Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B04147g56655728610.0
Scas_705.2355355821270.0
YGR092W (DBF2)57256020770.0
Scas_716.3357356520520.0
Kwal_23.399257156120070.0
CAGL0G03047g53948620020.0
ADR033W57753019310.0
KLLA0D14905g56752319150.0
AFR035W7194835683e-64
Kwal_33.145547145435587e-63
YNL161W (CBK1)7564745536e-62
CAGL0J06072g7734775404e-60
KLLA0D07810g7184865342e-59
Scas_654.127374895282e-58
Scas_720.1038043764068e-42
Scas_629.169183544051e-41
CAGL0K07458g7043834022e-41
YNR047W8933764032e-41
YMR104C (YPK2)6773513967e-41
CAGL0C03509g8952943991e-40
ADR167W8733283981e-40
Kwal_47.167617443813942e-40
YCR091W (KIN82)7203503933e-40
Kwal_23.64588683793934e-40
Scas_689.25*4092983795e-40
Scas_651.183713503757e-40
KLLA0C18568g7743493918e-40
KLLA0B03586g7343953882e-39
Scas_703.57494423872e-39
CAGL0F09075g7464433863e-39
ABL028W7223853792e-38
YHR205W (SCH9)8244483793e-38
KLLA0B07205g4553403684e-38
ADL389W7113893756e-38
YKL126W (YPK1)6803503739e-38
Kwal_33.138463752983601e-37
YJL164C (TPK1)3973583611e-37
YKL166C (TPK3)3982983559e-37
AEL115C3863733513e-36
Scas_721.1246843523605e-36
Kwal_26.76356913733596e-36
CAGL0K03399g7033503597e-36
KLLA0B12716g7163533562e-35
Scas_717.696743513562e-35
CAGL0G09020g3612973422e-35
CAGL0M08404g4623153473e-35
Kwal_56.240593533613387e-35
AFL090W3463023316e-34
KLLA0D03190g3723753311e-33
CAGL0B04301g5422433381e-33
Scas_690.133542983272e-33
Kwal_56.227885151963319e-33
KLLA0F24618g5562213311e-32
YBR028C5252253301e-32
Scas_593.14d4952493237e-32
YDR490C (PKH1)7663203163e-30
YBL105C (PKC1)11513813164e-30
Scas_715.3411503323111e-29
KLLA0E06413g11613323111e-29
YDR466W (PKH3)8982613102e-29
AFR377C7262483055e-29
AEL083W5362203017e-29
CAGL0M09361g11443353041e-28
YOL100W (PKH2)10813263041e-28
Kwal_27.1058111543743032e-28
ACR191C11493633004e-28
Kwal_56.226939843442914e-27
Scas_660.209572982881e-26
KLLA0C12485g9252492763e-25
CAGL0I07513g10762512754e-25
AFR335C10332712745e-25
YMR001C (CDC5)7053422711e-24
CAGL0G04609g9653262702e-24
CAGL0K06479g9912582675e-24
CAGL0K12562g16821652622e-23
KLLA0F11143g8132552584e-23
KLLA0E03487g6472512558e-23
Kwal_56.240913812992491e-22
YFL033C (RIM15)17701572533e-22
KLLA0F09020g9281922513e-22
Scas_502.211162502505e-22
Kwal_56.224766972462496e-22
CAGL0J11638g7463382487e-22
Kwal_26.87967962552452e-21
ACL006W7082722442e-21
ACR218W15691522443e-21
Scas_700.546982982423e-21
ACR142W8372622425e-21
Kwal_47.183076212692405e-21
Kwal_14.115915211692401e-20
KLLA0C06138g7082392381e-20
Scas_707.315981862382e-20
CAGL0M02233g7672842327e-20
KLLA0B02332g3612922251e-19
AFL101C3672912204e-19
CAGL0K08514g14892322274e-19
KLLA0C01650g11122392264e-19
Scas_644.157262442246e-19
KLLA0F09031g6331432221e-18
Scas_616.1014612322212e-18
Scas_627.73492522115e-18
CAGL0M03729g8612022141e-17
ABL034W14252322132e-17
AFR696C11422392132e-17
YCL024W (KCC4)10372202123e-17
Scas_493.211172482104e-17
CAGL0I09504g5282182076e-17
CAGL0K05709g11032392096e-17
YDR507C (GIN4)11422382071e-16
KLLA0F13552g12672322061e-16
CAGL0E05720g3582982001e-16
Scas_700.288962372042e-16
YNR031C (SSK2)15791672052e-16
Scas_660.286232562022e-16
YDR477W (SNF1)6332702023e-16
YKL101W (HSL1)15182392033e-16
Kwal_55.215458651672023e-16
CAGL0M08910g6122492013e-16
YBR274W (CHK1)5271722004e-16
CAGL0M02519g7561812006e-16
YNL298W (CLA4)8422022006e-16
Scas_675.25271681979e-16
YOL113W (SKM1)6552041979e-16
AEL185C5152311961e-15
AER264C14831651981e-15
KLLA0F11319g8431811971e-15
Kwal_26.778812672191981e-15
Kwal_47.182335983251961e-15
KLLA0A07403g8792021972e-15
YDL101C (DUN1)5132441942e-15
AEL230W6083281942e-15
KLLA0A03806g6022481924e-15
YCR073C (SSK22)13311661944e-15
Kwal_23.52908192021925e-15
CAGL0C05005g10761941926e-15
KLLA0E01584g4152791896e-15
AEL205W7932021916e-15
CAGL0L11550g10721681917e-15
CAGL0L07326g5062971897e-15
CAGL0J03828g4672011889e-15
Scas_668.228931941891e-14
Scas_598.67902021891e-14
CAGL0K02673g9151941891e-14
KLLA0C04191g7972221891e-14
YGL158W (RCK1)5121741871e-14
KLLA0F01276g5191821872e-14
Scas_618.156202281872e-14
Scas_720.9416832221892e-14
AFL188C4722731852e-14
YHL007C (STE20)9391941872e-14
YHR102W (KIC1)10801681872e-14
ACR133C8512241872e-14
KLLA0C08525g15511651872e-14
CAGL0M02299g8931811863e-14
Kwal_14.24974181761833e-14
KLLA0A02497g3622111814e-14
Kwal_26.87518482231854e-14
Kwal_23.35904992891834e-14
Kwal_27.97638681951845e-14
KLLA0F12188g5462331835e-14
Scas_580.610151681846e-14
CAGL0M10153g8672231836e-14
Kwal_26.78619552691836e-14
KLLA0B13607g9892431829e-14
AER223C9021891829e-14
ABR014W9711941829e-14
Kwal_23.632515421661821e-13
YLR096W (KIN2)11472511811e-13
Scas_673.20*7581941801e-13
KLLA0B13112g7301911801e-13
Scas_477.57032251801e-13
Scas_613.55172601782e-13
KLLA0E21780g10161671792e-13
YGL179C (TOS3)5602141773e-13
Scas_628.96211771773e-13
CAGL0B02739g6761911764e-13
Scas_640.165051971754e-13
KLLA0C00979g4832191754e-13
Kwal_55.203267501911764e-13
Scas_648.173402081724e-13
Scas_564.712102171766e-13
Kwal_0.1555872531746e-13
AFR724C4401911727e-13
CAGL0L07810g5961921747e-13
Scas_700.354391921719e-13
ACL104C9471681739e-13
YOR233W (KIN4)8002051731e-12
Scas_685.245151931711e-12
Scas_693.1710491831731e-12
KLLA0E11979g6141921711e-12
Scas_651.198012241712e-12
ABL011C7011921712e-12
ACL054W9722761712e-12
KLLA0F19536g11041831712e-12
YCR008W (SAT4)6031901702e-12
Kwal_33.138317001971702e-12
ACL191C3651761672e-12
KLLA0D07304g4651941692e-12
CAGL0B03509g5972191693e-12
YLR362W (STE11)7171911693e-12
CAGL0B01925g9441841693e-12
Scas_573.105692191683e-12
YDR523C (SPS1)4902571673e-12
AER195C5041681673e-12
CAGL0K02167g11622801693e-12
Kwal_33.13222148971554e-12
AAL029W5342761674e-12
YOR231W (MKK1)5081901674e-12
Kwal_55.217093402081644e-12
Kwal_0.3074902051674e-12
CAGL0M11396g11921831684e-12
Scas_711.2515151761685e-12
Scas_707.369152061676e-12
Kwal_33.131125052391666e-12
Scas_713.79831991667e-12
YJL095W (BCK1)14781761668e-12
ACR117W5242021648e-12
ACR119W9311931659e-12
CAGL0H01639g5212031649e-12
KLLA0F16467g3402791611e-11
YOR061W (CKA2)3392081611e-11
Kwal_47.1726311272701641e-11
Kwal_14.14163652111602e-11
CAGL0J03872g6611871622e-11
YOR351C (MEK1)4972481612e-11
ADR300C8902621632e-11
Scas_689.246451661612e-11
CAGL0I06248g8131681622e-11
Kwal_23.55765041701603e-11
YLR248W (RCK2)6102401603e-11
AAR009W4532271584e-11
YDL028C (MPS1)7641841595e-11
CAGL0G02035g3392081565e-11
Scas_640.14*7281931595e-11
CAGL0L06006g9422661595e-11
Scas_718.906471901586e-11
KLLA0D07348g9091781596e-11
Scas_602.1111862251596e-11
AGR058W10711851596e-11
KLLA0B11902g4951701576e-11
AEL284C4792051576e-11
YDR283C (GCN2)16591961596e-11
CAGL0D02244g4872061577e-11
Kwal_56.237178581831587e-11
Scas_688.144791701567e-11
YDL025C6201951577e-11
Kwal_0.964272531567e-11
CAGL0K04169g3982091558e-11
CAGL0L03520g14471661588e-11
CAGL0F04741g4422541559e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B04147g
         (557 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...  1106   0.0  
Scas_705.23                                                           823   0.0  
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   804   0.0  
Scas_716.33                                                           795   0.0  
Kwal_23.3992                                                          777   0.0  
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   775   0.0  
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   748   0.0  
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   742   0.0  
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   223   3e-64
Kwal_33.14554                                                         219   7e-63
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...   217   6e-62
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   212   4e-60
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   210   2e-59
Scas_654.12                                                           207   2e-58
Scas_720.103                                                          160   8e-42
Scas_629.16                                                           160   1e-41
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   159   2e-41
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...   159   2e-41
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...   157   7e-41
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   158   1e-40
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   157   1e-40
Kwal_47.16761                                                         156   2e-40
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   155   3e-40
Kwal_23.6458                                                          155   4e-40
Scas_689.25*                                                          150   5e-40
Scas_651.18                                                           149   7e-40
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   155   8e-40
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   154   2e-39
Scas_703.5                                                            153   2e-39
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   153   3e-39
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   150   2e-38
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   150   3e-38
KLLA0B07205g complement(624606..625973) some similarities with s...   146   4e-38
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   149   6e-38
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...   148   9e-38
Kwal_33.13846                                                         143   1e-37
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   143   1e-37
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...   141   9e-37
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   139   3e-36
Scas_721.124                                                          143   5e-36
Kwal_26.7635                                                          142   6e-36
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   142   7e-36
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   141   2e-35
Scas_717.69                                                           141   2e-35
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   136   2e-35
CAGL0M08404g complement(836791..838179) some similarities with s...   138   3e-35
Kwal_56.24059                                                         134   7e-35
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   132   6e-34
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   132   1e-33
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   134   1e-33
Scas_690.13                                                           130   2e-33
Kwal_56.22788                                                         132   9e-33
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   132   1e-32
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   131   1e-32
Scas_593.14d                                                          129   7e-32
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   126   3e-30
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   126   4e-30
Scas_715.34                                                           124   1e-29
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   124   1e-29
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   124   2e-29
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   122   5e-29
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   120   7e-29
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   121   1e-28
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...   121   1e-28
Kwal_27.10581                                                         121   2e-28
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   120   4e-28
Kwal_56.22693                                                         116   4e-27
Scas_660.20                                                           115   1e-26
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   110   3e-25
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   110   4e-25
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   110   5e-25
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...   108   1e-24
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   108   2e-24
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   107   5e-24
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   105   2e-23
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...   103   4e-23
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   102   8e-23
Kwal_56.24091                                                         100   1e-22
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   102   3e-22
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   101   3e-22
Scas_502.2                                                            100   5e-22
Kwal_56.22476                                                         100   6e-22
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...   100   7e-22
Kwal_26.8796                                                           99   2e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    99   2e-21
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...    99   3e-21
Scas_700.54                                                            98   3e-21
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    98   5e-21
Kwal_47.18307                                                          97   5e-21
Kwal_14.1159                                                           97   1e-20
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    96   1e-20
Scas_707.3                                                             96   2e-20
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    94   7e-20
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    91   1e-19
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    89   4e-19
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    92   4e-19
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    92   4e-19
Scas_644.15                                                            91   6e-19
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...    90   1e-18
Scas_616.10                                                            90   2e-18
Scas_627.7                                                             86   5e-18
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    87   1e-17
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    87   2e-17
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    87   2e-17
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    86   3e-17
