS +G + +  + +D  TG S+GF ++ +  P 
Sbjct: 240 TGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSP- 298

Query: 378 EAVQAYIELDKQIFQGRLLHILAAD 402
           +AV    +     F+G+ + I  A+
Sbjct: 299 DAVDRVCQNKFIEFKGKRIEIKRAE 323

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 68/168 (40%), Gaps = 16/168 (9%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +FI  LN++TT   L + F  +    V +VK   D        S GFGF+ F        
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGN--VTEVKIMRD---GTTGRSRGFGFLSFADASSVDE 219

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
           V+      ++DG  I  K S   G A                 +  +   K+  E F+ +
Sbjct: 220 VVKTQ--HILDGKVIDPKESDPTGRA-------RKAGKIFVAGIGPDVRPKEFEEFFSQW 270

Query: 762 GQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           G +   ++    D   +RGF F+ +  P +A + + Q + +   G+R+
Sbjct: 271 GSIIDAQLMLDKDTGRSRGFGFITYDSP-DAVDRVCQNKFIEFKGKRI 317

>Scas_635.7
          Length = 581

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP---EEAVQA 382
           ++F+  + + +TED  K  FS YG + E+ +  D  TG S+GF ++ F  P   +E V+ 
Sbjct: 197 KMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKT 256

Query: 383 YIELDKQIF 391
              LD ++ 
Sbjct: 257 QHILDGKVI 265

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           KTG++F+  I       +F+  F+ YG + +  + +D  TG S+GF +V +    +AV  
Sbjct: 278 KTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDS-GDAVDR 336

Query: 383 YIELDKQIFQGRLLHILAADEMKDHR 408
             +     F+G+ + I  A+   + R
Sbjct: 337 VCQNKYIEFKGKQIEIKRAEPRHNQR 362

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 32/76 (42%), Gaps = 8/76 (10%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
             +FI  LN++TT   L + F  +   V  ++      K      S GFGF+ F      
Sbjct: 196 CKMFIGGLNWETTEDGLKNYFSKYGNVVELKIM-----KDGATGRSRGFGFLTFENPSSV 250

Query: 700 TAVISA---MDGTVID 712
             V+     +DG VID
Sbjct: 251 DEVVKTQHILDGKVID 266

>Kwal_55.21960
          Length = 597

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP---EEAVQA 382
           ++F+  + + +TED+ K  FS YG++ ++ +  D  TG S+GF ++ FA+    +E V+ 
Sbjct: 210 KMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKT 269

Query: 383 YIELDKQIF 391
              LD ++ 
Sbjct: 270 QHILDGKVI 278

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           KTG++F+  I       +F++ FS +G + +  + +D  TG S+GF ++ +  P +AV  
Sbjct: 291 KTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDR 349

Query: 383 YIELDKQIFQGRLLHILAAD 402
             E     F+G+ + I  A+
Sbjct: 350 VCENKFIEFKGKRIEIKRAE 369

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 31/76 (40%), Gaps = 8/76 (10%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
             +FI  LN++TT   L D F  +      ++      +      S GFGF+ F      
Sbjct: 209 CKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIM-----RDNATGRSRGFGFLTFAEASSV 263

Query: 700 TAVISA---MDGTVID 712
             V+     +DG VID
Sbjct: 264 DEVVKTQHILDGKVID 279

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           LF+ ++   +TE D   LF + Y  +K V V  D  TG S+ F +V FA   E   A IE
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 386 LDKQIFQGRLLHILAA 401
           ++   FQGR L +  A
Sbjct: 221 MNGVQFQGRQLRVAYA 236

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 61/149 (40%), Gaps = 18/149 (12%)

Query: 676 DPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQE--XX 733
           DP + N +   G+ FVEF + E A   ++ ++ T I         S R  + G ++    
Sbjct: 85  DPNKTN-LHHAGYCFVEFESFEDAQQALT-LNATPIPNISCNTTASKRTNDDGKRKFRLN 142

Query: 734 XXXXXXXXXXXLPFE------------ATRKDVFELFNS-FGQLKSVRV-PKKFDKSARG 779
                      LP              AT  D+  LF + +  +K+VRV       ++R 
Sbjct: 143 WANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRC 202

Query: 780 FAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           F FV F    E  NA+ ++ GV   GR+L
Sbjct: 203 FGFVRFANETERRNALIEMNGVQFQGRQL 231

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 754 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLG 805
           +FELF  FG +  V++P       +   FV++    EAE A++ LQG  ++G
Sbjct: 461 LFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAINGLQGFIIMG 507

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+R + + ST+++F   FS +  +K   +  D   G S+GF +V FA  ++   A  + 
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDG-EGASRGFGFVSFAVEDDTKTALNQA 75

Query: 387 DKQIFQGRLLHI 398
            K  F GRLL I
Sbjct: 76  RKTKFMGRLLRI 87

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           +PFE+T ++    F+ F  +K   + K  + ++RGF FV F +  + + A++Q +    +
Sbjct: 22  VPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFM 81

Query: 805 GRRL 808
           GR L
Sbjct: 82  GRLL 85

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+RN+ Y +T++  ++ F  +G +K     +D  TG +KG A+V F
Sbjct: 298 IFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAF 344

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 11/86 (12%)

Query: 4  VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNE 63
          + V+G+P   T+ E    F++     HA            I+K+ EG SR F F+ +  E
Sbjct: 17 LFVRGVPFESTDEEFGNFFSQFSPIKHAV-----------IVKDGEGASRGFGFVSFAVE 65

Query: 64 QDALDAVNYFDGSFIYTSKIEVDMAK 89
           D   A+N    +      + +D+AK
Sbjct: 66 DDTKTALNQARKTKFMGRLLRIDIAK 91

>Scas_701.3
          Length = 321

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 38/60 (63%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + Y +TE + +KLF  +GE++++ +  D  T  SKG+A+++F  P  +  A+ E+
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQL---QG 800
           LP++ T  ++ +LF  FG+++ +R+ + K    ++G+AF+ F+ P  ++ A  ++   +G
Sbjct: 113 LPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEIGVHRG 172

Query: 801 VHLLGRRLVM 810
           + + GR  ++
Sbjct: 173 IDIKGRTCIV 182

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 512 RVILVKNFPFGTTREELGELFVPFGKLERL------LMPPAGTIAIVQFRDIASGRSAFS 565
           R I +   P+ TT  EL +LFV FG++E++      L   +   A + F D  S + AF 
Sbjct: 106 RTIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFK 165

Query: 566 KLAFKR 571
           ++   R
Sbjct: 166 EIGVHR 171

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T RLF+R   +   E +  ++FSP+G +KEV +          GFA+V F + E A +A 
Sbjct: 74  TTRLFVRPFPFDVQESELNEIFSPFGPMKEVKIL--------NGFAFVEFEESESAAKAI 125

Query: 384 IELDKQIFQGRLLHILAADEMKDHRLDEFDLKNMP 418
            E++ + F  + L ++ + ++   R     L+N+P
Sbjct: 126 DEVNGKTFANQPLEVVYS-KLPPQRF-RMILRNLP 158

 Score = 37.4 bits (85), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 7/56 (12%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQG 800
            PF+    ++ E+F+ FG +K V++         GFAFVEF   + A  A+D++ G
Sbjct: 82  FPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDEVNG 130

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFK 573
           + V+ FPF     EL E+F PFG ++ + +      A V+F +  S   A  ++  K F 
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKI--LNGFAFVEFEESESAAKAIDEVNGKTFA 134

Query: 574 GT---VIYLEKGPK 584
                V+Y +  P+
Sbjct: 135 NQPLEVVYSKLPPQ 148

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 13/83 (15%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T  +F++   F     +L + F  F             P ++ K+L+ GF FVEF   E 
Sbjct: 74  TTRLFVRPFPFDVQESELNEIFSPFG------------PMKEVKILN-GFAFVEFEESES 120

Query: 699 ATAVISAMDGTVIDGHKIQLKLS 721
           A   I  ++G       +++  S
Sbjct: 121 AAKAIDEVNGKTFANQPLEVVYS 143

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP---EEAVQA 382
           ++F+  + + +TED+ ++ F  YG + ++ +  D  TG S+GF ++ F KP   +E V+ 
Sbjct: 160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT 219

Query: 383 YIELDKQIF 391
              LD ++ 
Sbjct: 220 QHILDGKVI 228

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           KTG++F+  I       +F++ FS +G + +  + +D  TG S+GF +V +
Sbjct: 241 KTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY 291

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP---EEAVQA 382
           ++F+  + + +TED  ++ FS YG + E+ +  D  TG S+GF ++ F  P   +E V+ 
Sbjct: 131 KMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKT 190

Query: 383 YIELDKQIF 391
              LD ++ 
Sbjct: 191 QHILDGKVI 199

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           KTG++F+  +       +F++ FS +G + +  + +D  TG S+GF +V +  P +A + 
Sbjct: 212 KTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSP-DAAEK 270

Query: 383 YIELDKQIFQGRLLHILAAD 402
             E   + F+G+ + I  A+
Sbjct: 271 VCESRYREFKGKQIEIKRAE 290

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
              +FI  LN++TT   L + F  +   V  ++K   DP   N   S GFGF+ F     
Sbjct: 129 NCKMFIGGLNWETTEDGLREYFSKYGNVV--ELKIMKDP---NTGRSRGFGFLSFDAPSS 183

Query: 699 ATAVISA---MDGTVID 712
              V+     +DG VID
Sbjct: 184 VDEVVKTQHILDGKVID 200

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 326 RLFLRNILYSSTEDD---FKKLFSPYGELKEVHVAVDTRTGNSK--GFAYVLFAKPEEAV 380
           R+++ N+ YSS+E+D   F K F+    L   H     R   ++  G AYV F   EEAV
Sbjct: 5   RIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 381 QAYIELDKQIFQGRLLHI 398
           +A  EL+ + F GR+L +
Sbjct: 65  RAVEELNGKEFGGRVLRV 82

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ +   E++  K FSP GE++ + +  D++T   KGFAYV F   +   +A +  
Sbjct: 309 VFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALLLN 368

Query: 387 DKQI-FQGRLLHILAADEMK 405
           +K+I   GR L +     M+
Sbjct: 369 EKKINGNGRKLRVSRCKNMR 388

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+RNI + +T+ +    FS +  +K   V V    G+S+GF +V FA   +   A  + 
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHA-VIVKDNAGSSRGFGFVSFAVESDTQAALDKG 76

Query: 387 DKQIFQGRLLHILAA 401
            K  F+GRLL +  A
Sbjct: 77  RKTQFKGRLLRVDVA 91

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 73/194 (37%), Gaps = 31/194 (15%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++F++N+ F  T  +LTD F  F+    A +       + N   S GFGFV F  +    
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPIKHAVIV------KDNAGSSRGFGFVSFAVESDTQ 70

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKD------- 753
           A +     T   G  +++ ++ R+  +   +              P  A   D       
Sbjct: 71  AALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEK-PTTAPEGDEALMRGK 129

Query: 754 -----------------VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMD 796
                            + ++F  FG +    +P+K D    GFAFV          A++
Sbjct: 130 PKLIIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIE 189

Query: 797 QLQGVHLLGRRLVM 810
           + +G+ + GR + +
Sbjct: 190 ECKGLKIDGREVAV 203

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+RN+ Y +T++  +  FS +G +K      D  TG  KG A+V F
Sbjct: 290 VFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAF 336

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/228 (20%), Positives = 87/228 (38%), Gaps = 31/228 (13%)

Query: 497 LTKFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLER--LLMPPAGT---IAI 551
           ++K  N  S +  D + + V+N PF  T  EL + F  F  ++   ++   AG+      
Sbjct: 1   MSKQVNDTSKNGLDLKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGF 60

Query: 552 VQFRDIASGRSAFSKLAFKRFKGTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPS 611
           V F   +  ++A  K    +FKG ++ ++   +   +K     +A    E+       P 
Sbjct: 61  VSFAVESDTQAALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPE 120

Query: 612 SADLLXXXXXXXXXXXXXXXXXXXXGPTVSIFIKNLNFKTTSQQLTDRFKVFSGF-VVAQ 670
             + L                         + I+N+ +  + +  T   K+F  F VVA+
Sbjct: 121 GDEALMRGKP-------------------KLIIRNMPW--SCRDPTKLKKIFGRFGVVAE 159

Query: 671 VKTKPDPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQL 718
                 P++ +  L  GF FV  +        I    G  IDG ++ +
Sbjct: 160 ASI---PRKADGKL-CGFAFVTMKKLSNCRKAIEECKGLKIDGREVAV 203

>Scas_717.41
          Length = 379

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 52/96 (54%), Gaps = 12/96 (12%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T RLF+R   +   E +  ++F+P+G +KEV +          GFA+V F + + A +A 
Sbjct: 82  TTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL--------NGFAFVEFEEADSAAKAI 133

Query: 384 IELDKQIFQGRLLHILAAD-EMKDHRLDEFDLKNMP 418
            E++ + F  + L ++ +   +K +RL    L+N+P
Sbjct: 134 EEVNGKTFANQPLEVVYSKLPVKRYRL---TLRNLP 166

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 19/86 (22%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSA---------- 563
           + V+ FPF     EL E+F PFG ++ + +      A V+F +  S   A          
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKI--LNGFAFVEFEEADSAAKAIEEVNGKTFA 142

Query: 564 -------FSKLAFKRFKGTVIYLEKG 582
                  +SKL  KR++ T+  L +G
Sbjct: 143 NQPLEVVYSKLPVKRYRLTLRNLPEG 168

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
            PF+    ++ E+F  FG +K V++         GFAFVEF   +EA++A   ++ V+  
Sbjct: 90  FPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEF---EEADSAAKAIEEVN-- 137

Query: 805 GRRLVMQP 812
           G+    QP
Sbjct: 138 GKTFANQP 145

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           ++F+  + + +TE+  +  FS YG + EV +  DT TG S+GF ++ F
Sbjct: 187 KMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTF 234

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           KTG++F+  I       +F++ FS +G + +  + +D  TG S+GF ++ +  P +AV  
Sbjct: 268 KTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDR 326

Query: 383 YIELDKQIFQGRLLHILAAD 402
             +     F+G+ + I  A+
Sbjct: 327 VCQNKFIEFKGKQIEIKRAE 346

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 8/74 (10%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +FI  LN++TT + L D F  +    VA+VK   D        S GFGF+ F        
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYG--AVAEVKIMKDTATGR---SRGFGFLTFENASSVDE 242