Scas_493.2                                                             86   4e-17
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    84   6e-17
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    85   6e-17
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    84   1e-16
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    84   1e-16
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    82   1e-16
Scas_700.28                                                            83   2e-16
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    84   2e-16
Scas_660.28                                                            82   2e-16
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    82   3e-16
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    83   3e-16
Kwal_55.21545                                                          82   3e-16
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    82   3e-16
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    82   4e-16
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    82   6e-16
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    82   6e-16
Scas_675.2                                                             80   9e-16
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    80   9e-16
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    80   1e-15
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    81   1e-15
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    80   1e-15
Kwal_26.7788                                                           81   1e-15
Kwal_47.18233                                                          80   1e-15
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    80   2e-15
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    79   2e-15
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    79   2e-15
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    79   4e-15
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    79   4e-15
Kwal_23.5290                                                           79   5e-15
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    79   6e-15
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    77   6e-15
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    78   6e-15
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    78   7e-15
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    77   7e-15
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    77   9e-15
Scas_668.22                                                            77   1e-14
Scas_598.6                                                             77   1e-14
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    77   1e-14
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    77   1e-14
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    77   1e-14
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    77   2e-14
Scas_618.15                                                            77   2e-14
Scas_720.94                                                            77   2e-14
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    76   2e-14
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    77   2e-14
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    77   2e-14
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    77   2e-14
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    77   2e-14
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    76   3e-14
Kwal_14.2497                                                           75   3e-14
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    74   4e-14
Kwal_26.8751                                                           76   4e-14
Kwal_23.3590                                                           75   4e-14
Kwal_27.9763                                                           75   5e-14
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    75   5e-14
Scas_580.6                                                             75   6e-14
CAGL0M10153g complement(1010688..1013291) some similarities with...    75   6e-14
Kwal_26.7861                                                           75   6e-14
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    75   9e-14
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    75   9e-14
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    75   9e-14
Kwal_23.6325                                                           75   1e-13
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    74   1e-13
Scas_673.20*                                                           74   1e-13
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    74   1e-13
Scas_477.5                                                             74   1e-13
Scas_613.5                                                             73   2e-13
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    74   2e-13
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    73   3e-13
Scas_628.9                                                             73   3e-13
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    72   4e-13
Scas_640.16                                                            72   4e-13
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    72   4e-13
Kwal_55.20326                                                          72   4e-13
Scas_648.17                                                            71   4e-13
Scas_564.7                                                             72   6e-13
Kwal_0.155                                                             72   6e-13
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    71   7e-13
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    72   7e-13
Scas_700.35                                                            70   9e-13
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    71   9e-13
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    71   1e-12
Scas_685.24                                                            70   1e-12
Scas_693.17                                                            71   1e-12
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   1e-12
Scas_651.19                                                            70   2e-12
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    70   2e-12
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    70   2e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    70   2e-12
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    70   2e-12
Kwal_33.13831                                                          70   2e-12
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    69   2e-12
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    70   2e-12
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    70   3e-12
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    70   3e-12
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    70   3e-12
Scas_573.10                                                            69   3e-12
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    69   3e-12
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    69   3e-12
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    70   3e-12
Kwal_33.13222                                                          64   4e-12
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    69   4e-12
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    69   4e-12
Kwal_55.21709                                                          68   4e-12
Kwal_0.307                                                             69   4e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   4e-12
Scas_711.25                                                            69   5e-12
Scas_707.36                                                            69   6e-12
Kwal_33.13112                                                          69   6e-12
Scas_713.7                                                             69   7e-12
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    69   8e-12
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    68   8e-12
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    68   9e-12
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    68   9e-12
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    67   1e-11
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    67   1e-11
Kwal_47.17263                                                          68   1e-11
Kwal_14.1416                                                           66   2e-11
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    67   2e-11
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    67   2e-11
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    67   2e-11
Scas_689.24                                                            67   2e-11
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    67   2e-11
Kwal_23.5576                                                           66   3e-11
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    66   3e-11
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    65   4e-11
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    66   5e-11
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    65   5e-11
Scas_640.14*                                                           66   5e-11
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    66   5e-11
Scas_718.90                                                            65   6e-11
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    66   6e-11
Scas_602.11                                                            66   6e-11
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    66   6e-11
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    65   6e-11
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    65   6e-11
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    66   6e-11
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    65   7e-11
Kwal_56.23717                                                          65   7e-11
Scas_688.14                                                            65   7e-11
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    65   7e-11
Kwal_0.96                                                              65   7e-11
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    64   8e-11
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    65   8e-11
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    64   9e-11
Kwal_26.8703                                                           64   1e-10
Kwal_26.8709                                                           65   1e-10
Scas_700.34                                                            65   1e-10
Kwal_33.14167                                                          65   1e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    65   1e-10
Kwal_17.2687                                                           64   1e-10
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    63   1e-10
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    64   2e-10
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    64   2e-10
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    64   2e-10
Kwal_55.20189                                                          64   2e-10
Kwal_27.12559                                                          63   2e-10
Scas_713.38                                                            63   2e-10
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    63   2e-10
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    64   3e-10
Scas_635.1                                                             62   3e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    64   3e-10
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    63   3e-10
KLLA0D09328g complement(788565..791705) some similarities with s...    64   3e-10
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   3e-10
Scas_683.6                                                             62   4e-10
Kwal_27.10004                                                          63   4e-10
Kwal_47.18098                                                          62   4e-10
Kwal_26.7355                                                           63   4e-10
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    63   4e-10
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    62   4e-10
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    62   4e-10
Scas_643.20                                                            63   5e-10
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    62   5e-10
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    62   5e-10
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    62   5e-10
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    62   5e-10
Scas_619.5*                                                            62   6e-10
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    62   6e-10
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    62   6e-10
Scas_713.21                                                            62   8e-10
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    61   8e-10
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    61   8e-10
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    61   8e-10
CAGL0K01661g complement(146952..148400) some similarities with t...    61   9e-10
Kwal_56.23841                                                          61   9e-10
Kwal_55.22001                                                          61   9e-10
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    61   1e-09
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    62   1e-09
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    62   1e-09
Kwal_23.5668                                                           62   1e-09
Scas_707.34                                                            61   1e-09
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    60   1e-09
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    61   1e-09
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    60   1e-09
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    60   2e-09
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    61   2e-09