Query: 702 VISA---MDGTVID 712
           V+     +DG VID
Sbjct: 243 VVKTQHILDGKVID 256

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 117/285 (41%), Gaps = 21/285 (7%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           I K  KT  LF+ N+  + TE+  +K+F  Y   +   V  D  T  S G+ Y+ F    
Sbjct: 104 ITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKN 163

Query: 378 EAVQAYIELDKQIFQGRLLHILAADEMKDHRLD---EFDLKNMPLKKQRELXXXXXXXXX 434
           +A  A  E +  +F G+ + I+ + +    R +        N+PL+  +           
Sbjct: 164 DAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPLENPQLTTRSFYLIMI 223

Query: 435 TF-SWNSLYMNQDAVLGSVAAKLGVQKADLIDPENSNSAV-KQALAEAHVIGDVRKYFE- 491
            + +  S  + +   +G V     +   ++I   N+      + +   H   +VR   E 
Sbjct: 224 EYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEF 283

Query: 492 TK-----GVDLTKFSNLKSPSQRDD----RVILVKNFPFGTTREELGELFVPFGKLERLL 542
           TK     G D+     L + +   D    + ILVKN P  TT+EE+ + F   G ++ + 
Sbjct: 284 TKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVF 343

Query: 543 MP--PAGT--IAIVQFRDIASGRSAFSKLAFKRFKGTVIYLEKGP 583
           +    A T   A V +++    + A   L    FK   I++  GP
Sbjct: 344 ISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWV--GP 386

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 71/179 (39%), Gaps = 26/179 (14%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T S+FI NL    T + L   FK +  F  A+V      K+     S+G+G++ F+ K  
Sbjct: 110 TNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKK-----SLGYGYLNFKDKND 164

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHR----QGNAGSQEXXXXXXXXXXXXXLPFE---ATR 751
           A +     + TV  G ++++  S +    + N G+               LP E    T 
Sbjct: 165 AESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTN---------VFFSNLPLENPQLTT 215

Query: 752 KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
           +  + +   +G + S  + ++     +   FV F     A N + +       G +++ 
Sbjct: 216 RSFYLIMIEYGNVLSCLLERR-----KNIGFVYFDNDISARNVIKKYNNQEFFGNKIIC 269

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 31/48 (64%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           ++F+  + + +TED  +  FS YG+++E+ +  D  TG S+GF ++ F
Sbjct: 123 KMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTF 170

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           KTG++F+  I       +F++ F+ +G + +  + +D  TG S+GF ++ +  P +AV  
Sbjct: 204 KTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTP-DAVDK 262

Query: 383 YIELDKQIFQGRLLHILAA 401
             +     F+GR + I  A
Sbjct: 263 VCQNKFIDFKGRKIEIKRA 281

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           +  +FI  LN++TT   L D F  +    V ++K   DP       S GFGF+ F +   
Sbjct: 121 SCKMFIGGLNWETTEDGLRDYFSKYG--KVEELKIMKDPATGR---SRGFGFLTFESASS 175

Query: 699 ATAVISA---MDGTVID 712
              V+     +DG VID
Sbjct: 176 VDEVVKTQHILDGKVID 192

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           LP   T   +  +FN F    SV++    + K + G+ ++ F  PK+AENA+D+   + +
Sbjct: 145 LPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEYNYMPI 204

Query: 804 LGRRLVMQP 812
            GR + M P
Sbjct: 205 FGREIRMMP 213

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 320 KIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEA 379
           K +K   LF+ ++  + TED    +F+ +     V + VD+ T  S G+ Y+ F  P++A
Sbjct: 133 KSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDA 192

Query: 380 VQAYIELDKQIFQGRLLHILAA 401
             A  E +     GR + ++ +
Sbjct: 193 ENAVDEYNYMPIFGREIRMMPS 214

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 69/168 (41%), Gaps = 26/168 (15%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++FI +L    T   L + F  F  F   ++    + K+     S+G+G++ F   + A
Sbjct: 138 TALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKK-----SLGYGYLNFGDPKDA 192

Query: 700 TAVISAMDGTVIDGHKIQLKLSHR----QGNAGSQEXXXXXXXXXXXXXLPFEATR---K 752
              +   +   I G +I++  S R    + N G+               LP + T+   +
Sbjct: 193 ENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTN---------VFFSNLPLDNTKLTTR 243

Query: 753 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQG 800
             ++ F  FG++ S ++ ++     +   F+ F     A+ A+ Q  G
Sbjct: 244 VFYDEFKKFGKILSCKLDRR-----KNIGFIYFENDAAAKEAIKQYNG 286

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T ++F+ +LN     + L   F+ F  F+ A V       Q  +  S G+GFV F  +E+
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD---MQTGR--SRGYGFVSFSNQEE 199

Query: 699 ATAVISAMDGTVIDGHKIQLKL-SHRQGNAGS 729
           A   + AM G  + G +I++   + R+ N G+
Sbjct: 200 AQKAMDAMQGKDLSGRQIRINWATKRERNMGN 231

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           Q  A+   T  LF+ ++     ++     F  +    + HV  D +TG S+G+ +V F+ 
Sbjct: 137 QQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSN 196

Query: 376 PEEAVQAYIELDKQIFQGRLLHI 398
            EEA +A   +  +   GR + I
Sbjct: 197 QEEAQKAMDAMQGKDLSGRQIRI 219

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 9/167 (5%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL+   T   L   F+  +G  +  VK   D   KN+ ++  + FVE+     A  
Sbjct: 60  LYVGNLDKSITEDLLKQYFQ--AGGPIQNVKIIED--MKNEYVN--YAFVEYIRSHDANV 113

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
            +  ++G  ++   +++  +     A   +             +  E T    F  F +F
Sbjct: 114 ALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDE-TLAGTFREFPTF 172

Query: 762 GQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
            Q   V    +  +S RG+ FV F   +EA+ AMD +QG  L GR++
Sbjct: 173 IQ-AHVMWDMQTGRS-RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQI 217

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 76/183 (41%), Gaps = 24/183 (13%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P  +I++ N++ K T + L + F       V QVK    PK K      GF F+EF +  
Sbjct: 4   PEATIYVGNIDTKVTKELLYELFTQ-----VGQVKKVKYPKDKISQEYQGFAFIEFFSTA 58

Query: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPF-EATRKDV-- 754
            A  V++ M+  V    K+   L  R+ N   Q+             LP  +   KD+  
Sbjct: 59  DADYVLNVMNNNVKLYQKV---LKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIAD 115

Query: 755 -------FELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQLQGVHLL 804
                   +LF+ FG L   + P+ F  S    R  AF+ F     A+ A+  L G  ++
Sbjct: 116 TVEVRHLTQLFSKFGPL--AKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIM 172

Query: 805 GRR 807
            ++
Sbjct: 173 NKK 175

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%)

Query: 342 KKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLH 397
           ++L  P+GE+  V V  +  TG S+G AYV F   E A QA   L+ + F   +LH
Sbjct: 202 RELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 85/191 (44%), Gaps = 29/191 (15%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVK------TKPD------PKQKN---KVLSM 686
           ++I NL+F TT + +T        F+V + K      T+ D      P  KN   ++ + 
Sbjct: 115 VWIGNLSFDTTKEDIT-------RFIVGKTKGTDVEITEEDLVRVNMPLAKNDGKQIKNK 167

Query: 687 GFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHR-QGNAGSQEXXXXXXXXXXX--- 742
           GF +V+F+T+EQ  A I  +  + ++G  + +K S   +G     +              
Sbjct: 168 GFCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRILF 226

Query: 743 -XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQG 800
              L F+ T + + + F   G++  +R+    D    +GFAFV+F   + A NA+     
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDKSC 286

Query: 801 VHLLGRRLVMQ 811
             + GR L M+
Sbjct: 287 RKIAGRPLRME 297

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+ N+ + +T++  +K F   GE+ ++ +A    +G  KGFA+V F   E A  A  + 
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 387 DKQIFQGRLLHI 398
             +   GR L +
Sbjct: 285 SCRKIAGRPLRM 296

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F TT + L   F+     V  ++ T  D  +       GF FV+F+ +E
Sbjct: 221 PSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGK-----CKGFAFVDFKNEE 275

Query: 698 QATAVISAMDGTVIDGHKIQLKL 720
            AT  +       I G  ++++ 
Sbjct: 276 GATNALKDKSCRKIAGRPLRMEF 298

>Scas_598.1
          Length = 516

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +LF+  + + +TED  K  FS YG + ++ +  D  TG S+GF ++ F
Sbjct: 201 KLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTF 248

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 8/77 (10%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
              +FI  LN++TT  +L D F  +   V  ++      K      S GFGF+ F     
Sbjct: 199 CCKLFIGGLNWETTEDKLKDYFSKYGNVVDLKIM-----KDNATGRSRGFGFLTFELSSS 253

Query: 699 ATAVISA---MDGTVID 712
              V+     +DG VID
Sbjct: 254 VDEVVKTQHILDGKVID 270

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAV---DTRTGNSKGFAYVLFAKPEEA 379
           KTG++F+  I       +F++ F+ +G + +  + +   D  TG S+GF ++ +    EA
Sbjct: 282 KTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEA 340

Query: 380 VQAYIELDKQIFQGRLLHILAA 401
           V    +     F+G+ + I  A
Sbjct: 341 VDRVCQNKYIDFKGKQIEIKRA 362

>Kwal_56.24709
          Length = 828

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%)

Query: 321 IQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAV 380
           +   G L++R I    T DD   +FS +G +  + +  D+ +G+S G+ ++ +    +A 
Sbjct: 237 LTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQAS 296

Query: 381 QAYIELDKQIFQGRLLHILAADEMKDHRLDEFD 413
           +   EL+  +  G  L I    E K+     +D
Sbjct: 297 RCIKELNGNLMNGSALFINYHVERKERERIHWD 329

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/98 (20%), Positives = 45/98 (45%), Gaps = 19/98 (19%)

Query: 320 KIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAV------------------DTR 361
           K Q+   L+++++  S  ++DF + +  +GE+    +                    +  
Sbjct: 605 KDQQESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPA 664

Query: 362 TGNSKGFAYVLFAKPEEAVQAYIELDK-QIFQGRLLHI 398
            G+SKG+ +V F  P +A +A +  D+ Q+ +   L++
Sbjct: 665 LGSSKGYGFVCFKNPLDASRAMMITDRYQVDENHTLYV 702

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 17/93 (18%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           Q++  +F+RN+ Y +T++  +  F  +G +K     +D  TG +KG A+V F K EEA  
Sbjct: 295 QESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAF-KTEEAFS 353

Query: 382 AYIE----------------LDKQIFQGRLLHI 398
             ++                L + +++GR+L I
Sbjct: 354 ECVDNAPSAASTSLLISDDVLPQYVYEGRILSI 386

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+R+I + + +++F   FS +  +K   +  D+    S+GF +V FA  ++  +A  + 
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSFAVEDDTKEALAQA 86

Query: 387 DKQIFQGRLLHI 398
            K  F+ RLL I
Sbjct: 87  RKAKFKNRLLRI 98

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           +PF+A  ++  + F+ F  +K   + K  +K +RGF FV F +  + + A+ Q +     
Sbjct: 33  IPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQARKAKFK 92

Query: 805 GRRL 808
            R L
Sbjct: 93  NRLL 96

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 35/187 (18%), Positives = 74/187 (39%), Gaps = 23/187 (12%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++F++++ F    ++  D F  F+  +   V  K   KQ     S GFGFV F  ++   
Sbjct: 27  TLFVRSIPFDANDEEFADFFSQFAP-IKHSVIVKDSEKQ-----SRGFGFVSFAVEDDTK 80

Query: 701 AVISAMDGTVIDGHKIQLKLS----------------HRQGNAGSQEXXXXXXXXXXXXX 744
             ++           +++ ++                H+     ++E             
Sbjct: 81  EALAQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRN 140

Query: 745 LPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           +P+      V + LF+ FG +   ++PKK      GFAFV        + A+++ + + +
Sbjct: 141 MPWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKI 200

Query: 804 LGRRLVM 810
            GR++ +
Sbjct: 201 DGRQVAI 207

>Kwal_27.11832
          Length = 686

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+R+I + +T+++    FS    +K   +  D +  NS+GF +V FA  ++   A  + 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQK-NSRGFGFVSFAVEDDTKDALDKA 81

Query: 387 DKQIFQGRLLHI 398
            K  F+GRLL +
Sbjct: 82  RKTKFKGRLLRV 93

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           +PF+AT +++   F++   +K   + K   K++RGF FV F +  + ++A+D+ +     
Sbjct: 28  IPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKARKTKFK 87

Query: 805 GRRL 808
           GR L
Sbjct: 88  GRLL 91

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 80/188 (42%), Gaps = 24/188 (12%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++F++++ F  T ++L + F   +    A V  K D  QKN   S GFGFV F  ++   
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHA-VIVKDD--QKN---SRGFGFVSFAVEDDTK 75

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQ--------GNAGSQEXXXXXXXXXX---------XX 743
             +     T   G  +++ ++ R+          AGS++                     
Sbjct: 76  DALDKARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 744 XLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVH 802
            +P+     D  + +F  +G +   ++PK+ D    GFAFV        + A+++ + + 
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 803 LLGRRLVM 810
           + GR++ +
Sbjct: 196 IGGRQVAV 203

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 15/90 (16%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK----------- 375
           +F+RN+ Y +T++  ++ F+ +G +K      D  TG +KG A+V+F             
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQEAFDECVNNA 352

Query: 376 PEEAVQAYIELD----KQIFQGRLLHILAA 401
           P     + +  D    + ++ GR+L I  A
Sbjct: 353 PASGTTSLLISDDVPYRYVYDGRILSIAPA 382

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 39/89 (43%), Gaps = 11/89 (12%)

Query: 1  MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60
          M  + V+ +P   T+ EL  +F+      HA            I+K+ +  SR F F+ +
Sbjct: 20 MKTLFVRSIPFDATDEELANYFSNLAPIKHAV-----------IVKDDQKNSRGFGFVSF 68

Query: 61 KNEQDALDAVNYFDGSFIYTSKIEVDMAK 89
            E D  DA++    +      + VD+AK
Sbjct: 69 AVEDDTKDALDKARKTKFKGRLLRVDIAK 97

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + Y   E + +K F  +GE++ V +  D  T   +G+A+VLF  PE + +AY E+
Sbjct: 109 IFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREI 168

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 10/93 (10%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           RLF+R       E +  ++F P+G +KEV +          GFA+V F + E A +A  E
Sbjct: 106 RLFVRPFPLDVQESELNEIFGPFGAMKEVKIL--------NGFAFVEFEEAESASKAIEE 157