Scas_678.24                                                            61   2e-09
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    60   2e-09
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    60   2e-09
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    59   2e-09
KLLA0C16577g complement(1451181..1452695) some similarities with...    60   2e-09
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    60   2e-09
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    60   2e-09
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    60   2e-09
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    60   2e-09
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    60   3e-09
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    59   3e-09
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    60   3e-09
Kwal_26.7154                                                           60   3e-09
Scas_633.29                                                            60   3e-09
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    60   3e-09
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    59   3e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    60   3e-09
Scas_548.6                                                             60   4e-09
CAGL0M08360g complement(833220..835520) some similarities with s...    60   4e-09
Scas_710.28                                                            59   4e-09
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    59   4e-09
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    59   4e-09
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    59   4e-09
Kwal_26.7552                                                           59   4e-09
Kwal_33.14192                                                          59   4e-09
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    60   4e-09
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    59   4e-09
Scas_568.9*                                                            58   4e-09
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    59   5e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    59   5e-09
KLLA0A06820g complement(615686..618004) some similarities with s...    59   5e-09
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    59   5e-09
Scas_704.50                                                            59   5e-09
Scas_703.47                                                            59   5e-09
Kwal_27.9773                                                           59   5e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    60   5e-09
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    59   6e-09
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    59   6e-09
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    59   6e-09
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    59   6e-09
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    58   6e-09
Kwal_14.1273                                                           58   7e-09
Scas_698.37                                                            58   7e-09
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    59   7e-09
Kwal_56.24584                                                          58   8e-09
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    59   8e-09
Scas_582.1                                                             59   8e-09
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    59   9e-09
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    58   9e-09
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    59   9e-09
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    59   1e-08
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    57   1e-08
Scas_544.6                                                             58   1e-08
Kwal_47.17252                                                          58   1e-08
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    58   1e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    57   1e-08
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    58   1e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    58   1e-08
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    58   1e-08
Scas_634.5                                                             58   1e-08
Kwal_27.11803                                                          56   1e-08
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    57   2e-08
Scas_201.1*                                                            56   2e-08
Scas_721.46                                                            56   2e-08
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    57   2e-08
Scas_653.25                                                            57   2e-08
KLLA0C03938g complement(358851..360632) some similarities with s...    57   2e-08
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    57   2e-08
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    57   2e-08
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    56   3e-08
Scas_680.20                                                            57   3e-08
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    56   3e-08
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    57   3e-08
Scas_610.7                                                             57   3e-08
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    57   4e-08
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    57   4e-08
Kwal_47.17345                                                          56   4e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    57   4e-08
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    56   5e-08
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    55   6e-08
Scas_667.18                                                            55   6e-08
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    55   7e-08
Kwal_33.14434                                                          56   7e-08
Scas_683.12                                                            55   8e-08
Scas_692.24                                                            55   8e-08
Kwal_33.14081                                                          55   8e-08
Scas_684.28                                                            55   9e-08
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    55   1e-07
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    55   1e-07
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    54   1e-07
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    54   1e-07
Kwal_27.11830                                                          55   1e-07
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    55   1e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    54   2e-07
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    54   2e-07
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    54   2e-07
Scas_655.2                                                             54   2e-07
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    54   2e-07
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    54   2e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    54   2e-07
Kwal_26.8941                                                           54   3e-07
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    53   3e-07
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    53   3e-07
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    53   4e-07
Kwal_33.13681                                                          53   5e-07
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    52   5e-07
Scas_649.30                                                            53   5e-07
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    53   6e-07
Scas_677.18                                                            53   6e-07
Scas_618.8                                                             52   6e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    52   6e-07
Scas_623.11                                                            52   6e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    52   7e-07
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    51   8e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    52   9e-07
Scas_651.3                                                             52   1e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    52   1e-06
CAGL0K11990g complement(1155395..1158370) some similarities with...    52   1e-06
Scas_22.1                                                              50   1e-06
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    52   1e-06
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    52   1e-06
Kwal_23.4276                                                           51   2e-06
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    51   2e-06
Scas_695.33                                                            51   2e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    51   2e-06
Scas_584.11                                                            51   2e-06
Scas_718.72                                                            51   2e-06
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    51   2e-06
Scas_568.13                                                            50   2e-06
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    50   2e-06
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    51   2e-06
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    50   2e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    51   2e-06
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    51   2e-06
Kwal_47.17868                                                          50   3e-06
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    50   3e-06
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    50   3e-06
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    50   3e-06
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    50   3e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    50   3e-06
Scas_721.110                                                           50   3e-06
Scas_673.34*                                                           50   4e-06
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    49   4e-06
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    50   4e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    49   6e-06
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    49   7e-06
Scas_613.13*                                                           49   7e-06
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    49   7e-06
Kwal_27.11919                                                          47   7e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    49   9e-06
Scas_716.73                                                            49   9e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    49   1e-05
Kwal_33.13984                                                          49   1e-05
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    49   1e-05
KLLA0F22297g complement(2083448..2085547) some similarities with...    49   1e-05
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    48   2e-05
Kwal_55.21900                                                          48   2e-05
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    47   2e-05
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    47   2e-05
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    48   2e-05
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    48   2e-05
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    48   2e-05
Scas_671.16                                                            47   3e-05
Scas_721.132                                                           47   3e-05
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    47   3e-05
Kwal_23.3471                                                           46   3e-05
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    47   3e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    46   4e-05
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    47   4e-05
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    47   5e-05
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    47   5e-05
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    46   5e-05
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    46   6e-05
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    46   7e-05
Kwal_26.8347                                                           46   8e-05
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    45   9e-05
Scas_711.15                                                            45   1e-04
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    45   1e-04
Kwal_27.9804                                                           45   1e-04
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    45   1e-04
KLLA0B06501g complement(576636..579089) some similarities with s...    45   1e-04
Scas_661.27                                                            45   2e-04
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    44   2e-04
CAGL0K01815g 162144..163658 similar to sp|P06243 Saccharomyces c...    44   3e-04
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    44   3e-04
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    44   3e-04
Scas_654.17                                                            44   3e-04
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    44   4e-04
KLLA0D12100g complement(1031728..1033161) some similarities with...    44   4e-04
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    44   5e-04
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    43   5e-04
ABL055C [537] [Homologous to ScYKL116C (PRR1) - SH] (295497..297...    43   5e-04
Scas_601.6                                                             43   5e-04
Kwal_27.11777                                                          43   5e-04
CAGL0K11550g 1118142..1119758 similar to sp|P28708 Saccharomyces...    43   6e-04
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    43   6e-04
Scas_678.13                                                            42   8e-04
AGR315C [4626] [Homologous to ScYGR188C (BUB1) - SH; ScYJL013C (...    43   8e-04

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/557 (95%), Positives = 533/557 (95%)

Query: 1   MFRREKEDGVEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQYKENRSGASPYSTSP 60
           MFRREKEDGVEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQYKENRSGASPYSTSP
Sbjct: 1   MFRREKEDGVEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQYKENRSGASPYSTSP 60

Query: 61  TKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVISRR 120
           TKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVISRR
Sbjct: 61  TKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVISRR 120

Query: 121 QRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITXXXXX 180
           QRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMIT     
Sbjct: 121 QRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITQVGQG 180

Query: 181 XXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQD 240
                 LARKRDTKEVCA             ETNHILTERDILTTTRSEWLVKLLYAFQD
Sbjct: 181 GYGQVYLARKRDTKEVCALKILNKKLLVKLNETNHILTERDILTTTRSEWLVKLLYAFQD 240

Query: 241 PESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENF 300
           PESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENF
Sbjct: 241 PESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENF 300

Query: 301 LIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360
           LIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ
Sbjct: 301 LIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360

Query: 361 NDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
           NDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN
Sbjct: 361 NDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420

Query: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLR 480
           LRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLR
Sbjct: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLR 480

Query: 481 QLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFR 540
           QLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFR
Sbjct: 481 QLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFR 540

Query: 541 HKNGNTGSSGVLYKGHE 557
           HKNGNTGSSGVLYKGHE
Sbjct: 541 HKNGNTGSSGVLYKGHE 557

>Scas_705.23
          Length = 553

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/558 (72%), Positives = 460/558 (82%), Gaps = 15/558 (2%)

Query: 1   MFRREKEDGVEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQY-KENRSGASPYSTS 59
           MF R  +D V+ + GN++QLGLN          P  ++   TPT+  KENRS  SP  + 
Sbjct: 1   MFPRSDKD-VDQLVGNLNQLGLN---------KPNARFVSVTPTRANKENRSSLSPSPSP 50

Query: 60  PTKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVISR 119
                F  ++    + NSPKKLP DF++KA SN T+R+V+VCQMYFLDYYCDMFDYVISR
Sbjct: 51  NKTKRFTADETE--LKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISR 108

Query: 120 RQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITXXXX 179
           RQRTK ++ N  E  QN ++  E+LN EW  YLQ+EH+VLRKRRLKPKNKDFEMIT    
Sbjct: 109 RQRTKSVL-NYLERNQN-SLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITQVGQ 166

Query: 180 XXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQ 239
                  LARKRDTKEVCA             ETNH+LTERDILTTTRS+WLVKLLYAFQ
Sbjct: 167 GGYGQVYLARKRDTKEVCALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQ 226

Query: 240 DPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPEN 299
           D ESLYLAMEFVPGGDFRTLLINTR LR+ HARFYISEMFCAVNALHELGYTHRDLKPEN
Sbjct: 227 DTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPEN 286

Query: 300 FLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLR 359
           FLID+EGHIKLTDFGLAAGT+S ERI+SMKIRLEEVKNLEFPAFTEKSIEDRRK+Y +LR
Sbjct: 287 FLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLR 346

Query: 360 QNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYE 419
           Q ++NYANSMVGSPDYMALEVLEGKKYD+TVDYWSLGCMLFE+L+GYTPFSGSSTNETYE
Sbjct: 347 QTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYE 406

Query: 420 NLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTL 479
           NLRHWK+TLRRP L++GR A SDR W++ITRLIADPINRLRSFEH+KRM YF E+NF+TL
Sbjct: 407 NLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTL 466

Query: 480 RQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTF 539
           RQ +PPFTPQLD+ETDAGYFDDFTNEADMAKYADVFKRQ+KL++MVDDS VDSKL+GFTF
Sbjct: 467 RQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTF 526

Query: 540 RHKNGNTGSSGVLYKGHE 557
           RH+NG  G SG+LY G E
Sbjct: 527 RHRNGQKGLSGILYNGSE 544

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/560 (70%), Positives = 452/560 (80%), Gaps = 7/560 (1%)

Query: 5   EKEDGVEDITGNISQLGLNGTLSPA-TGNTPFKKYAP--STPTQYKENRSGASP----YS 57
           + E  V+ + GN+S L  +G  +P  TG  P +      + P    ++ S   P    Y 
Sbjct: 4   KSEKNVDLLAGNMSNLSFDGHGTPGGTGLFPNQNITKRRTRPAGINDSPSPVKPSFFPYE 63

Query: 58  TSPTKSIFKKEKPRERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVI 117
            +    I +  +P   + NSPKKLP  F+ +ATSNKTQR+VSVC+MYFL++YCDMFDYVI
Sbjct: 64  DTSNMDIDEVSQPDMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFDYVI 123

Query: 118 SRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITXX 177
           SRRQRTKQ++  +Q+  Q       +LNEEW++YLQ+EH+VLRKRRLKPKN+DFEMIT  
Sbjct: 124 SRRQRTKQVLEYLQQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMITQV 183

Query: 178 XXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYA 237
                    LARK+DTKEVCA             ET H+LTERDILTTTRSEWLVKLLYA
Sbjct: 184 GQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLYA 243

Query: 238 FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKP 297
           FQD +SLYLAMEFVPGGDFRTLLINTR L+S HARFYISEMFCAVNALH+LGYTHRDLKP
Sbjct: 244 FQDLQSLYLAMEFVPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKP 303

Query: 298 ENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQN 357
           ENFLIDA+GHIKLTDFGLAAGT+SNERIESMKIRLE++K+LEFPAFTEKSIEDRRK+Y  
Sbjct: 304 ENFLIDAKGHIKLTDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKMYNQ 363

Query: 358 LRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNET 417
           LR+ +INYANSMVGSPDYMALEVLEGKKYD+TVDYWSLGCMLFE+L+GYTPFSGSSTNET
Sbjct: 364 LREKEINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNET 423