Query: 386 LDKQIFQGRLLHILAADEMKDHRLDEFDLKNMP 418
           ++ + F  + L ++ + +M   R     LKN+P
Sbjct: 158 VNGKTFANQPLEVMFS-KMPVKRF-RITLKNLP 188

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 22/90 (24%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSA---------- 563
           + V+ FP      EL E+F PFG ++ + +      A V+F +  S   A          
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKI--LNGFAFVEFEEAESASKAIEEVNGKTFA 164

Query: 564 -------FSKLAFKRFKGTVIYLEKGPKDC 586
                  FSK+  KRF+   I L+  P+ C
Sbjct: 165 NQPLEVMFSKMPVKRFR---ITLKNLPEGC 191

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 12/68 (17%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
            P +    ++ E+F  FG +K V++         GFAFVEF   +EAE+A   ++ V+  
Sbjct: 112 FPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEF---EEAESASKAIEEVN-- 159

Query: 805 GRRLVMQP 812
           G+    QP
Sbjct: 160 GKTFANQP 167

>Scas_671.4
          Length = 443

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T ++F+ +LN     + L+  F  F  +V A V       Q  +  S G+GFV F  +EQ
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWD---MQTGR--SRGYGFVSFADQEQ 224

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQ 724
           A   ++ M G  I+G  +++  + ++
Sbjct: 225 AQEAMNVMQGMPINGRAVRINWATKR 250

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 72/167 (43%), Gaps = 9/167 (5%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL+       L   F+V  G  +  VK   D K  N    + + F+E+     A  
Sbjct: 85  LYVGNLDKSINEDLLKQYFQV--GGQITDVKIMVDKKNNN----VNYAFIEYLKSHDANV 138

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
            +  ++G  I+G  +++  + +     + +             +  E T    F+ F S+
Sbjct: 139 ALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDE-TLSHAFDQFPSY 197

Query: 762 GQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
            Q   V    +  +S RG+ FV F   ++A+ AM+ +QG+ + GR +
Sbjct: 198 VQ-AHVMWDMQTGRS-RGYGFVSFADQEQAQEAMNVMQGMPINGRAV 242

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 35/75 (46%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T  LF+ ++     ++     F  +    + HV  D +TG S+G+ +V FA  E+A +A 
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229

Query: 384 IELDKQIFQGRLLHI 398
             +      GR + I
Sbjct: 230 NVMQGMPINGRAVRI 244

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 18  LQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSF 77
           L K  N+ L+  +    V G ITD++I+ +++  +  +AFI Y    DA  A+   +G  
Sbjct: 90  LDKSINEDLLKQYF--QVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLNGIQ 147

Query: 78  IYTSKIEVDMA 88
           I    + ++ A
Sbjct: 148 IEGKTVRINWA 158

>Scas_558.1
          Length = 435

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 78/210 (37%), Gaps = 54/210 (25%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           IF+ NL +    Q L D FK     + A V+     +      S GFG V FRT++    
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELDRAGR------SRGFGTVIFRTRDDMER 276

Query: 702 VISA-----MDGTVID---GHKIQ----LKLSHRQGNAGSQEXXXXXXXXXXX------- 742
            I       +DG  +D   GH       + + H+  NA + +                  
Sbjct: 277 AIDRYNRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSE 336

Query: 743 -------------------------XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA 777
                                      LP    R D+++LF S G++++  +  K+D++ 
Sbjct: 337 PASNRTSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGKVRNAEL--KYDRNG 394

Query: 778 R--GFAFVEFVLPKEAENAMDQLQGVHLLG 805
              G A VEF+   +A+  +++L   +  G
Sbjct: 395 ETTGVAIVEFISQDDADVCIERLNKYNYGG 424

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ YS      K +F   G++    V +D R G S+GF  V+F   ++  +A    
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRY 281

Query: 387 DKQIFQGRLLHI 398
           ++    GR L +
Sbjct: 282 NRFEVDGRTLDV 293

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T RL ++       E +  ++FSPYG LKEV +          GFA+V F KPE A QA 
Sbjct: 36  TTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLM--------SGFAFVEFEKPESAEQAI 87

Query: 384 IELDKQIF 391
            +++ ++F
Sbjct: 88  KDVNGKMF 95

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 7/56 (12%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQG 800
            P +    ++ E+F+ +G LK V++         GFAFVEF  P+ AE A+  + G
Sbjct: 44  FPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKDVNG 92

>Kwal_47.18572
          Length = 363

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T RLF+R   +   + +  ++F P+G +KEV +          GFA+V F + + A +A 
Sbjct: 81  TTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKIL--------NGFAFVEFEEADSAARAI 132

Query: 384 IELDKQIFQGRLLHIL 399
            E++ + F  + L ++
Sbjct: 133 EEVNGKTFANQPLEVV 148

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 12/68 (17%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
            PF+    ++ E+F  FG +K V++         GFAFVEF   +EA++A   ++ V+  
Sbjct: 89  FPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEF---EEADSAARAIEEVN-- 136

Query: 805 GRRLVMQP 812
           G+    QP
Sbjct: 137 GKTFANQP 144

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRF 572
           + V+ FPF     EL E+F PFG ++ + +      A V+F +  S   A  ++  K F
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKI--LNGFAFVEFEEADSAARAIEEVNGKTF 140

>Kwal_0.250
          Length = 216

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ YS++    K LF   G      V +D R G SKGF  V+F   +EA  A  + 
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFETIDEARTALDKF 120

Query: 387 DKQIFQGRLLHI 398
                +GR+L +
Sbjct: 121 QHFDLEGRILEL 132

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 67/170 (39%), Gaps = 33/170 (19%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P   IFI NL + T+ Q L D FK       A VK   + + K      GFG V F T +
Sbjct: 58  PGYEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSK------GFGTVIFETID 111

Query: 698 QATAVISAMDGTVIDGHKIQLK--------------------LSHRQGNAGSQEXXXXXX 737
           +A   +       ++G  ++LK                    ++ +  NA  +       
Sbjct: 112 EARTALDKFQHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGE---GHKS 168

Query: 738 XXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEF 785
                  LP+   + D+++LF + G ++  R   K+D+  +  G A V +
Sbjct: 169 NTIYVDNLPYATAQSDLYDLFETIGVVE--RAELKYDRKVKPTGAAIVSY 216

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 55/134 (41%), Gaps = 13/134 (9%)

Query: 689 GFVEFRTKEQATAVISAMDGTVIDGHKIQLK------LSHRQGNAGSQEXXXXXXXXXXX 742
           G VEF   E  +  I   DG    G ++ ++       S R   +G+++           
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYE 61

Query: 743 ---XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEFVLPKEAENAMDQ 797
                LP+  + + + +LF + G     R   K D++ R  GF  V F    EA  A+D+
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGN--PTRADVKLDRNGRSKGFGTVIFETIDEARTALDK 119

Query: 798 LQGVHLLGRRLVMQ 811
            Q   L GR L ++
Sbjct: 120 FQHFDLEGRILELK 133

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+ N+ + +T++  KK F   GE+ ++ +A    +G  KGFA+V F     A  A  + 
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 387 DKQIFQGRLLHI-LAADEMKDH 407
             +   GR L +    D  K H
Sbjct: 278 SCRAIAGRPLRMEYGEDRSKRH 299

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 5/81 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F TT + L   F+     V  ++ T  D  +       GF FV+FR + 
Sbjct: 214 PSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGK-----CKGFAFVDFRDEA 268

Query: 698 QATAVISAMDGTVIDGHKIQL 718
            ATA ++      I G  +++
Sbjct: 269 GATAALTDRSCRAIAGRPLRM 289

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 80/193 (41%), Gaps = 32/193 (16%)

Query: 642 IFIKNLNFKTTSQQLTDRFKV--FSGFVVAQVKTKPD------PKQKN---KVLSMGFGF 690
           ++I N+ F TT ++L  RF V   +G    +V T  D      P  KN   ++ + GF +
Sbjct: 107 VWIGNMAFDTTQEELR-RFVVSKTAGMEAGEV-TDADIVRVNMPLAKNDGKQIKNKGFAY 164

Query: 691 VEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLP---- 746
           V+F T  Q  AVI  +    ++G  + +K      NA S +              P    
Sbjct: 165 VDFATSAQMDAVI-GLSEAQLNGRNLLIK------NAKSYDGRPAKNDLISMSKNPPSRI 217

Query: 747 -------FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQL 798
                  F+ T + + + F   G++  +R+    D    +GFAFV+F     A  A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 799 QGVHLLGRRLVMQ 811
               + GR L M+
Sbjct: 278 SCRAIAGRPLRME 290

>Scas_316.1
          Length = 483

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+RN+ Y +TE+     FS +G++K     +D  TG +KG A+V F
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAF 290

>Kwal_26.7179
          Length = 456

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 3/81 (3%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ +  TE++  K F   G+++ V +  D++T   KGFAYV F +  + V   + L
Sbjct: 295 VFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQF-RDFQTVNKALLL 353

Query: 387 DKQIFQ--GRLLHILAADEMK 405
           D Q     GR L +     MK
Sbjct: 354 DGQKLNGTGRKLRVTRCKNMK 374

>Kwal_27.11447
          Length = 439

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 74/185 (40%), Gaps = 46/185 (24%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL+   T   L   F+V  G  +A VK   D   K       + FVEF     A+ 
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQV--GGAIANVKILMDKNNKEA----NYAFVEFHQPHDASV 117

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF--- 758
               +DG  I+ H I++  + +     SQ                 + + +D F LF   
Sbjct: 118 AFQTLDGKQIENHVIKINYAFQ-----SQ-----------------QVSSEDTFNLFVGD 155

Query: 759 -----------NSFGQLKS-VRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQLQGVHL 803
                      N+F  + + ++    +D     +RG+ FV F    +A+ AM++ QG  +
Sbjct: 156 LNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVV 215

Query: 804 LGRRL 808
            GR +
Sbjct: 216 NGRAI 220

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 5/85 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T ++F+ +LN     + L + FK    F+ A V       Q  +  S G+GFV F  + Q
Sbjct: 148 TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWD---MQTGR--SRGYGFVSFGEQVQ 202

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHR 723
           A   +    GTV++G  I++  + +
Sbjct: 203 AQKAMEEKQGTVVNGRAIRINWASK 227

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNE 63
           + V  L + +TE  L+++F            V G I +++IL ++  K   +AF+ +   
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQ-----------VGGAIANVKILMDKNNKEANYAFVEFHQP 112

Query: 64  QDALDAVNYFDGSFIYTSKIEVDMA 88
            DA  A    DG  I    I+++ A
Sbjct: 113 HDASVAFQTLDGKQIENHVIKINYA 137

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAY 383
           T  LF+ ++     ++     F       + HV  D +TG S+G+ +V F +  +A +A 
Sbjct: 148 TFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAM 207

Query: 384 IELDKQIFQGRLLHI 398
            E    +  GR + I
Sbjct: 208 EEKQGTVVNGRAIRI 222

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 31/47 (65%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+  + Y  TE + +K FS +GE+++V V  D  T  S+G+A+++F
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVF 105

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 43/72 (59%), Gaps = 8/72 (11%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQL--- 798
           LP+E T  ++ + F+ FG+++ VRV +  DKS   +RG+AF+ F     +  A  ++   
Sbjct: 64  LPYEVTEVELQKHFSRFGEIEKVRVVR--DKSTSKSRGYAFIVFRDETGSRAACKEIGVH 121

Query: 799 QGVHLLGRRLVM 810
           +G+ + GR +++
Sbjct: 122 RGLDIQGRSVIV 133

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 12/68 (17%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGYKN 62
           V +  LP  +TE ELQKHF++            G I  +R+++++   KSR +AFI +++
Sbjct: 59  VFIGRLPYEVTEVELQKHFSR-----------FGEIEKVRVVRDKSTSKSRGYAFIVFRD 107

Query: 63  EQDALDAV 70
           E  +  A 
Sbjct: 108 ETGSRAAC 115

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 320 KIQKTG-RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEE 378
           K QK G  L + N+ YS +    K +F  +G++ + +V VD+ TG S G   V+F   E+
Sbjct: 211 KPQKKGYELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDS-TGMSIGVGNVIFKNQED 269

Query: 379 AVQAYIELDKQIFQGRLLHI 398
            V+AY   +    +G++L +
Sbjct: 270 MVKAYEHFNGFEIEGKVLEV 289

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 7/78 (8%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T SIF+ NL +  T + L D F      V A + T       ++    G G VEF + E+
Sbjct: 106 TNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-------SRGHHRGMGTVEFTSGEE 158

Query: 699 ATAVISAMDGTVIDGHKI 716
               I   DG  +   +I
Sbjct: 159 VDEAIRKFDGAYLMNRQI 176

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 39/67 (58%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           Q + +  K+  +++ N+ + ++E+   +LFS  G +K + + +D       GF +++++ 
Sbjct: 37  QELRESMKSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSC 96

Query: 376 PEEAVQA 382
           P+EA+ A
Sbjct: 97  PDEALNA 103

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           L F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P EA NA+  L    L
Sbjct: 53  LSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTKL 112

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           LF+ N+ + +TED  +K F   GE+  + +A    TG  KGFA++ F
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDF 275

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 82/199 (41%), Gaps = 43/199 (21%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVK--------TKPD------PKQKN---KVL 684
           +++ N+ F T  + +         F+VA+ K        T+ D      P  KN   K+ 
Sbjct: 117 VWVGNMAFDTVKEDIIR-------FIVAKTKENDEGGAITEKDIVRINMPLTKNDNKKLR 169

Query: 685 SMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXX 744
           + GF +++F+T++Q  AV+  +  + ++G  + +K      NAGS E             
Sbjct: 170 NKGFAYIDFKTEKQMEAVV-GLSESALNGRNLLIK------NAGSYEGRPDKNDLVAASK 222

Query: 745 LP-----------FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAE 792
            P           F+ T   + + F   G++  +R+    D    +GFAF++F     A 
Sbjct: 223 NPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGAT 282

Query: 793 NAMDQLQGVHLLGRRLVMQ 811
           NA+       +  R + M+
Sbjct: 283 NALKDKSCRKIASRPIRME 301

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/178 (19%), Positives = 73/178 (41%), Gaps = 26/178 (14%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V++FI +L+ + T + L D F  +   V  ++      K+     S+G+G++ F   E A
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKR-----SLGYGYINFSNDEDA 156