Query: 418 YENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFD 477
           Y+NLR WK+TLRRP  +DGR+A SDR W+LITRLIADPINRLRSFEHVKRM+YF +INF 
Sbjct: 424 YDNLRRWKQTLRRPRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADINFS 483

Query: 478 TLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGF 537
           TLR + PPFTPQLD+ETDAGYFDDFT+EADMAKYADVFKRQDKL AMVDDS V SKL+GF
Sbjct: 484 TLRSMIPPFTPQLDSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKLVGF 543

Query: 538 TFRHKNGNTGSSGVLYKGHE 557
           TFRH+NG  GSSG+L+ G E
Sbjct: 544 TFRHRNGKQGSSGILFNGLE 563

>Scas_716.33
          Length = 573

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/565 (68%), Positives = 451/565 (79%), Gaps = 17/565 (3%)

Query: 7   EDGVEDITGNISQLGLNGTLSPATGNTPFKKYAP----STPTQYKENRSGASP------- 55
           E  +E++TG + QL  N    P  G+T   ++A     STPT+YK ++   SP       
Sbjct: 3   ERKMENLTGTMHQLNFNLPNQPNRGST--SQFASLDNFSTPTKYKNDKLNGSPIPPGARR 60

Query: 56  YSTSPTKSIFKKEKPRER---IINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDM 112
           Y    + S    +        I NSPKKLP+ F   A++NKTQRLVSVC+MYFLDYYCDM
Sbjct: 61  YEIDDSDSKMDIDGSSYNDIDITNSPKKLPQGFQTMASNNKTQRLVSVCKMYFLDYYCDM 120

Query: 113 FDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFE 172
           FDYVISRRQRTK+++  +++ K+N  +    LN EWN Y+Q+EH+VLRKRRLKPK+KDFE
Sbjct: 121 FDYVISRRQRTKKVLEYLEQ-KKNENVDLNSLNNEWNGYIQREHQVLRKRRLKPKHKDFE 179

Query: 173 MITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLV 232
           MIT           LARK+DT EVCA             ETNH+LTERDILTTTRS+WLV
Sbjct: 180 MITQVGQGGYGQVYLARKKDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQWLV 239

Query: 233 KLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTH 292
           KLLYAFQD ++LYLAMEFVPGGDFRTLLINTR L+S HARFYISEMF AVNALH+LGYTH
Sbjct: 240 KLLYAFQDTQNLYLAMEFVPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALHDLGYTH 299

Query: 293 RDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRR 352
           RDLKPENFLIDA+GHIKLTDFGLAAGT+SN+RI+SMK+RLEEVKNLEFP F++KSIEDRR
Sbjct: 300 RDLKPENFLIDAKGHIKLTDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSIEDRR 359

Query: 353 KIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGS 412
           ++YQ  R+ ++NYANSMVGSPDYMALEVLEGKKYD+TVDYWSL CMLFE+L+GYTPFSGS
Sbjct: 360 QMYQKYRETEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTPFSGS 419

Query: 413 STNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFH 472
           STNETYENLRHWK+TLRRP L++GR A SDR W+ ITRLIADPINRLRSFEHVKRM YF 
Sbjct: 420 STNETYENLRHWKKTLRRPMLDNGRPAFSDRTWDFITRLIADPINRLRSFEHVKRMTYFE 479

Query: 473 EINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDS 532
            ++F+TLR LSPPF PQLDNETDAGYFDDFTNEADMAKYADVFKRQ+KL+ MV+D+++DS
Sbjct: 480 SVDFNTLRDLSPPFIPQLDNETDAGYFDDFTNEADMAKYADVFKRQNKLSTMVNDADIDS 539

Query: 533 KLIGFTFRHKNGNTGSSGVLYKGHE 557
           KL+GFTFRH+ G  GSSGVLY G E
Sbjct: 540 KLVGFTFRHRYGKNGSSGVLYNGLE 564

>Kwal_23.3992
          Length = 571

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/561 (67%), Positives = 444/561 (79%), Gaps = 24/561 (4%)

Query: 10  VEDITGNISQLGLNGTLSPATGNTPFKKYAPSTPTQYKENRSGASPYSTSPTKSIFKKEK 69
           +E +T NI QL  +  +     ++P   Y PSTP++++ +    SP     +KS+   + 
Sbjct: 13  IESLTDNIGQLSFDAAV-----DSPKYHYPPSTPSKFRGDVDNPSP-----SKSVNGADV 62

Query: 70  PRERIIN-------------SPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYV 116
            R  +++             SPKKLP DFHRKA+S  T+RLV+VCQMYFLDYYCDMFDYV
Sbjct: 63  SRTSMMDIDDTSNVDIDYTQSPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDYV 122

Query: 117 ISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITX 176
           ISRR+RT+Q++  +++ ++   I  E+L++EW  YL KE  +LRKRRLKPKNKDFEMIT 
Sbjct: 123 ISRRERTRQVMKYLEQ-QRTQGIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITQ 181

Query: 177 XXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLY 236
                     LARKRDT+E+CA             ETNH+LTERDILTTTRSEWLVKLLY
Sbjct: 182 VGQGGYGQVYLARKRDTREICALKILNKKLLIKLNETNHVLTERDILTTTRSEWLVKLLY 241

Query: 237 AFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLK 296
           AFQDP SLYLAMEFVPGGD+RTLLINTR L++PHARFYISEMFCAV+ALH+LGYTHRDLK
Sbjct: 242 AFQDPSSLYLAMEFVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLK 301

Query: 297 PENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQ 356
           PENFLID+ GHIKLTDFGLAAGTVS ERIESMKIRLEEVKNL+FP F EKS+ DRR++Y 
Sbjct: 302 PENFLIDSRGHIKLTDFGLAAGTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYT 361

Query: 357 NLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNE 416
           NLR+ND+NYA+S VGSPDYMALEVLE K YD+TVDYWSLGC+LFE+L+GYTPFSGSSTNE
Sbjct: 362 NLRENDVNYASSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNE 421

Query: 417 TYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINF 476
           TYENLR WK+ LRRP  ++GR A SDR W+LI RLIADPI+RLRSFEHVK+M YF EI+F
Sbjct: 422 TYENLRCWKQVLRRPRCDNGRYAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISF 481

Query: 477 DTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIG 536
           + LR +SPPF PQLDNETDAGYFDDFT+EADMAKYADVFKRQDKL+AMVDDS+  SKL+G
Sbjct: 482 ENLRNVSPPFIPQLDNETDAGYFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVG 541

Query: 537 FTFRHKNGNTGSSGVLYKGHE 557
           FT+RHK G  GSSGV+Y G E
Sbjct: 542 FTYRHKKGKNGSSGVIYGGPE 562

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/486 (75%), Positives = 412/486 (84%)

Query: 72  ERIINSPKKLPRDFHRKATSNKTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQ 131
           + +++SPKKLP  F  KA++NKTQRLV VC+MYFL+YYCDMFDYVISRRQRTKQ++  ++
Sbjct: 45  DELLHSPKKLPAGFRSKASNNKTQRLVGVCKMYFLEYYCDMFDYVISRRQRTKQIMEYLR 104

Query: 132 EYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKR 191
           +  +N  + +   + EW  YL KE+ +LRKRRLKPKN DFEM+T           LARKR
Sbjct: 105 QENENGRLDEHTADTEWRGYLAKENNILRKRRLKPKNNDFEMLTQVGQGGYGQVYLARKR 164

Query: 192 DTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFV 251
           DTKEVCA             ETNH+LTERDILTTTRSEWLVKLLYAFQD  SLYLAMEFV
Sbjct: 165 DTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRSEWLVKLLYAFQDSSSLYLAMEFV 224

Query: 252 PGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLT 311
           PGGDFRTLLINT+ L+S HARFYISEMFCAVNALHELGYTHRDLKPENFLIDA+GHIKLT
Sbjct: 225 PGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLT 284