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQG----NAGSQEXXXXXXXXXXXXXLPFE---ATRK 752
                  +   + G ++++  S R      N G+               LP E    T +
Sbjct: 157 EKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGTN---------VFFSNLPLENLSLTTR 207

Query: 753 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
             ++ F  +G++ S ++ ++     +   F+ F     A++A+D   G    G  ++ 
Sbjct: 208 AFYDTFKKYGKILSCKLDRR-----KNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMC 260

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F++N+  ++ EDD    FS  G +K V  +   +  +S  +A+V + K  +  +A  +L
Sbjct: 314 IFVKNLPVNANEDDILDFFSRIGPVKSVFTSKVPKYNSS--WAFVTYKKGSDTSEAIEKL 371

Query: 387 DKQIFQGRLLHILAADEMKDH 407
           + +IF+ R + +  A +   H
Sbjct: 372 NGEIFKHRKIEVARAQKNFQH 392

>Scas_697.10
          Length = 610

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 70/178 (39%), Gaps = 21/178 (11%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P  ++FI +LN   T + L   F V+  FV A+V       Q N  +S+G G++ F  KE
Sbjct: 99  PFTALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDF---QTN--VSLGHGYLNFGDKE 153

Query: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATR----KD 753
            A   I   +   +    I++  S R  N                  LP E  R    + 
Sbjct: 154 DAEKAIDDFNCMKLGDKVIRIMPSLRGKNT-----KKSIGTNVFFTNLPDEDNRLFHSRK 208

Query: 754 VFELFNSFGQLKSVRV-PKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
            FE+F  FG++ S R+ P K         F+ F   + A+  + +       G R+  
Sbjct: 209 FFEIFRQFGKILSCRLDPNK------NIGFISFEHEEVAKTVVKKYNNSMFFGNRITC 260

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 12/85 (14%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNE 63
           V V  LP  +T  E++ HFNK         N+  L    +I  N       +AF+ Y   
Sbjct: 313 VFVSNLPTSITVEEIRNHFNK-------IGNIMNLFISDKISSN-----ALWAFVKYSTA 360

Query: 64  QDALDAVNYFDGSFIYTSKIEVDMA 88
             A+ A+   + +FI   +I V  A
Sbjct: 361 ACAIRAIKELNNTFIRKKQIVVSQA 385

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+RN+ Y +TE+     FS +G +K     +D  TG +KG A+V F
Sbjct: 292 VFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAF 338

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+R+I    T++     FS +  +K   V  DT    S+GF +V FA  ++  +A  + 
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAKA 86

Query: 387 DKQIFQGRLLHI 398
            K  F G +L +
Sbjct: 87  RKTKFNGHILRV 98

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 76/202 (37%), Gaps = 40/202 (19%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++F++++    T +QL D F  F+    A V      K  NK  S GFGFV F  ++   
Sbjct: 27  TLFVRSIPQDVTDEQLADFFSNFAPIKHAVV-----VKDTNK-RSRGFGFVSFAVEDDTK 80

Query: 701 AVISAMDGTVIDGHKIQLKLSHR------------------------QGNAGSQEXXXXX 736
             ++    T  +GH +++ ++ R                        Q N    +     
Sbjct: 81  EALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGED 140

Query: 737 XXXXXXXXL-----PFEATRKDVFEL---FNSFGQLKSVRVPKKFDKSARGFAFVEFVLP 788
                   L     P+    +D  +L   F  +G +    +P+K D    GFAFV     
Sbjct: 141 SMLKGKPKLIIRNMPWSC--RDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKI 198

Query: 789 KEAENAMDQLQGVHLLGRRLVM 810
                A++  + + + GR++ +
Sbjct: 199 SNCRIALENTKDLKIDGRKVAV 220

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 499 KFSNLKSPSQRDDRVILVKNFPFGTTREELGELFVPFGKLERLL 542
           K S  K+ ++R+D  + V+N P+  T E L   F  FG ++  L
Sbjct: 277 KESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYAL 320

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 12/94 (12%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           RLF+R       E +  ++F P+G +KEV +          GFA+V F + E A +A  E
Sbjct: 126 RLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGFAFVEFEEAESAAKAIEE 177

Query: 386 LDKQIFQGRLLHILAAD-EMKDHRLDEFDLKNMP 418
           +  + F  + L ++ +    K +R+    +KN+P
Sbjct: 178 VHGKSFANQPLEVVYSKLPAKRYRI---TMKNLP 208

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 39/86 (45%), Gaps = 12/86 (13%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
            P +    ++ E+F  FG +K V++         GFAFVEF   +EAE+A   ++ VH  
Sbjct: 132 FPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEF---EEAESAAKAIEEVH-- 179

Query: 805 GRRLVMQPXXXXXXXXXXXXXRMTKK 830
           G+    QP             R+T K
Sbjct: 180 GKSFANQPLEVVYSKLPAKRYRITMK 205

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 37/86 (43%), Gaps = 19/86 (22%)

Query: 514 ILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSA---------- 563
           + V+ FP      EL E+F PFG ++ + +      A V+F +  S   A          
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKI--LNGFAFVEFEEAESAAKAIEEVHGKSFA 184

Query: 564 -------FSKLAFKRFKGTVIYLEKG 582
                  +SKL  KR++ T+  L +G
Sbjct: 185 NQPLEVVYSKLPAKRYRITMKNLPEG 210

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 14/89 (15%)

Query: 8   GLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGYKNEQDA 66
           GL + LTE ++   F++            G+ TDL+++++RE G+SR F F+ Y++++  
Sbjct: 40  GLNVELTEGDILTVFSQF-----------GVPTDLKLVRDRETGESRGFGFLKYEDQRST 88

Query: 67  LDAVNYFDGSFIYTSKIEVDMAKSFADPR 95
           + AV+  +G  +    ++VD    F +PR
Sbjct: 89  VLAVDNLNGVNLCGRVLKVD--HCFYEPR 115

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 745 LPFEATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGV 801
           L  E T  D+  +F+ FG    LK VR   +    +RGF F+++   +    A+D L GV
Sbjct: 41  LNVELTEGDILTVFSQFGVPTDLKLVR--DRETGESRGFGFLKYEDQRSTVLAVDNLNGV 98

Query: 802 HLLGRRL 808
           +L GR L
Sbjct: 99  NLCGRVL 105

 Score = 32.7 bits (73), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%)

Query: 337 TEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLL 396
           TE D   +FS +G   ++ +  D  TG S+GF ++ +      V A   L+     GR+L
Sbjct: 46  TEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVL 105

Query: 397 HI 398
            +
Sbjct: 106 KV 107

>Kwal_33.14463
          Length = 393

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+ N+ + +T++  KK F   G++ ++ +A    TG  KGFA+V F   E    A  + 
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 387 DKQIFQGRLLHI 398
             +   GR L +
Sbjct: 297 TCRKIAGRPLRM 308

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F TT + L   F+     V  ++ T  D  +       GF FV+F+ +E
Sbjct: 233 PSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGK-----CKGFAFVDFKDEE 287

Query: 698 QATAVISAMDGTVIDGHKIQLKL 720
             T  +       I G  ++++ 
Sbjct: 288 GPTNALKDKTCRKIAGRPLRMEF 310

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 79/197 (40%), Gaps = 39/197 (19%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVK--------------------TKPDPKQ-K 680
           ++I NL+F T+ + L         F VA+ K                     + D KQ K
Sbjct: 125 VWIGNLSFDTSKEDLC-------RFFVAKTKELDESCRIEESDIVRVNLPLAQNDGKQIK 177

Query: 681 NKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHR-QGNAGSQEXXXXXXXX 739
           NK    GF  + F+T+EQ  AV+ A+  + ++G  + +K S    G     +        
Sbjct: 178 NK----GFAHMNFKTQEQMNAVV-ALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNP 232

Query: 740 XXX----XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENA 794
                    L F+ T + + + F   G +  +R+    D    +GFAFV+F   +   NA
Sbjct: 233 PSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNA 292

Query: 795 MDQLQGVHLLGRRLVMQ 811
           +       + GR L M+
Sbjct: 293 LKDKTCRKIAGRPLRME 309

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++L +I Y  TE+    L S  G +  + +  D++TG SKG+A+V +   E +  A   L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 387 DKQIFQGRLLHI 398
           +      RLL  
Sbjct: 78  NGYQLGSRLLKC 89

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 41/68 (60%), Gaps = 6/68 (8%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQLQGV 801
           +P++ T + + +L ++ G + S+++   FD     ++G+AFV++   + + +A+  L G 
Sbjct: 23  IPYDQTEEQILDLCSNVGPVVSLKM--MFDSQTGKSKGYAFVQYQDLESSASAVRNLNG- 79

Query: 802 HLLGRRLV 809
           + LG RL+
Sbjct: 80  YQLGSRLL 87

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+ N+ +   E+   K F P G+++ V +  D++T   KGFAYV F
Sbjct: 281 IFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQF 327

>Kwal_0.370
          Length = 560

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/152 (21%), Positives = 64/152 (42%), Gaps = 26/152 (17%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           S+FI +L+   T + L D F+VF   +  ++    +       +S+G+G++ F + + A 
Sbjct: 16  SLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETG-----ISLGYGYLNFYSSKDAE 70

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQG----NAGSQEXXXXXXXXXXXXXLPFE---ATRKD 753
             I       + G ++++  S R      N G+               LP E    T + 
Sbjct: 71  TAIETFSYVNLFGREVRIMPSMRNSYFRKNIGTN---------VFFSNLPLEQPALTTRV 121

Query: 754 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEF 785
            +E F  +G++ S ++ ++     +   FV F
Sbjct: 122 FYETFREYGKVLSCKLDRR-----KNIGFVYF 148

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           LPF    +D+   F+  G +KSV    K +     + FV +    +   A+D L G   +
Sbjct: 232 LPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIFM 290

Query: 805 GRRL 808
            RRL
Sbjct: 291 DRRL 294

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 36/80 (45%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQ 381
           QK   LF+ ++  + TE      F  +  L  V + VD+ TG S G+ Y+ F   ++A  
Sbjct: 12  QKVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAET 71

Query: 382 AYIELDKQIFQGRLLHILAA 401
           A          GR + I+ +
Sbjct: 72  AIETFSYVNLFGREVRIMPS 91

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 749 ATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLGRR 807
            T K + + F  F  L SV++    +   + G+ ++ F   K+AE A++    V+L GR 
Sbjct: 26  VTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIETFSYVNLFGRE 85

Query: 808 LVMQP 812
           + + P
Sbjct: 86  VRIMP 90

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +F+  LN  T +  L   F  F       V +    + ++   S+G+GFVEF TK     
Sbjct: 232 LFVCKLNPLTRAADLATVFAQF-----GHVNSVEIIRDRDSGRSLGYGFVEFATKAACEL 286

Query: 702 VISAMDGTVIDGHKIQLKLS 721
             + MDG +ID  ++ +  S
Sbjct: 287 AYTKMDGALIDDRRVHVDFS 306

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 66/168 (39%), Gaps = 12/168 (7%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL+       L   F+V  G  +A VK   D   +       + FVE+R    A  
Sbjct: 37  LYVGNLDKTINEATLKQYFQV--GGPIANVKVLVDKNNE----EANYAFVEYRQPRDANV 90

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
               +DG  I+ + I++  + +     SQ+             L  +   + +   F  F
Sbjct: 91  AFQTLDGKQIENNVIKINWAFQ-----SQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEF 145

Query: 762 GQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
                  V        +RG+ FV F   +EA+ AMD  QG +L GR +
Sbjct: 146 PTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAI 193

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T ++F+ +LN     + L+  FK F  F+ A V       Q  +  S G+GFV F  +E+
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWD---MQSGR--SRGYGFVSFGEQEE 175

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQ 724
           A   + A  G  ++G  I++  + ++
Sbjct: 176 AQKAMDAKQGFNLNGRAIRVNWAAKR 201

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 324 TGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           T  LF+ ++     ++     F  +    + HV  D ++G S+G+ +V F + EEA +A
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKA 179

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%)

Query: 35  VDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMA 88
           V G I ++++L ++  +   +AF+ Y+  +DA  A    DG  I  + I+++ A
Sbjct: 57  VGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLDGKQIENNVIKINWA 110

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           LP +    +V + F ++GQL  V+V +  D   R +AFV+++  K+A++A+    G  L 
Sbjct: 106 LPDDQLCMNVTKHFQNYGQLVGVKVLR--DDHNRPYAFVQYINDKDAKHALKNASGTVLN 163

Query: 805 GRRL 808
           GR+L
Sbjct: 164 GRKL 167

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 43/82 (52%)

Query: 317 AIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
           A++K   +  LF+ N+ + +T++  +K F   GE+ +V +A    +G  KGFA++ F   
Sbjct: 221 AMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDE 280

Query: 377 EEAVQAYIELDKQIFQGRLLHI 398
           +   +A  +   +   GR L +
Sbjct: 281 KGPTEALTDKSCRKIAGRPLRM 302

 Score = 36.6 bits (83), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 7/136 (5%)

Query: 682 KVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLK-LSHRQGNAGSQEXXXXXXXXX 740
           K+ + GF +++F+ KEQ  AVI  +  + ++G  + +K  S  +G     +         
Sbjct: 169 KIRNKGFAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPP 227

Query: 741 XX----XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAM 795
                   L F+ T + + + F   G++  VR+    D    +GFAF++F   K    A+
Sbjct: 228 SRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEAL 287

Query: 796 DQLQGVHLLGRRLVMQ 811
                  + GR L M+
Sbjct: 288 TDKSCRKIAGRPLRME 303

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 39/83 (46%), Gaps = 5/83 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F TT + L   F+     V  ++ T  D  +       GF F++F+ ++
Sbjct: 227 PSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGK-----CKGFAFIDFKDEK 281

Query: 698 QATAVISAMDGTVIDGHKIQLKL 720
             T  ++      I G  ++++ 
Sbjct: 282 GPTEALTDKSCRKIAGRPLRMEF 304

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 8/80 (10%)

Query: 326 RLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           RLF++      T+ + K++F P+G LKE+ +          GFA+V F + E A QA   
Sbjct: 53  RLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL--------NGFAFVEFEEAESASQAIQN 104

Query: 386 LDKQIFQGRLLHILAADEMK 405
           +  ++F    L ++ + ++K
Sbjct: 105 VAGKMFADYPLEVVFSKKLK 124

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 2/62 (3%)

Query: 511 DRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFK 570
           D  + VK FP   T  E+ E+F PFG L+ + +      A V+F +  S   A   +A K
Sbjct: 51  DTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI--LNGFAFVEFEEAESASQAIQNVAGK 108