Query: 312 DFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVG 371
           DFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTE+ IEDRRK+Y +LR  DINYANSMVG
Sbjct: 285 DFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPIEDRRKMYHDLRDTDINYANSMVG 344

Query: 372 SPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRP 431
           SPDYMALEVLEGKKYD+TVDYWSLGCMLFE+L+ +TPFSG++TNETYENLRHW++TLRRP
Sbjct: 345 SPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTPFSGATTNETYENLRHWRKTLRRP 404

Query: 432 FLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLD 491
            L +GR A+SDR W  IT LIADPINRL+SFEHVKRM YF EI+F  LR++SPPF PQLD
Sbjct: 405 RLGNGRYAVSDRTWAFITSLIADPINRLKSFEHVKRMPYFSEIDFSKLREMSPPFIPQLD 464

Query: 492 NETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGV 551
           +E DAGYFDDFTNEADMAKYADVFKRQ+KL AM+DDS VDSKL+GFTFRH+NG  GSSG+
Sbjct: 465 SEVDAGYFDDFTNEADMAKYADVFKRQNKLNAMIDDSAVDSKLVGFTFRHRNGKHGSSGI 524

Query: 552 LYKGHE 557
           LY G E
Sbjct: 525 LYNGAE 530

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/530 (67%), Positives = 426/530 (80%), Gaps = 12/530 (2%)

Query: 40  PSTPTQY-KENRSGASP---------YSTSPTKSIFKKEKPRERI--INSPKKLPRDFHR 87
           P TP++Y +   +G SP            +    +   E+PR+ I    SPKKLP DFH+
Sbjct: 39  PHTPSRYLQRTPNGKSPAGRQGGYLTVENADYSGMDVDERPRDDIDLSRSPKKLPMDFHK 98

Query: 88  KATSNKTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEE 147
           +A+S KT+RLVSVCQM+FLDYYCDMFDYVISRR+RT+Q+++ +++ +       ++++EE
Sbjct: 99  RASSTKTKRLVSVCQMFFLDYYCDMFDYVISRRERTRQVMNYLEQQRAQGLHSAQEISEE 158

Query: 148 WNNYLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXX 207
           W NYL +E ++LRKRRLKPKNKDFE+IT           LARK+DTKE+CA         
Sbjct: 159 WQNYLYRETDILRKRRLKPKNKDFEIITQVGQGGYGQVYLARKKDTKEICALKILNKNLL 218

Query: 208 XXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLR 267
                T+H+LTERDILTTTRSEWLVKLLYAFQDP SLYLAMEFVPGGD+RTLLINTR L+
Sbjct: 219 AKLNGTDHVLTERDILTTTRSEWLVKLLYAFQDPHSLYLAMEFVPGGDYRTLLINTRFLQ 278

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
           +PHARFYISEMFCAV+ALH+LGYTHRDLKPENFLID++GHIKLTDFGLA+GTVS ERIES
Sbjct: 279 APHARFYISEMFCAVDALHKLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIES 338

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
           M+IRLEEVKNLEFP F E S++ RRK+Y  +R+ ++NYA+S VGSPDYMALEVLE K YD
Sbjct: 339 MRIRLEEVKNLEFPEFKETSMDYRRKMYHRVREKELNYASSTVGSPDYMALEVLEAKNYD 398

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWEL 447
           +TVDYWSLGC+LFE+L+GYTPFSGSS+NETYENLR WK+ LRRP   +GR A SDR WEL
Sbjct: 399 FTVDYWSLGCILFESLVGYTPFSGSSSNETYENLRRWKQVLRRPRCENGRPAFSDRTWEL 458

Query: 448 ITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEAD 507
           ITRLIADPINRLRSFEHVK+M YF EI+F  LR +SPPF PQLD+ETDAGYFDDFTNEAD
Sbjct: 459 ITRLIADPINRLRSFEHVKKMKYFAEIDFANLRSMSPPFIPQLDSETDAGYFDDFTNEAD 518

Query: 508 MAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGVLYKGHE 557
           MAKYADVFKRQDKL AMV++S   SKL+GFTFRH+ G TGSSGVL+ G E
Sbjct: 519 MAKYADVFKRQDKLNAMVEESSNSSKLVGFTFRHRKGKTGSSGVLHNGSE 568

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/523 (67%), Positives = 423/523 (80%), Gaps = 5/523 (0%)

Query: 40  PSTPTQYKENRSGASPYSTSPTKSIFKKEKPRE-----RIINSPKKLPRDFHRKATSNKT 94
           PSTPT+ + + S       +P  S+   +   +      I  SPKKLP+DF++K++  K+
Sbjct: 36  PSTPTRIRGSPSPTRSIVKNPENSLMDIDDDTQGDLTADITKSPKKLPKDFYKKSSKTKS 95

Query: 95  QRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQK 154
           +RLVSVCQMYFLDYYCDMFDYVISRR+RT+Q+I+ ++E ++++ +  EQ+  EW  YL K
Sbjct: 96  KRLVSVCQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTK 155

Query: 155 EHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETN 214
           E  +LRKRRLKPK+KDFEMIT           LARK+DTKE+CA              T+
Sbjct: 156 ETNILRKRRLKPKHKDFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTD 215

Query: 215 HILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFY 274
           H+LTERDILTTTRSEWLVKLLYAFQDP+SLYLAMEFVPGGDFRTLL+NT+ L++PHARFY
Sbjct: 216 HVLTERDILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFY 275

Query: 275 ISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE 334
           ISEMFCAVNALH+LGYTHRDLKPENFLID++GHIKLTDFGLA+GTVS ERIESMKIRL+E
Sbjct: 276 ISEMFCAVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQE 335

Query: 335 VKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWS 394
           VKNLEFP F E+S++DRR++Y  LR+ ++ YA+S VGSPDYMALEVLE K YD+TVDYWS
Sbjct: 336 VKNLEFPEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWS 395

Query: 395 LGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIAD 454
           LGC+LFE+L+GYTPFSG+STNETYENLR+WK  L+RP  ++GR A SDR WELITRLIAD
Sbjct: 396 LGCILFESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIAD 455

Query: 455 PINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADV 514
           PINRL+SFEHVKRM YF EI+F+TLR + PPF PQLDNE D GYFDDFTNE  MA+Y DV
Sbjct: 456 PINRLKSFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDV 515

Query: 515 FKRQDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGVLYKGHE 557
           FKRQD+L AMVDDS  DSKL+GFTFRH+NG  GSSGVLY G E
Sbjct: 516 FKRQDRLTAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLE 558

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  223 bits (568), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 146/483 (30%), Positives = 244/483 (50%), Gaps = 43/483 (8%)

Query: 91  SNKTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNN 150
           S  TQ   +  ++   ++Y    ++ I R QR  ++ S +     +H   +E+ N + ++
Sbjct: 234 SKSTQEKAAAVKLKVENFYQSSVNHAIERNQRRVELESQLL----SHGWSEERKNRQLSS 289

Query: 151 YLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXX 210
             +KE + LR RR +   +DF  +            L +K+DT ++ A            
Sbjct: 290 LGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKK 349

Query: 211 XETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPH 270
            +  H+  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +      
Sbjct: 350 DQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDV 409

Query: 271 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKI 330
            RFY++E   A+ A+H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G          K 
Sbjct: 410 TRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKK 469

Query: 331 RLEEVKNLE-------FPAFTEK-----------------SIEDRRKIYQNLRQNDINYA 366
            L+E +  +       +PA                     ++ +R+++ Q  R++    A
Sbjct: 470 LLQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIHLTMTNRQQM-QTWRKSRRLMA 528

Query: 367 NSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKR 426
            S VG+PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + ++++
Sbjct: 529 YSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQ 588

Query: 427 TLRRPFLNDGRSAISDRAWELITRLIADPINRL--RSFEHVKRMNYFHEINFDTLRQLSP 484
           TL  P  +D    IS  A +LI RL++    RL       +K   +F  ++++T+RQ+  
Sbjct: 589 TLVFP--DDIH--ISYEAEDLIRRLLSHADERLGRHGANEIKNHPFFRGVDWETIRQVGA 644