Query: 571 RF 572
            F
Sbjct: 109 MF 110

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 10/57 (17%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGV 801
            P + T  ++ E+F  FG LK +++         GFAFVEF   +EAE+A   +Q V
Sbjct: 59  FPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEF---EEAESASQAIQNV 105

>Scas_696.32
          Length = 445

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/113 (21%), Positives = 55/113 (48%), Gaps = 5/113 (4%)

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXL-P 746
           F +V+  T  +AT +++ ++   ID +K+  K+S     +   +             L P
Sbjct: 154 FAYVDVCTSNEATNMVNNLNNKEIDNYKLVAKMSDPSQRSKRSDAAAIERRELIIRNLDP 213

Query: 747 FEATRKDVFELFNSFGQLKSVRVPKKFDKSA----RGFAFVEFVLPKEAENAM 795
                 ++  +F + G+++S+ +PKK ++++     G AF+ F+   +A +A+
Sbjct: 214 SSIDEGELRNMFGTLGEIESINIPKKQEENSNQYTNGVAFITFLNSDDAHSAL 266

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 76/201 (37%), Gaps = 37/201 (18%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++F++++    T +QL D F  F+    A V    + K      S GFGFV F  ++   
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKK------SRGFGFVSFAVEDDTK 76

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXX---------------- 744
             +     T +DG ++++ ++ R+  +G  E                             
Sbjct: 77  IALKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDE 136

Query: 745 --------------LPFEATR-KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPK 789
                         +P+       + ++F  +G +    +P+K D    GFAFV      
Sbjct: 137 SSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKIS 196

Query: 790 EAENAMDQLQGVHLLGRRLVM 810
             + A++  + + + GR++ +
Sbjct: 197 NCKKALEDTKNLTIDGRKVAV 217

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+RN+ Y +TE+     FS +G +K     +D  TG +KG A+V F
Sbjct: 292 VFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAF 338

>Scas_376.1
          Length = 404

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           LF+ N+ + +T++  KK F   GE+ ++ +A    +G  KGFA++ F   E A  A
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA 295

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F TT + L   F+     V  ++ T  D  +       GF F++FR++E
Sbjct: 236 PSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGK-----CKGFAFIDFRSEE 290

Query: 698 QATAVI 703
            AT  +
Sbjct: 291 GATNAL 296

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 16/185 (8%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFS-----GFV----VAQVKTKPDPKQKNKVLSMGFGFVE 692
           ++I NL F TT ++L   F   +     G V    + +V          K+ + GF +++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 693 FRTKEQATAVISAMDGTVIDGHKIQLKLSHR-QGNAGSQEXXXXXXXXXXXX----XLPF 747
           F+T EQ  ++I  +  + ++G  + +K S   +G     +                 L F
Sbjct: 189 FKTNEQMESIIK-LSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSF 247

Query: 748 EATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           + T + + + F   G++  +R+    D    +GFAF++F   + A NA+       +  R
Sbjct: 248 DTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCRKIAAR 307

Query: 807 RLVMQ 811
            + M+
Sbjct: 308 PIRME 312

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%)

Query: 321 IQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAV 380
           +   G L++R I    + DD   +FS +G +  + + +D  T  S G+ ++ +    +A 
Sbjct: 213 LTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAA 272

Query: 381 QAYIELDKQIFQGRLLHI 398
           +   EL+  +  G  L I
Sbjct: 273 RCIKELNGNLMNGSPLFI 290

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 754 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQP 812
           V E F  +G L  V+V +  D + R +AFV++    +A++A+ + QG  L GRRL  +P
Sbjct: 113 VTENFKKYGDLARVKVLR--DNANRPYAFVQYNNDHDAKHALIRAQGTLLNGRRLRCEP 169

>Scas_643.16
          Length = 448

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 10/89 (11%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ +   E++    F   GE++ V +  D +T   KGFAYV F + E   +A +  
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 387 DKQIF----------QGRLLHILAADEMK 405
           +KQ+           +GR L +     M+
Sbjct: 337 EKQMTKIKTDKDNKKKGRKLRVTRCKNMR 365

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 5/54 (9%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFR 694
           SIF+ NL+F+   + L + FK  S   +  V+   DPK     +  GF +V+F+
Sbjct: 276 SIFVGNLDFEEDEENLWNHFK--SCGEIEYVRIIRDPKTN---MGKGFAYVQFK 324

>Kwal_27.11096
          Length = 201

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 37/65 (56%)

Query: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377
           + +  ++  +++ N+ + ++E+   +LFS  G +K + + +D       GF +V++  PE
Sbjct: 39  LRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPE 98

Query: 378 EAVQA 382
           EA+ A
Sbjct: 99  EALNA 103

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           + +I++ NL+F T+ +Q+ + F   SG V+ ++    D   + K    GF FV + T E+
Sbjct: 45  SATIYVGNLSFYTSEEQIYELFSK-SG-VIKRIIMGLD---RFKFTPCGFCFVIYNTPEE 99

Query: 699 ATAVISAMDGTVIDGHKIQLKL 720
           A   +  +  T +D   I L L
Sbjct: 100 ALNAVKYLSDTKLDDRNISLDL 121

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           L F  + + ++ELF+  G +K + +   +F  +  GF FV +  P+EA NA+  L    L
Sbjct: 53  LSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYLSDTKL 112

Query: 804 LGRRLVM 810
             R + +
Sbjct: 113 DDRNISL 119

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 342 KKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLH 397
           ++L  P+G + +V V  +T TG S+G +Y+ F   E A  A   LD + F   +LH
Sbjct: 216 QELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNLILH 271

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +++ N+    TE D   +FS YG   +V ++ D  TG S+GFAY+ +      + A   L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 387 DKQIFQGRLLHI 398
           +     GR L I
Sbjct: 93  NGFKIGGRALKI 104

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 327 LFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSK----GFAYVLFAKPEEAVQ 381
           +F+R +  Y  +     KL   YG ++ V +     + NS     GFA+V +   EE+ Q
Sbjct: 278 IFIRKLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTN-EESAQ 336

Query: 382 AYIELDKQIFQGRLLHILAAD 402
             +EL+  +F+GR+L +  AD
Sbjct: 337 KALELNMSVFEGRVLAVSIAD 357

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 757 LFNSFG-QLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQ 811
           LF+ +G  + SVR+P  KFD S R FA+++F    EA  AM +L      G  LV++
Sbjct: 202 LFSQYGGSVLSVRLPSLKFD-SNRRFAYIDFASSDEANTAMSKLNNTSHDGYILVVK 257

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/115 (20%), Positives = 52/115 (45%), Gaps = 6/115 (5%)

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPF 747
           F +++F + ++A   +S ++ T  DG+ + +K S+    +   +             L F
Sbjct: 226 FAYIDFASSDEANTAMSKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKLDF 285

Query: 748 -EATRKDVFELFNSFGQLKSVRVPKKFD-----KSARGFAFVEFVLPKEAENAMD 796
            + +   + +L   +G ++ V +P   D     K   GFAFV +   + A+ A++
Sbjct: 286 YKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE 340

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPY-GELKEVHVAVDTRTGNSKGFAYVLFA 374
           + +    K   L++ N   +ST +  K LFS Y G +  V +    +  +++ FAY+ FA
Sbjct: 174 EIVVNFLKDATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLP-SLKFDSNRRFAYIDFA 232

Query: 375 KPEEAVQAYIELDKQIFQGRLL 396
             +EA  A  +L+     G +L
Sbjct: 233 SSDEANTAMSKLNNTSHDGYIL 254

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ +  +E+   K F   G ++ V +  D +T   KGFAYV FA      +A +  
Sbjct: 261 VFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLLN 320

Query: 387 DKQ--IFQGRLLHILAADEMK 405
           DK+  + +GR L +     M+
Sbjct: 321 DKKMAVGKGRKLRVTRCRNMQ 341

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/200 (21%), Positives = 77/200 (38%), Gaps = 37/200 (18%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P   +FI NL +  T Q L D F+     + A ++       +N   S GFG V + T+E
Sbjct: 220 PMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIEL-----DRNG-FSRGFGTVFYGTQE 273

Query: 698 QATAVISAMDGTVIDGHKIQLK------------------------LSHRQGNAGSQEXX 733
           +    I   +G  +DG  +Q++                        +    G +   E  
Sbjct: 274 EMFNAIERFNGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENV 333

Query: 734 XXXXXXXX---XXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA--RGFAFVEFVLP 788
                         LP      D+++LF + G+++   +  KFD+S    G A +E+   
Sbjct: 334 VGGGERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAEL--KFDESGAPTGIAVIEYENV 391

Query: 789 KEAENAMDQLQGVHLLGRRL 808
           ++A+  + +L   +  G  L
Sbjct: 392 EDADFCIQRLNNYNYGGCDL 411

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ YS T    K LF   G++    + +D R G S+GF  V +   EE   A    
Sbjct: 224 VFIVNLPYSMTWQTLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERF 282

Query: 387 DKQIFQGRLLHI 398
           +     GR+L +
Sbjct: 283 NGFDVDGRILQV 294

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           L F+AT +D+ + F   G++    +     +  RG   VEF  P+  +NA+    GV  +
Sbjct: 126 LSFDATPEDLHDFFGQAGEVLRADIITSRGRH-RGMGTVEFTSPEGVDNAIRDFNGVEFM 184

Query: 805 GRRLVMQ 811
           GR L ++
Sbjct: 185 GRPLFVR 191

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 74/185 (40%), Gaps = 29/185 (15%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           SIFI NL+F  T + L D F      + A + T    + +++    G G VEF + E   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIITS---RGRHR----GMGTVEFTSPEGVD 172

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELF-- 758
             I   +G    G  + +    RQ N   +               P E  R  +FE+F  
Sbjct: 173 NAIRDFNGVEFMGRPLFV----RQDNPPPEPMESLPPMRERFNDYPPEG-RPPMFEVFIV 227

Query: 759 -----NSFGQLKS--------VRVPKKFDKS--ARGFAFVEFVLPKEAENAMDQLQGVHL 803
                 ++  LK         +R   + D++  +RGF  V +   +E  NA+++  G  +
Sbjct: 228 NLPYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDV 287

Query: 804 LGRRL 808
            GR L
Sbjct: 288 DGRIL 292

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 2/72 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ N+ + +T +D    F   GE+  +   + T  G  +G   V F  PE    A  + 
Sbjct: 121 IFIGNLSFDATPEDLHDFFGQAGEV--LRADIITSRGRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 387 DKQIFQGRLLHI 398
           +   F GR L +
Sbjct: 179 NGVEFMGRPLFV 190

>Kwal_26.7522
          Length = 262

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++L +I Y  TE+    L S  G +  + +  D +TG SKG+A+V +   E +  A   L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 387 DKQIFQGRLL 396
           +      RLL
Sbjct: 74  NGYQLGNRLL 83

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 40/68 (58%), Gaps = 6/68 (8%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQLQGV 801
           +P++ T + + +L ++ G + ++++   FD     ++G+AFVE+   + + +A+  L G 
Sbjct: 19  IPYDQTEEQILDLCSNVGPVVNLKM--MFDPQTGKSKGYAFVEYKDLEASASAVRNLNGY 76

Query: 802 HLLGRRLV 809
             LG RL+
Sbjct: 77  Q-LGNRLL 83

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 35/60 (58%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + Y   E + +K F  +GE++++ +  D  T  SKG+A+++F  P  +  A+ E+
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVH 802
           LP++    ++ + F  FG+++ +R+ K K  + ++G+AF+ F  P  ++ A  ++ GVH
Sbjct: 114 LPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI-GVH 171

>Scas_665.4
          Length = 219

 Score = 37.7 bits (86), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 5/74 (6%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
            P  ++++ N++ K T +QL + F       V+ +     PK K   +  G+ F+EF T 
Sbjct: 7   NPETTVYVGNIDPKVTKEQLYELF-----IQVSPISKLRYPKDKILQMHQGYAFIEFYTA 61

Query: 697 EQATAVISAMDGTV 710
           +    VI  M+ TV
Sbjct: 62  KDVQYVIQVMNNTV 75

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 748 EATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           + T++ ++ELF     +  +R PK K  +  +G+AF+EF   K+ +  +  +     L  
Sbjct: 20  KVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVMNNTVALYD 79

Query: 807 RLV 809
           R +
Sbjct: 80  RFL 82

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 43/83 (51%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           + + K   +  +++ N+ + ++E+   +LFS  G ++++ + +D       GF ++++  
Sbjct: 37  EELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQT 96

Query: 376 PEEAVQAYIELDKQIFQGRLLHI 398
           P+EA+ A   L K     R + I
Sbjct: 97  PQEALAALKYLSKTKLDDREITI 119

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           + +I++ NL+F T+ +QL + F       + ++    D   + K    GF F+ ++T ++
Sbjct: 45  SATIYVGNLSFYTSEEQLYELFSKCGS--IEKIIMGLD---RFKFTPCGFCFIIYQTPQE 99

Query: 699 ATAVISAMDGTVIDGHKIQLKL 720
           A A +  +  T +D  +I + L
Sbjct: 100 ALAALKYLSKTKLDDREITIDL 121

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 42/81 (51%), Gaps = 6/81 (7%)

Query: 642 IFIKNLNFKTTSQQLTD---RFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           ++I NL+F TT  +LT     + V S  + +Q        + ++V  +G  + +F + ++
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRG---FRNSRVRPLGIAYADFESADK 80

Query: 699 ATAVISAMDGTVIDGHKIQLK 719
           A   I A++G V +   ++LK
Sbjct: 81  AKEAIEALNGKVFNNRTLRLK 101

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%)

Query: 342 KKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           +KL SP+  +  V V  +  TG S+G AYV FA  ++A  A   L  + F   +L +
Sbjct: 206 QKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQV 262

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPF 747
           F +V+  + E A    + ++G  I+ +K+  K+S+        +             LP 
Sbjct: 157 FAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISNVNERTERTDNAISDGREIIVKNLPD 216

Query: 748 EATRKDVFELFNSFGQLKSVRVPKKFDKSARG----FAFVEFVLPKEAENAMDQLQGVHL 803
           + T  D+ ++FN FG  +  R+    D++  G    +AF+ F     A+NA+  L G  +
Sbjct: 217 DITIDDLIKMFNEFGDTEKARIVTG-DETNPGRHSRYAFITFKNKASADNAL-SLNGAVM 274

Query: 804 LGRRL 808
            G+ L
Sbjct: 275 NGKPL 279

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 27/44 (61%)

Query: 766 SVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLV 809
           S+R+P     S R FA+V+ V P+ A+ A ++L G+ +   +LV
Sbjct: 143 SIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLV 186