Query: 485 PFTPQLDNETDAGYF--DDFTNEADMAKYADVFKRQDKL------AAMVDDSEVDSKLIG 536
           P+ P+L + TD  +F  D+  N  D    A   K+++++      AA    ++ D   IG
Sbjct: 645 PYIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQMLKQGGSAANTAQAKEDLPFIG 704

Query: 537 FTF 539
           +T+
Sbjct: 705 YTY 707

>Kwal_33.14554
          Length = 714

 Score =  219 bits (558), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 157/543 (28%), Positives = 266/543 (48%), Gaps = 59/543 (10%)

Query: 45  QYKENRSGASPYSTSPTKSIFKKEK------PRERIINSPKKLPRD--FHRKA--TSNKT 94
           Q ++  +   P   SP +SI    +      P++R ++  K +     F R+    S  T
Sbjct: 171 QNQQQFTPVPPLQNSPVRSIRGVGQQQPLVEPQQRHLSPAKPVSNYMYFERRPELLSKST 230

Query: 95  QRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNI--QEYKQNHTIPDEQLNEEWNNYL 152
           Q   +  ++   ++Y    +Y I R QR  ++ S +  Q++       DE+ + + +   
Sbjct: 231 QDKAATVKLKIENFYQSSVNYAIERNQRRVELESQLVSQDWS------DERKSRQLSTLG 284

Query: 153 QKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXE 212
           +KE + LR RR +   +DF+ +            L +K+DT ++ A             +
Sbjct: 285 RKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQ 344

Query: 213 TNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHAR 272
             H+  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       R
Sbjct: 345 LAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTR 404

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRL 332
           FY++E   A+ A+H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G          K  L
Sbjct: 405 FYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLL 464

Query: 333 EE------VKNLEFPAF----------------------TEKSIEDRRKIYQNLRQNDIN 364
           ++        +L+ P                           ++ +R++I Q  R++   
Sbjct: 465 QQDEVNAAAGSLQKPQMGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQI-QTWRKSRRL 523

Query: 365 YANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHW 424
            A S VG+PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + ++
Sbjct: 524 MAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNF 583

Query: 425 KRTLRRPFLNDGRSAISDRAWELITRLIADPINRL---RSFEHVKRMNYFHEINFDTLRQ 481
           ++TL+ P  +D    IS  A +LI RL+     RL      + +K   +F  ++++T+RQ
Sbjct: 584 EQTLQFP--DDIH--ISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQ 639

Query: 482 LSPPFTPQLDNETDAGYF--DDFTNEADMAKYADVFKRQDKL---AAMVDDSEVDSKLIG 536
           +  P+ P+L + TD  +F  D+  N  D    A   ++++++    A    S+ D   IG
Sbjct: 640 VEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGAANPSSKEDLPFIG 699

Query: 537 FTF 539
           +T+
Sbjct: 700 YTY 702

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score =  217 bits (553), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 139/474 (29%), Positives = 234/474 (49%), Gaps = 36/474 (7%)

Query: 94  TQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQ 153
           TQ   +  ++   ++Y     Y I R +R  ++ + +     +H   +E+ + + ++  +
Sbjct: 279 TQDKAAAVKLKIENFYQSSVKYAIERNERRVELETELT----SHNWSEERKSRQLSSLGK 334

Query: 154 KEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXET 213
           KE + LR RR +   +DF  +            L +K+DT ++ A             + 
Sbjct: 335 KESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKDQL 394

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF 273
            H+  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       RF
Sbjct: 395 AHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRF 454

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAG---TVSNERIESMKI 330
           Y++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T  +   + +  
Sbjct: 455 YMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQ 514

Query: 331 RLEEVKNLEFPAFTEKSIED------------------RRKIYQNLRQNDINYANSMVGS 372
           + E    +  P     +  D                   R+  Q  R++    A S VG+
Sbjct: 515 QDEATNGISKPGTYNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTVGT 574

Query: 373 PDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF 432
           PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + ++++TL+ P 
Sbjct: 575 PDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP- 633

Query: 433 LNDGRSAISDRAWELITRLIADPINRL---RSFEHVKRMNYFHEINFDTLRQLSPPFTPQ 489
                  IS  A +LI RL+     RL      + +K   +F  ++++T+RQ+  P+ P+
Sbjct: 634 ---DDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYIPK 690

Query: 490 LDNETDAGYF--DDFTNEADMAKYADVFKRQDKLAAMVDDSEV--DSKLIGFTF 539
           L + TD  +F  D+  N  D    A   K+++++      + V  D   IG+T+
Sbjct: 691 LSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPFIGYTY 744

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  212 bits (540), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 144/477 (30%), Positives = 237/477 (49%), Gaps = 37/477 (7%)

Query: 91  SNKTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNN 150
           S  TQ   +  ++   +YY     Y I R +R  ++ + +     +H   +E+   +  +
Sbjct: 294 SKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELG----SHNWSEERNARQLAS 349

Query: 151 YLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXX 210
             +KE + LR RR +   +DF  +            L +K+DT ++ A            
Sbjct: 350 LGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKK 409

Query: 211 XETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPH 270
            +  H+  ERD+L  T S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +      
Sbjct: 410 DQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDV 469

Query: 271 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKI 330
            RFY++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G          K 
Sbjct: 470 TRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKK 529

Query: 331 RLEE----VKNLEFPAFTEKS--------------IEDRRKIYQNLRQNDINYANSMVGS 372
            L++     KN       + S              + +R++I Q  R++    A S VG+
Sbjct: 530 LLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQI-QTWRKSRRLMAYSTVGT 588

Query: 373 PDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF 432
           PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + ++++TL+ P 
Sbjct: 589 PDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFP- 647

Query: 433 LNDGRSAISDRAWELITRLIADPINRL---RSFEHVKRMNYFHEINFDTLRQLSPPFTPQ 489
                  IS  A +LI RL+     RL      + +K   +F  ++++T+RQ+  P+ P+
Sbjct: 648 ---EDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTIRQVEAPYIPK 704

Query: 490 LDNETDAGYF--DDFTNEADMAKYADVFKRQDKL---AAMVDDSEV--DSKLIGFTF 539
           L + TD  +F  D+  N  D    A   K+++++       + ++V  D   IG+T+
Sbjct: 705 LSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKNGVNPNQNQVKEDLPFIGYTY 761

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 140/486 (28%), Positives = 234/486 (48%), Gaps = 49/486 (10%)

Query: 94  TQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQ 153
           TQ   +  ++   ++Y     Y I R QR  ++ S +     +    +E+ N +  +  +
Sbjct: 230 TQDKAAAVKLKIENFYQSSVGYAIERNQRRLELESELA----SQDWSEERKNRQLASLGK 285

Query: 154 KEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXET 213
           KE + LR RR +    DF  +            L +K+DT ++ A             + 
Sbjct: 286 KESQFLRLRRTRLSLDDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKDQL 345

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF 273
            H+  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       RF
Sbjct: 346 AHVKAERDVLAGSDSPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVTRF 405

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
           Y++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G          K  L+
Sbjct: 406 YMAECILAIEVIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSSYYKKLLQ 465

Query: 334 E------------------------------VKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
           E                               +N         ++ +R+++ Q  R++  
Sbjct: 466 EDEAKKQQQQQQQQQQLNLQKPQLPNETNNGNRNTMLVDAIHLTMTNRQQM-QTWRKSRR 524

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH 423
             A S VG+PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + +
Sbjct: 525 LMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMN 584

Query: 424 WKRTLRRPFLNDGRSAISDRAWELITRLIADPINRL---RSFEHVKRMNYFHEINFDTLR 480
           +++TL+ P        IS  A +LI RL+    NRL      + +K   +F  ++++T+R
Sbjct: 585 FEQTLQFP----DDIHISYEAEDLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNTIR 640