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 4/77 (5%)

Query: 325 GR-LFLRNILYSSTEDDFKKLFSPYGELKEVHVAV--DTRTGNSKGFAYVLFAKPEEAVQ 381
           GR + ++N+    T DD  K+F+ +G+ ++  +    +T  G    +A++ F     A  
Sbjct: 206 GREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKASADN 265

Query: 382 AYIELDKQIFQGRLLHI 398
           A + L+  +  G+ LH+
Sbjct: 266 A-LSLNGAVMNGKPLHV 281

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 754 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           V E F  +G+L  V+V +  D S R +AFV++    +A+ A+ Q QG  L GR +
Sbjct: 181 VTEAFKKYGELSMVKVLR--DPSNRPYAFVQYTNDNDAKRALKQAQGTLLNGRTI 233

>Kwal_27.10364
          Length = 443

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 58/130 (44%), Gaps = 10/130 (7%)

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLP- 746
           F +V+  + E+A  ++  + G V+D H++ +KLS+        +             L  
Sbjct: 160 FAYVDMASSEEAKLIVDRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERRQVYLKNLDY 219

Query: 747 FEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--------GFAFVEFVLPKEAENAMDQL 798
           F  + + + + F+ +G ++ + +P K +            GF FV F     A +++ QL
Sbjct: 220 FRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSL-QL 278

Query: 799 QGVHLLGRRL 808
            G  L GR++
Sbjct: 279 DGSELEGRKI 288

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGF-----VVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           +++KNL++   S+++    K FS +     +    K +P      K L+ GFGFV F   
Sbjct: 212 VYLKNLDYFRVSEEIIS--KSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSES 269

Query: 697 EQATAVISAMDGTVIDGHKIQLKLSHRQG 725
             A + +  +DG+ ++G KI + L+ R+ 
Sbjct: 270 TSAASSLQ-LDGSELEGRKISVTLADRKA 297

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 756 ELFNSFG-QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQ 811
           +LF+ FG  + S+R P     S R FA+V+    +EA+  +D+L G  +    L+++
Sbjct: 135 KLFSQFGGTVLSIRFPSLRYDSHRRFAYVDMASSEEAKLIVDRLHGFVVDNHELIIK 191

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +F+  L F    Q+L D FK     + A V T  D K      S GFG V   TKEQ   
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGK------SRGFGTVYMATKEQQND 117

Query: 702 VISAMDGTVIDGHKIQLK 719
            I    GT   G  + +K
Sbjct: 118 AIRHWTGTEYKGRVLDVK 135

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  + +S    + K +F P G++    V  D R G S+GF  V  A  E+   A    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTD-RDGKSRGFGTVYMATKEQQNDAIRHW 122

Query: 387 DKQIFQGRLLHI 398
               ++GR+L +
Sbjct: 123 TGTEYKGRVLDV 134

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 43/135 (31%), Gaps = 19/135 (14%)

Query: 689 GFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXX------ 742
           G VEF         I   DG  ++G  I +    RQ N    E                 
Sbjct: 2   GTVEFNNSTDVDTAIRDCDGAFLNGRAIFV----RQDNPPPAEISRTGNNNGPPPPPKRA 57

Query: 743 ---------XXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAEN 793
                      LPF    +++ ++F   G +    V    D  +RGF  V     ++  +
Sbjct: 58  HDEGFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQND 117

Query: 794 AMDQLQGVHLLGRRL 808
           A+    G    GR L
Sbjct: 118 AIRHWTGTEYKGRVL 132

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 35/60 (58%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           K+  +++ N+ + ++E+   +LFS  G +K + + +D       GF ++++  P+EA+ A
Sbjct: 44  KSSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNA 103

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFVLPKEAENAMDQL 798
           L F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P+EA NA+  L
Sbjct: 53  LSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVKYL 107

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 55  FAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPR 95
           F FI Y   Q+AL+AV Y   + +    I +D+   F D R
Sbjct: 89  FCFIIYNTPQEALNAVKYLGDTKLDDKSITIDLDPGFEDGR 129

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEA 379
           +F+  + Y + E   +K+F+ YGE+  V V  D +   S+G+A+VLF + + A
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRD-KQNKSRGYAFVLFKETDSA 168

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENA------MDQL 798
           LP++     + ++F  +G++  VRV +     +RG+AFV F   KE ++A      +   
Sbjct: 122 LPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLF---KETDSARVCTRDIGVH 178

Query: 799 QGVHLLGRRLVM 810
           +G+ + GRR ++
Sbjct: 179 RGIQINGRRCIV 190

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++L +I Y  TE+    L S  G +  + +  D +TG SKG+A++ F   E +  A   L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 387 DKQIFQGRLLHI 398
           +      R L  
Sbjct: 80  NGYQLGSRFLKC 91

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 5/93 (5%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T ++F+ +LN       L   FK F  F+ A V       Q  +  S G+GFV F  ++Q
Sbjct: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD---MQSGR--SRGYGFVSFGEQDQ 237

Query: 699 ATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQE 731
           A   +    G  ++G  +++  + ++    SQ+
Sbjct: 238 AQVAMETKQGFELNGRALRINWASKREPQQSQQ 270

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 69/173 (39%), Gaps = 22/173 (12%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +++ NL        L   F++  G  ++ VK  PD   KN      + FVE+     A  
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQI--GGSISSVKIIPD---KNS-QECNYAFVEYFEPHDANV 152

Query: 702 VISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSF 761
               ++G  ++G  +++  + +     S E                +AT    F+ F SF
Sbjct: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVD--DATLAGTFKEFPSF 210

Query: 762 GQ------LKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
            Q      ++S R        +RG+ FV F    +A+ AM+  QG  L GR L
Sbjct: 211 IQAHVMWDMQSGR--------SRGYGFVSFGEQDQAQVAMETKQGFELNGRAL 255

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 2/89 (2%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           L++ N+  S  +D  K+ F   G +  V +  D +      +A+V + +P +A  AY  L
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPD-KNSQECNYAFVEYFEPHDANVAYQTL 157

Query: 387 DKQIFQGRLLHILAADEMKDHRLDE-FDL 414
           + +  +G++L I  A + +    DE F+L
Sbjct: 158 NGKEVEGKVLKINWAFQSQQVNSDETFNL 186

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           +T  LF+ ++     +      F  +    + HV  D ++G S+G+ +V F + ++A Q 
Sbjct: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQA-QV 240

Query: 383 YIELDKQIFQ--GRLLHI 398
            +E  KQ F+  GR L I
Sbjct: 241 AMET-KQGFELNGRALRI 257

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+ N+ +  T+D  +K F   G++ ++ +A    +G  KGFA++ F   E +     + 
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 387 DKQIFQGRLLHI 398
             +   GR L +
Sbjct: 301 SCRKIAGRPLRM 312

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 76/196 (38%), Gaps = 35/196 (17%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQK-------------------NK 682
           ++I NL+F TT   L         F +A+ K   D K +                   N 
Sbjct: 127 VWIGNLSFDTTKDDLV-------RFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNA 179

Query: 683 VLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXX 742
           + + GF ++ F+  EQ  AV+  +  + ++G  + +K S        ++           
Sbjct: 180 MKNKGFCYMFFKNVEQMKAVLE-LSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPS 238

Query: 743 X-----XLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS--ARGFAFVEFVLPKEAENAM 795
                  L F+ T   + + F   G +  +R+   F+ S   +GFAF++F   + + N +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMAT-FEDSGKCKGFAFIDFKNEEGSTNEL 297

Query: 796 DQLQGVHLLGRRLVMQ 811
                  + GR L M+
Sbjct: 298 KDKSCRKIAGRPLRME 313

 Score = 30.4 bits (67), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697
           P+  +F+ NL+F  T   L   F+     V  ++ T  D  +       GF F++F+ +E
Sbjct: 237 PSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGK-----CKGFAFIDFKNEE 291

Query: 698 QATAVISAMDGTVIDGHKIQL 718
            +T  +       I G  +++
Sbjct: 292 GSTNELKDKSCRKIAGRPLRM 312

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           LF+  + Y+  E + +K F  YG+++   +  D + G S+G+ +V F   E++ Q + EL
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 758 FNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQL---QGVHLLGRRLVM 810
           F  +G ++S R+ +  D  +RG+ FV+F   ++++    +L   +G+ ++GR  ++
Sbjct: 135 FVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRELGVRKGIEIMGRTSIV 190

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ NI  S+T +  +  F   G +K V +  +  TG  KG+AY+ F + +++V+     
Sbjct: 85  IFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF-ESKDSVEKGSAF 143

Query: 387 DKQIFQGRLLHI 398
           D+  F G+ + +
Sbjct: 144 DQSDFNGKTITV 155

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 35.8 bits (81), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%)

Query: 337 TEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLL 396
           TE D   +FS YG   ++ +  D  TG SKGF ++ +      + A   L+     GRL+
Sbjct: 46  TEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLI 105

Query: 397 HI 398
            +
Sbjct: 106 RV 107

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 3/60 (5%)

Query: 37  GLITDLRILKNRE-GKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPR 95
           G   D+++++++  GKS+ F F+ Y++++  + AV+  +G+ +    I VD A  F  PR
Sbjct: 58  GCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHA--FYRPR 115

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 35.8 bits (81), Expect = 0.068,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 39/67 (58%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           Q + K  K+  +++ N+ + ++E+   +LFS  G +K++ + +D       GF +++F K
Sbjct: 38  QQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDK 97

Query: 376 PEEAVQA 382
            E+A+ +
Sbjct: 98  MEDALNS 104

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 77/178 (43%), Gaps = 26/178 (14%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           V +FI +L+   T + L   FK +  FV A+V      K+     S+G G++ F  KE+A
Sbjct: 91  VPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKK-----SLGHGYLNFEDKEEA 145

Query: 700 TAVISAMDGTVIDGHKIQLKLSHR----QGNAGSQEXXXXXXXXXXXXXLPFE---ATRK 752
              +  ++ T ++G +I++  S R    + N G+               LP      T +
Sbjct: 146 EKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTN---------VFFSNLPLNNPLLTTR 196

Query: 753 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
             ++ F+ +G++ S ++      S +   FV F   K A N +         G++++ 
Sbjct: 197 VFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILC 249

>Kwal_14.1851
          Length = 535

 Score = 36.6 bits (83), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 11/89 (12%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
            ++FI  L  + + +QL   F  F   +   VK  P           G GFV++  +  A
Sbjct: 396 TTVFIGGLTSQISERQLHSLFSPFGAII--NVKIPP---------GKGCGFVKYAYRIDA 444

Query: 700 TAVISAMDGTVIDGHKIQLKLSHRQGNAG 728
            A I  M G ++ G+ I+L       + G
Sbjct: 445 EAAIQGMQGFIVGGNPIRLSWGRTSADTG 473

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 35.8 bits (81), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++L +I Y  TE+    L S  G +  + +  D +TG SKG+A+V +   E +  A   L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 387 DKQIFQGRLLHI 398
           +      R L  
Sbjct: 75  NGYQLGNRFLKC 86

>Kwal_23.5864
          Length = 278

 Score = 35.8 bits (81), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 30/47 (63%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +F+  + Y+ TE + +K F  +GE+++V V  D  +  S+G+ +++F
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMF 149

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 711 IDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVP 770
           I+   ++ KLSH   N  +               LP+  T  ++ + F  FG+++ VRV 
Sbjct: 74  IEADALKEKLSHWHPNEDANIVGSDPYRTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVV 133

Query: 771 K-KFDKSARGFAFVEF---VLPKEAENAMDQLQGVHLLGRRLVM 810
           + K    +RG+ F+ F   +  + A   +   +GV + GR +++
Sbjct: 134 RDKTSNKSRGYGFIMFKEELFARTACREIGVHRGVEIGGRPVIV 177

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 56/135 (41%), Gaps = 7/135 (5%)

Query: 676 DPKQKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXX 735
           +P + + V + G+ FVEF  +  A+  +      V       LKL     N  S      
Sbjct: 93  NPNKSHAVNNSGYCFVEFPNQMAASNALMKSGLRVPMDSNYALKL-----NWASFATAPG 147

Query: 736 XXXXXXXXXLPFEATRKDVFELFNS--FGQLKSVRVPKKFDKSARGFAFVEFVLPKEAEN 793
                    L    T   +FELF S     L +  V  +F   ++G+ FV+FV   E + 
Sbjct: 148 SEFTLFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQR 207

Query: 794 AMDQLQGVHLLGRRL 808
           A+ ++QG  L GR +
Sbjct: 208 ALVEMQGTFLNGRAI 222

 Score = 33.5 bits (75), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           LF+ ++  + TE    +LF S Y       +  D  TG SKG+ +V F    E  +A +E
Sbjct: 152 LFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVE 211

Query: 386 LDKQIFQGRLLHI 398
           +      GR + +
Sbjct: 212 MQGTFLNGRAIRV 224

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 750 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           T  ++   F  FGQ+  V++P       +G  FV++V    AE A+ ++QG  +   R+
Sbjct: 328 TEDELRSYFQPFGQIVYVKIPV-----GKGCGFVQYVDRISAETAISKMQGFPIGNSRI 381

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 524 TREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKL 567
           T +EL   F PFG++  + +P       VQ+ D  S  +A SK+
Sbjct: 328 TEDELRSYFQPFGQIVYVKIPVGKGCGFVQYVDRISAETAISKM 371

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ NI    T +  +  F   G++K + +  D  TG  KG+ Y+ F  P     AY E 
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESP-----AYREK 120

Query: 387 DKQIFQGRL 395
             Q+  G L
Sbjct: 121 ALQLNGGEL 129

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 35.4 bits (80), Expect = 0.11,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 37/67 (55%)

Query: 316 QAIAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           + + K   +  +++ N+ + ++E+   +LFS  G +K + + +D       GF +V++  
Sbjct: 37  EDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNT 96

Query: 376 PEEAVQA 382
           P+EA+ A
Sbjct: 97  PKEALSA 103

 Score = 32.7 bits (73), Expect = 0.87,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFVLPKEAENAMDQLQGVHL 803
           L F  + + ++ELF+  G +K + +   +F  +  GF FV +  PKEA +A+  L    L
Sbjct: 53  LSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYLSDTKL 112

Query: 804 LGRRL 808
             R +
Sbjct: 113 DDRHI 117

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 688 FGFVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQGNAGSQEXXXXXXXXXXXXXLPF 747
           F +V+  + + A A  + ++G  +DG+ + +KLS  +  A   +             L F
Sbjct: 151 FAYVDLPSPQSADAAANTLNGMDLDGYNLVVKLSDPESRAQRSDAGTIEKREVLIRGLDF 210

Query: 748 -EATRKDVFELFNSFGQLKSVRVPKKFD----KSARGFAFVEF 785
            + T + +  L   FG+++ + +P   D    +  RGFAFV +
Sbjct: 211 IKVTIEKLQGLVEPFGEVEKLIMPPSSDSADGRHNRGFAFVTY 253

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 7/57 (12%)

Query: 497 LTKFSNLKSPSQRDD------RVILVKNFPF-GTTREELGELFVPFGKLERLLMPPA 546
           + K S+ +S +QR D      R +L++   F   T E+L  L  PFG++E+L+MPP+
Sbjct: 180 VVKLSDPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFGEVEKLIMPPS 236

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 752 KDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810
           +++   F   G Q  SVR+P     + R FA+V+   P+ A+ A + L G+ L G  LV+
Sbjct: 122 RELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTLNGMDLDGYNLVV 181

Query: 811 Q 811
           +
Sbjct: 182 K 182

>Kwal_27.12337
          Length = 209

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 748 EATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQL 798
           + TR+ ++ELF     +  +R PK K  ++ +GFAFVEF   ++ E A   L
Sbjct: 20  KVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

>Kwal_33.13496
          Length = 330

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 5/77 (6%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           +FI  LN  T ++ L   F  F    + +V+   D   K    S+ +GF+EF  K    A
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFG--TIEKVEIVRD---KETGASLHYGFIEFTNKSSCEA 303

Query: 702 VISAMDGTVIDGHKIQL 718
             S M+G +ID  +I +
Sbjct: 304 AYSKMEGVLIDDRRIHV 320

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 29/59 (49%)

Query: 340 DFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           D   +FS +G +++V +  D  TG S  + ++ F        AY +++  +   R +H+
Sbjct: 262 DLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKMEGVLIDDRRIHV 320

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 752 KDVFELFNSFGQLKSVRVPKKFDKSAR-GFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           KD+  +F+ FG ++ V + +  +  A   + F+EF      E A  +++GV +  RR+
Sbjct: 261 KDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKMEGVLIDDRRI 318

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 758 FNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           F  +G++ SV+V +  D + R +AFV++    EA NA+ Q QG  L  R +
Sbjct: 144 FAKYGKIVSVKVLR--DPANRPYAFVQYASDDEALNALSQAQGTTLNNRNI 192

>Scas_621.16
          Length = 314

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           ++L +I Y  TE+    L +  G +  + +  D +TG SKG+A++ F   E +  A   L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 387 DKQIFQGRLL 396
           +      R L
Sbjct: 106 NGYQLGSRFL 115

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFVLPKEAENAMDQLQGV 801
           +P++ T + + +L N+ G + ++++   FD     ++G+AF+EF   + + +A+  L G 
Sbjct: 51  IPYDQTEEQILDLCNNVGPVINLKM--MFDPQTGKSKGYAFIEFKDLETSASAIRNLNGY 108

Query: 802 HLLGRRL 808
            L  R L
Sbjct: 109 QLGSRFL 115

>Scas_709.2*
          Length = 171

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 51/93 (54%), Gaps = 14/93 (15%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILK-NREGKSRRFAFIGYKN 62
           + + GL   LTE ++   F++            G+  DL ++  N+ G+S+ FAF+ Y++
Sbjct: 36  IYIGGLDKELTEGDIISVFSQY-----------GVPVDLLLVNDNQTGESKGFAFLKYED 84

Query: 63  EQDALDAVNYFDGSFIYTSKIEVDMAKSFADPR 95
           ++  + A++  +G  + ++ I+VD   +F +PR
Sbjct: 85  QRSTVLAIDNLNGVKVGSNTIQVD--HTFYEPR 115

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%)

Query: 337 TEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           TE D   +FS YG   ++ +  D +TG SKGFA++ +      V A
Sbjct: 46  TEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLA 91

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 317 AIAKIQKTGRLFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAK 375
           A+A  Q    +F+ ++  S TE     LF + Y       V  D  TG SKG+ +V F  
Sbjct: 182 AVANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKS 241

Query: 376 PEEAVQAYIELDKQIFQGRLLHI 398
             +  +A +E+      GR + I
Sbjct: 242 SMDQQRALVEMQGCFLNGRAIKI 264

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 750 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           T  ++   F  FG +  V++P     + +G  FV++V    AE A+ ++QG  +   R+
Sbjct: 339 TEDELRSYFEPFGTIIYVKIP-----AGKGCGFVQYVERSSAETAITKMQGFPIANSRV 392

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 641 SIFIKNLNFKTTSQQLTDRF-KVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQA 699
           SIF+ +L    T  QL D F   +   V A+V        +   +S G+GFV+F++    
Sbjct: 191 SIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVM-----YDQLTGISKGYGFVKFKSSMDQ 245

Query: 700 TAVISAMDGTVIDGHKIQLKLS 721
              +  M G  ++G  I++ ++
Sbjct: 246 QRALVEMQGCFLNGRAIKIGIA 267

>Kwal_55.20972
          Length = 135

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  +    TE D   +FS YG   ++ +  D  +G SKGFAY+ +      V A   L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 387 DKQIFQGRLLHI 398
           +     GR + +
Sbjct: 96  NGVKIAGRSIRV 107

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGYKN 62
           + V GL   LTE ++   F++            G+  DL+++++RE G+S+ FA++ Y++
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQY-----------GIPVDLKLVRDRESGESKGFAYLKYED 84

Query: 63  EQDALDAVNYFDGSFIYTSKIEVD 86
           ++  + AV+  +G  I    I VD
Sbjct: 85  QRSTVLAVDNLNGVKIAGRSIRVD 108

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 748 EATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           + T  D+  +F+ +G    LK VR   +    ++GFA++++   +    A+D L GV + 
Sbjct: 44  DLTEGDILTIFSQYGIPVDLKLVR--DRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIA 101

Query: 805 GRRL 808
           GR +
Sbjct: 102 GRSI 105

>Scas_582.10
          Length = 283

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 9/100 (9%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHV-AVDTRT-----GNSKGFAYVLFAK 375
           +++  +++ NI   +++ D   LFS YG+++     A++ +      GN KG A V++ K
Sbjct: 38  RESSAIYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEK 97

Query: 376 PEEAVQAYIEL-DKQIFQGRLLHILAAD-EMKDHRLDEFD 413
           P E+VQ  I++ D  IF    + +  A  E    +LD+ D
Sbjct: 98  P-ESVQLAIDMVDGTIFNKSTIKVERAQFEDNKRKLDDVD 136

>Scas_720.2
          Length = 245

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 35/60 (58%)

Query: 323 KTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQA 382
           ++  +++ N+ + ++E+   +LFS  G +K + + +D       GF +V+++  +EA+ A
Sbjct: 45  QSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNA 104

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 5/60 (8%)

Query: 39  ITDLRILKNRE-GKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVP 97
           I  + +++N+E G+SR  AF+ + NE  A  A+++ DG       + VD +K    P+VP
Sbjct: 216 IQKVVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRVDWSK----PKVP 271

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 343 KLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           +L  P+  +++V V  +  TG S+G A+V F   + A +A   LD + F   +L +
Sbjct: 208 ELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRV 263

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 342 KKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           ++L  P+  +  V V  +  TG S+G A+V F+  E A QA   LD + +   +L +
Sbjct: 209 EELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRV 265

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 39  ITDLRILKNRE-GKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89
           I  + +++N+E GKSR  AF+ + +E+ A  A+ + DG       + V+ +K
Sbjct: 218 IPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLILRVEWSK 269

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 28/62 (45%)

Query: 337 TEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLL 396
           TE D   +FS YG   ++ +  D  T  SKGF Y+ +      V A   L+     GR +
Sbjct: 46  TEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTI 105

Query: 397 HI 398
            +
Sbjct: 106 KV 107

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 745 LPFEATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGV 801
           L  E T  D+  +F+ +G    +K VR   K  + ++GF ++++   +    A+D L G 
Sbjct: 41  LNKELTEGDILTIFSQYGIPVDIKLVR--DKETRESKGFGYLKYEDQRSTVLAVDNLNGA 98

Query: 802 HLLGRRL 808
            + GR +
Sbjct: 99  TIAGRTI 105

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYI 384
           +F+ N+ +   E+   K F   G ++ V +  D +T   KGFAYV F + +   +A +
Sbjct: 230 VFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALL 287

>Scas_530.4
          Length = 684

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 754 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           V + F  FG++  V+V +  D++ R +AFV++    +A  A+ +  G  L GRRL
Sbjct: 161 VTDYFKKFGEIIRVKVLR--DQANRPYAFVQYTNDNDANVALKEAHGSILNGRRL 213

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 34.3 bits (77), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
            P  +++I N++   T   L + F   S   +++++    P+ K      G+ F+EF TK
Sbjct: 7   NPETTLYIGNIDPNVTKDLLYELFIQVSP--ISKIRY---PRDKILDTHQGYAFIEFFTK 61

Query: 697 EQATAVISAMDGTV 710
           E A  V+  M+ TV
Sbjct: 62  EDADYVVKVMNNTV 75

>KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154.1
           Kluyveromyces lactis CCr4/NOT complex/transcription
           factor subunit, start by similarity
          Length = 574

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 687 GFG-FVEFRTKEQATAVISAMDGTVIDGHKIQ 717
           G+G +V F  K+ A   I A+DG  IDGH+++
Sbjct: 200 GYGIYVTFSRKDDAAKCIQAIDGIYIDGHQVK 231

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           ++L +I Y  TE     L S  G +  + +  D +TG SKG+A++ F
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEF 59

>Kwal_56.23945
          Length = 806

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 10/68 (14%)

Query: 318 IAKIQKTGRLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
           I  I    RLF+ N+ L +  +DD  ++FSPYG + ++++           F ++ +  P
Sbjct: 355 IQNIPPKSRLFIGNLPLKNVAKDDLFRIFSPYGHIYQINI--------KNAFGFIQYDNP 406

Query: 377 EEAVQAYI 384
            ++V+A I
Sbjct: 407 -QSVRAAI 413

>Kwal_55.20414
          Length = 284

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 41/79 (51%)

Query: 642 IFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQATA 701
           I++ NL+F TT ++L++  K ++   V          + + V  +G G+ +F++ + A  
Sbjct: 19  IYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPLGIGYADFQSAQDAQN 78

Query: 702 VISAMDGTVIDGHKIQLKL 720
               ++G  +   K+++K+
Sbjct: 79  AAQNLNGKQLKDRKLKIKI 97

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 749 ATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           AT   +  LF + F  +K+VRV       ++R F FV F   KE   A+ ++ GV   GR
Sbjct: 173 ATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGR 232

Query: 807 RL 808
           +L
Sbjct: 233 QL 234

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 11/79 (13%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           ++FI  L+   +  QL   F  F   +   VK  P           G GFV F  +  A 
Sbjct: 327 TVFIGGLSNMISEGQLHALFMPFGNIL--SVKVPP---------GRGCGFVRFENRMDAE 375

Query: 701 AVISAMDGTVIDGHKIQLK 719
           A I  M G ++ G+ I+L 
Sbjct: 376 AAIQGMQGFIVGGNAIRLS 394

>Kwal_55.21039
          Length = 119

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 7/66 (10%)

Query: 344 LFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADE 403
           LFS YGE+ ++ ++   R     G A+++    +EA  A I L+ + F G+ LHI  +  
Sbjct: 58  LFSTYGEVLQIDMSKRIR-----GQAFIVLKTVDEANIALISLNNEPFFGKDLHIQFSK- 111

Query: 404 MKDHRL 409
            KD RL
Sbjct: 112 -KDSRL 116

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 748 EATRKDVFELF-NSFGQLKSVR-VPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLG 805
             T   +FELF N +      + V  +    ++G+ FV+F    E + A+ ++QGV L G
Sbjct: 173 NVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNG 232

Query: 806 RRLVMQP 812
           R + + P
Sbjct: 233 RAIKVGP 239

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           +F+ ++  + TE    +LF + Y       +  D  TG SKG+ +V F   +E   A  E
Sbjct: 165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSE 224

Query: 386 LDKQIFQGRLLHILAADEMKDH 407
           +      GR + +      + H
Sbjct: 225 MQGVFLNGRAIKVGPTSGQQQH 246

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 637 GPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           G   SIF+ +L    T  QL   F++F     +    K    Q    +S G+GFV+F   
Sbjct: 160 GNNCSIFVGDLAPNVTESQL---FELFINRYASTSHAKIVHDQVTG-MSKGYGFVKFTNS 215

Query: 697 EQATAVISAMDGTVIDGHKIQL 718
           ++    +S M G  ++G  I++
Sbjct: 216 DEQQLALSEMQGVFLNGRAIKV 237

>YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear
           polyadenylated RNA-binding protein with one RNA
           recognition (RRM) domain [2409 bp, 802 aa]
          Length = 802

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 318 IAKIQKTGRLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
           +  I    RLF+ N+ L + +++D  ++FSPYG + ++++           F ++ F  P
Sbjct: 323 MHNIPPKSRLFIGNLPLKNVSKEDLFRIFSPYGHIMQINI--------KNAFGFIQFDNP 374

Query: 377 EEAVQAYIELDKQ 389
            ++V+  IE + Q
Sbjct: 375 -QSVRDAIECESQ 386

>Kwal_55.20903
          Length = 147

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLL 804
           +P + +   + + F   G +  + +  K  KS  G+A+VEF     AE A+ +L G  L 
Sbjct: 66  IPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSILR 124

Query: 805 GRRL 808
           G +L
Sbjct: 125 GHKL 128

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 750 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           T  ++   F  FGQ+  V++P       +G  FV++V    AENA+ ++QG  +   R+
Sbjct: 294 TEDELRAYFQPFGQIVYVKIPV-----GKGCGFVQYVDRSSAENAIAKMQGFPIGNSRV 347

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           +F+ ++  + TE    +LF S Y       +  D  TG SKG+ +V F    E  ++ +E
Sbjct: 143 IFVGDLAPNVTESQLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLE 202

Query: 386 LDKQIFQGRLLHI 398
           +      GR + +
Sbjct: 203 MQGVFLNGRAIRV 215

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           +++++ +    T + L   F  F   +V ++         N   SMGFGFV +    QA+
Sbjct: 192 NLYVRGIPKNLTKEDLVPIFAKFGPILVLKIIL-----DSNTNESMGFGFVSYALGSQAS 246

Query: 701 AVISAMDGTVIDG 713
             I  ++G +++G
Sbjct: 247 NCIKELNGNLMNG 259

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 40/194 (20%), Positives = 69/194 (35%), Gaps = 37/194 (19%)

Query: 639 TVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQ 698
           T  + +KNL      Q L D FK       A V+   D       +S G G V F   + 
Sbjct: 235 THEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDG------VSTGSGTVSFYDIKD 288

Query: 699 ATAVISAMDGTVIDGHKIQLK-----LSHRQGN----------------------AGSQE 731
               I   +G  I+G+ + +K      +H  G+                       G  E
Sbjct: 289 LHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGE 348

Query: 732 XXXXXXXXXXXXXLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEA 791
                        LPF   + D+++LF + G++ +  +      +  G A VE+    +A
Sbjct: 349 RNRLIYCSN----LPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDNVDDA 404

Query: 792 ENAMDQLQGVHLLG 805
           +  +++L   +  G
Sbjct: 405 DVCIERLNNYNYGG 418

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 62/177 (35%), Gaps = 16/177 (9%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           SIF+ NL + +T + LT+ F      V A + T       ++    G G VEF   +   
Sbjct: 137 SIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT-------SRGHHRGMGTVEFTNSDDVD 189

Query: 701 AVISAMDGTVIDGHKIQLK---------LSHRQGNAGSQEXXXXXXXXXXXXXLPFEATR 751
             I   DG      KI ++         +  R+     +              LP     
Sbjct: 190 RAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNW 249

Query: 752 KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           + + ++F   G +    V    D  + G   V F   K+   A+++  G  + G  L
Sbjct: 250 QALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVL 306

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ NI   +T +  ++ F   GE+  V +  +  TG  KG+AY+ F   +   +A +EL
Sbjct: 105 IFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDSIPKA-LEL 163

Query: 387 DKQIFQGRLLHI 398
                 G  +++
Sbjct: 164 KDSELHGETINV 175

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           +++ NI   +T ++  + F   G +K + +  D  TG S G+AYV F
Sbjct: 47  IYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEF 93

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 5/54 (9%)

Query: 640 VSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEF 693
            SI+I N++  TT +++ + FK  S  V+ ++    D   KN   S+G+ +VEF
Sbjct: 45  CSIYIGNISLDTTPEEIDEHFK--SCGVIKRITMLYD---KNTGPSIGYAYVEF 93

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 39/73 (53%), Gaps = 10/73 (13%)

Query: 318 IAKIQKTGRLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
           +  I    RLF+ N+ L + ++ D  +LFSP+G + ++++           F ++ +  P
Sbjct: 323 MHSIPPKSRLFIGNLPLKNVSKQDLFRLFSPFGHILQINIK--------NAFGFIQYDNP 374

Query: 377 EEAVQAYIELDKQ 389
            ++V+A IE + Q
Sbjct: 375 -KSVRAAIECESQ 386

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 14/85 (16%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGF-VVAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           P   +FI NL  K  S+Q  D F++FS F  + Q+  K             FGF+++   
Sbjct: 328 PKSRLFIGNLPLKNVSKQ--DLFRLFSPFGHILQINIK-----------NAFGFIQYDNP 374

Query: 697 EQATAVISAMDGTVIDGHKIQLKLS 721
           +   A I      +  G K+ L++S
Sbjct: 375 KSVRAAIECESQEINFGKKLILEVS 399

>Kwal_30.12890
          Length = 280

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 343 KLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLH 397
           +L  P+G + +V V  +  TG S+G AYV F   E A  A   L+ + F   +L+
Sbjct: 216 ELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILN 270

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 37  GLITDLRILKNRE-GKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89
           G I  + +++NRE G+SR  A++ ++ E+ A  A+N+ +G       +  D +K
Sbjct: 222 GRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILNADWSK 275

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 33.5 bits (75), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/72 (23%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+ +I   +T +  ++ F   G +  + +  + +TG  KG+AY+ F +   +V+  ++L
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQF-ESISSVEKALQL 143

Query: 387 DKQIFQGRLLHI 398
           D   F G  + +
Sbjct: 144 DGSSFNGNTISV 155

>Scas_714.59
          Length = 233

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 344 LFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398
           L  P+  +++  V  +  TG SKG A+V F+  + A +A   LD + F   +L +
Sbjct: 170 LLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLILRV 224

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 39  ITDLRILKNRE-GKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDMAK 89
           I    +++NRE G+S+  AF+ + +EQ A  A+++ DG       + V+ +K
Sbjct: 177 IQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLILRVEWSK 228

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 19/85 (22%)

Query: 322 QKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAV-------------------DTRT 362
           Q+   L++++I  S T++D    +  +GE+  V V                     D   
Sbjct: 537 QQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLPV 596

Query: 363 GNSKGFAYVLFAKPEEAVQAYIELD 387
           G+S+G+ +V F  P +A +A +  D
Sbjct: 597 GSSRGYGFVSFESPLDAAKAILNTD 621

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 37/89 (41%)

Query: 325 GRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYI 384
           G +F+  I  S +  +   LFS YG +  + +  D   G   G+ ++ +    +A     
Sbjct: 195 GNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIK 254

Query: 385 ELDKQIFQGRLLHILAADEMKDHRLDEFD 413
           EL+ +   G  L I    E K+     +D
Sbjct: 255 ELNGRTVNGSTLFINYHVERKERERIHWD 283

>Scas_611.5*
          Length = 787

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 39/71 (54%), Gaps = 10/71 (14%)

Query: 318 IAKIQKTGRLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKP 376
           +  I    RLF+ N+ L + +++D  ++FSPYG + ++++           F ++ +  P
Sbjct: 306 MHNIPAKSRLFIGNLPLKNVSKEDLFRIFSPYGHILQINI--------KNAFGFIQYNNP 357

Query: 377 EEAVQAYIELD 387
            ++V+  IEL+
Sbjct: 358 -QSVKDAIELE 367

>Scas_157.1
          Length = 232

 Score = 32.7 bits (73), Expect = 1.0,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 4/89 (4%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700
           S+F+ +L+   T  QL   F++F G   +    K    Q   V S  +GFV+F +     
Sbjct: 138 SVFVGDLSPNVTEAQL---FELFIGRYPSTCHAKVVHDQLTGV-SKCYGFVKFNSATDQQ 193

Query: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGS 729
            V+  M G  ++G  I++ L+    N  S
Sbjct: 194 RVLVEMQGVFLNGRSIKVGLTGGAHNDNS 222

>Kwal_55.20154
          Length = 522

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 327 LFLRNILYSSTEDDFKKLF-SPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIE 385
           +F+ ++  + TE    +LF S Y       +  D  TG SKG+ +V F +  E  ++ +E
Sbjct: 137 VFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLE 196

Query: 386 LDKQIFQGRLLHI 398
           +      GR + +
Sbjct: 197 MQGVFLNGRAIRV 209

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLF 373
           ++L +I Y  TE     L    G +  + +  D  TG SKG+A++ F
Sbjct: 10  VYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEF 56

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 10/65 (15%)

Query: 326 RLFLRNI-LYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYI 384
           RLF+ N+ L + T++D  ++FSPYG + ++++           F ++ +  P ++V+  I
Sbjct: 342 RLFIGNLPLKNVTKEDLFRIFSPYGHIFQINI--------KNAFGFIQYDDP-QSVKDAI 392

Query: 385 ELDKQ 389
           E + Q
Sbjct: 393 ECESQ 397

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%)

Query: 327 LFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIEL 386
           +F+  +    TE D   +FS YG   +V +  D  T  SKGFA++ +      + A   L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 387 DKQIFQGRLLHI 398
           +     GR + +
Sbjct: 96  NGITVAGRQIKV 107

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 49/93 (52%), Gaps = 14/93 (15%)

Query: 4   VIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNRE-GKSRRFAFIGYKN 62
           + + GL   LTE +L   F++            G+  D+ +++++E  +S+ FAF+ Y++
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQY-----------GVPVDVLLVRDKETHESKGFAFLKYED 84

Query: 63  EQDALDAVNYFDGSFIYTSKIEVDMAKSFADPR 95
           ++  + AV+  +G  +   +I+VD    F  PR
Sbjct: 85  QRSTILAVDNLNGITVAGRQIKVDHI--FFTPR 115

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 748 EATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGR 806
           + T  D+  +F+ +G  +  + V  K    ++GFAF+++   +    A+D L G+ + GR
Sbjct: 44  QLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGR 103

Query: 807 RL 808
           ++
Sbjct: 104 QI 105

>ADL064W [1677] [Homologous to ScYER068W (MOT2) - SH]
           complement(567690..569630) [1941 bp, 646 aa]
          Length = 646

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 687 GFG-FVEFRTKEQATAVISAMDGTVIDGHKIQ 717
           G+G +V F  KE A   I A+DGT +DG +++
Sbjct: 186 GYGIYVTFSRKEDAARCIQAVDGTFMDGRQVK 217

>Scas_241.1
          Length = 186

 Score = 32.0 bits (71), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 750 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           +  D+ + F  FG +  V++P     + +G  FV++V    AE A+ ++QG  L   R+
Sbjct: 38  SEDDLRQYFQPFGDIIYVKIP-----TGKGCGFVQYVDRLSAELAISKMQGFPLANSRI 91

>KLLA0C07194g 624694..625587 no similarity, hypothetical start
          Length = 297

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 31/72 (43%)

Query: 510 DDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAF 569
           D   + V  FP GT   EL   F   G+L R+ +PP G    + +  +    S  ++ A 
Sbjct: 3   DRNTVHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPYAFVEYESSHDAENAI 62

Query: 570 KRFKGTVIYLEK 581
           +   GT   + K
Sbjct: 63  RSCDGTPFEMNK 74

>Scas_645.14
          Length = 717

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 686 MGFGFVEFRTKEQATAVISAMDGTVIDGHKIQL 718
           +G+GF+ F    QA+  I+  +G +I+G K+ L
Sbjct: 231 IGYGFISFVLGSQASECINEFNGKIIEGTKLFL 263

>ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C
           (RNP1) - SH] (229767..230663) [897 bp, 298 aa]
          Length = 298

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 13/72 (18%)

Query: 508 QRDDRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSK- 566
           +R    + V N P+ TT+EE+ E F    K E +++P      + + RD  S R  +SK 
Sbjct: 148 ERSSDTLYVNNIPYYTTKEEIAEFF--GTKPELIVLP------MRRMRDTVSNRFFYSKS 199

Query: 567 ----LAFKRFKG 574
               + F  F+G
Sbjct: 200 MNRGIVFVAFEG 211

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFV-VAQVKTKPDPKQKNKVLSMGFGFVEFRTK 696
           P   +FI NL  K  +++  D F++FS +  + Q+  K             FGF+++   
Sbjct: 287 PKSRLFIGNLPLKNVTKE--DLFRIFSPYGHIFQINIK-----------NAFGFIQYDNA 333

Query: 697 EQATAVISAMDGTVIDGHKIQLKLS 721
           +     I    GT+  G K+ L++S
Sbjct: 334 QSVKDAIECESGTMNFGKKLILEVS 358

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 750 TRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           T++ ++ELF     +  ++ PK K  ++ +G+AF+EF    +A+ A+  +     L  RL
Sbjct: 21  TKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRL 80

Query: 809 V 809
           +
Sbjct: 81  I 81

>Scas_701.4
          Length = 612

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 687 GFG-FVEFRTKEQATAVISAMDGTVIDGHKIQ 717
           G+G ++ F TK+ A   I+ +DGT +DG  I+
Sbjct: 196 GYGVYITFATKDDAAKCIAQVDGTYMDGRLIK 227

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/95 (21%), Positives = 43/95 (45%), Gaps = 11/95 (11%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKV-----------LSMGFG 689
           +I++K++    + + L + ++ F   +  ++ T     ++ K            +S G+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 690 FVEFRTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724
           FV F     A   I + DG  ++G   +L +S+ Q
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQ 535

>Sklu_2345.4 YEL015W, Contig c2345 7938-9479 reverse complement
          Length = 513

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 142 EKDKQLKEFIETMKPSAQTSSWDKITE-----TAEPESGLAEEQELDDEESSNVNPLLKH 196
           EK K   E  E + P+A+   WDKI E     TA    G +E   L   +S N+  LLK 
Sbjct: 135 EKPKLNYEIDEMIIPNAKHDHWDKIVEEQDTRTASASDGESEADFLPITKSINITHLLKG 194

Query: 197 ALSMKKGDEND 207
           A      +E+D
Sbjct: 195 ATGPSDTEEDD 205

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKN----KVLSMGFGFVEFRTK 696
           +I IKN+ F    +QL D         + Q    P P   N      +  G  F  F T 
Sbjct: 57  AIVIKNIPFAIKKEQLLD---------IIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTP 107

Query: 697 EQATAVISAMDGTVIDGHKIQLK 719
           E  + VIS ++G  I+G K++++
Sbjct: 108 EDTSRVISDLNGKEINGRKLKVE 130

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 27/65 (41%), Gaps = 1/65 (1%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFVLPKEAENAMDQLQGVHL 803
           +PF   ++ + ++    G          FD    RG AF  F  P++    +  L G  +
Sbjct: 63  IPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDLNGKEI 122

Query: 804 LGRRL 808
            GR+L
Sbjct: 123 NGRKL 127

>Scas_591.5*
          Length = 290

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 511 DRVILVKNFPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFK 570
           ++++LV++ P   T+E +GELF   G LE +       +A V++  I+      +KL   
Sbjct: 218 NKILLVQDLPEDATQESIGELFNGDGLLE-VRYVEVRHLAFVEYDSISHASDVKNKLGSP 276

Query: 571 R-FKGTVI 577
             +KGT I
Sbjct: 277 YDWKGTTI 284

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%)

Query: 778 RGFAFVEFVLPKEAENAMDQLQGVHLLGRRL 808
           RG AF  F  P+E    +  L G  + GR+L
Sbjct: 126 RGLAFANFTTPEETTQVITSLNGKEISGRKL 156

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 29.6 bits (65), Expect = 8.4,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 745 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQG 800
            P E   +D+   F + G++  + +P       R FAFV+F   +E   A+++L G
Sbjct: 12  FPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEELDG 67

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 24,229,618
Number of extensions: 1030396
Number of successful extensions: 7033
Number of sequences better than 10.0: 592
Number of HSP's gapped: 6443
Number of HSP's successfully gapped: 984
Length of query: 848
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 738
Effective length of database: 12,788,129
Effective search space: 9437639202
Effective search space used: 9437639202
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)