Query: 481 QLSPPFTPQLDNETDAGYF--DDFTNEADMAKYADVFKRQDKL-----AAMVDDSEVDSK 533
           Q+  P+ P+L + TD  +F  D+  N  D    A   ++++++          +++ D  
Sbjct: 641 QVEAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAARQREQMMTQQQGVPQSNAKEDLP 700

Query: 534 LIGFTF 539
            IG+T+
Sbjct: 701 FIGYTY 706

>Scas_654.12
          Length = 737

 Score =  207 bits (528), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 142/489 (29%), Positives = 235/489 (48%), Gaps = 52/489 (10%)

Query: 94  TQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQ 153
           TQ   +  ++   ++Y     Y I R +R  ++ + +     +H   +E+ N +  +  +
Sbjct: 246 TQDKAAAIKLKIENFYQSSVKYAIERNERRVELETELA----SHDWSEERRNRQLASLGK 301

Query: 154 KEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXET 213
           KE + LR RR +   +DF  +            L +K DT ++ A             + 
Sbjct: 302 KESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKDQL 361

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF 273
            H+  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       RF
Sbjct: 362 AHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVTRF 421

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
           Y++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G          K  L+
Sbjct: 422 YMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKLLQ 481

Query: 334 E----VKNLEFPA---------------------------FTEKSIEDRRKIYQNLRQND 362
           E       L  P                                ++ +R++I Q  R++ 
Sbjct: 482 EDEANTTGLSKPGQPGNINNDGSSNADGSNKENRQSMMVDSINLTMSNRQQI-QTWRKSR 540

Query: 363 INYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              A S VG+PDY+A E+   + Y    D+WSLG +++E LIG+ PF   +  ETY  + 
Sbjct: 541 RLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIM 600

Query: 423 HWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRL---RSFEHVKRMNYFHEINFDTL 479
           ++++TL+ P        IS  A +LI RL+     RL      + +K   +F  ++++T+
Sbjct: 601 NFEQTLQFP----DDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTI 656

Query: 480 RQLSPPFTPQLDNETDAGYF--DDFTNEADMAKYADVFKRQDKL---AAMVDDSEVDSK- 533
           RQ+  P+ P+L + TD  +F  D+  N  D    A   K+++++      V+ +   +K 
Sbjct: 657 RQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKQGGPVNGNNTPTKE 716

Query: 534 ---LIGFTF 539
               IG+T+
Sbjct: 717 DLPFIGYTY 725

>Scas_720.103
          Length = 804

 Score =  160 bits (406), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 113/376 (30%), Positives = 183/376 (48%), Gaps = 38/376 (10%)

Query: 136 NHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKN------------KDFEMITXXXXXXXX 183
           NHT  + Q++++   Y   + E  R +RL+ K+            + FE I         
Sbjct: 359 NHTQSEVQISKDKRTY-SIDSEPKRSQRLRNKSFGNKFQDIKVNPQSFEKIKLLGQGDVG 417

Query: 184 XXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPES 243
              L +++ T  + A             +   ++TE++IL T+   ++V L ++FQ  + 
Sbjct: 418 KVFLVKEKKTNGLYAMKIYNKKDMIKREKIKRVITEQEILATSNHPFIVTLYHSFQTEDY 477

Query: 244 LYLAMEFVPGGDF-RTLLI-NTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFL 301
           LYL ME+  GG+F R L   +++ +    ARFY SE+  A+  LH LG+ +RDLKPEN L
Sbjct: 478 LYLCMEYCMGGEFFRALQTRDSKCICEDDARFYASEVLAALEYLHLLGFIYRDLKPENIL 537

Query: 302 IDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQN 361
           +   GHI L+DF L+     ++    MK  +        P      I D +   +  R  
Sbjct: 538 LHKSGHIMLSDFDLSVHAKDSKNPIFMKDGI-------LPTTNSNLIVDTKICSEGFR-- 588

Query: 362 DINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL 421
                NS VG+ +Y+A EV+ G  +   VD+W+LG ++FE L G TPF G +TNET+ N+
Sbjct: 589 ----TNSFVGTEEYIAPEVIRGNGHTVAVDWWTLGILIFEMLFGKTPFKGDTTNETFANI 644

Query: 422 RHWKRTLRRPFLNDGRSAISDRAWELITRLIA-DPINRLRS---FEHVKRMNYFHEINFD 477
               +    P  ND    I+     LI +L+  +   RL S      +K+ ++F  +N++
Sbjct: 645 --LSKDFEFPNSND----ITRNCKNLIKKLLTKNETKRLGSKMGAAEIKKHSFFKNVNWN 698

Query: 478 TLRQLSPPFTPQLDNE 493
            LR   PP  P+L ++
Sbjct: 699 MLRNEEPPLIPELSSD 714

>Scas_629.16
          Length = 918

 Score =  160 bits (405), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 168/354 (47%), Gaps = 43/354 (12%)

Query: 155 EHEVLRKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXX 202
           E E  R RRL+ K+            + FE I            L R++ T  + A    
Sbjct: 491 EEEPKRSRRLRNKSFSNKFKDITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIF 550

Query: 203 XXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLIN 262
                    +   IL E++IL T+   ++V L ++FQ  + LY  ME+  GG+F   L  
Sbjct: 551 SKSEMIKRKKIKRILAEQEILATSNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQT 610

Query: 263 TRT--LRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTV 320
            RT  +    ARFY SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+    
Sbjct: 611 RRTKCISEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSV-QA 669

Query: 321 SNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEV 380
            + ++  MK               E ++ D +      R       NS VG+ +Y+A EV
Sbjct: 670 KDAKVPVMK------------GSAESTVVDTKICSDGFR------TNSFVGTEEYIAPEV 711

Query: 381 LEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAI 440
           + G  +   VD+W+LG +++E L G+TPF GSS+NET+ N+   K  +  P  ND    I
Sbjct: 712 IRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNI--LKNDVSFPNNND----I 765

Query: 441 SDRAWELITRLIA-DPINRLRS---FEHVKRMNYFHEINFDTLRQLSPPFTPQL 490
           S    +LI +L+  +   RL S      VKR  +F ++ +  LR   PP  P L
Sbjct: 766 SRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWSFLRNQEPPLIPIL 819

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  159 bits (402), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 170/383 (44%), Gaps = 62/383 (16%)

Query: 144 LNEEWNNYLQKEHEVLRKRRLKPKNK------DFEMITXXXXXXXXXXXLARKRDTKEVC 197
            N +W N  Q    +      KP         DFE++T             RK+DT+++ 
Sbjct: 344 FNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDTQKIY 403

Query: 198 AXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFR 257
           A             E  H L ER IL      ++V L + FQ PE LYL +  + GG+  
Sbjct: 404 ALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACINGGELF 463

Query: 258 TLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAA 317
             L          ARFY SE+  A+++LH++   +RDLKPEN L+D++GHI L DFGL  
Sbjct: 464 HHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALCDFGLC- 522

Query: 318 GTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMA 377
                                                   L   D    ++  G+P+Y+A
Sbjct: 523 ---------------------------------------KLNMKDNEKTSTFCGTPEYLA 543

Query: 378 LEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFL-NDG 436
            EVL GK Y   VD+W+LG +L+E L G  P+   + +E Y      K+ L+ P +  DG
Sbjct: 544 PEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYYDENVSEMY------KKILKSPLIFPDG 597

Query: 437 RSAISDRAWELITRLIA-DPINRLRS--FEHVKRMNYFHEINFDTL--RQLSPPFTPQLD 491
              +   A +L+ RL+  DP  RL +   + +K   +F+++ +D++  ++  PPF P + 
Sbjct: 598 ---MDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDLIWDSIWNKEYLPPFRPDVQ 654

Query: 492 NETDAGYFD-DFTNEADMAKYAD 513
           N  D   FD +FT +  +    D
Sbjct: 655 NANDTSNFDNEFTKQKPVDSVID 677

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score =  159 bits (403), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 115/376 (30%), Positives = 178/376 (47%), Gaps = 46/376 (12%)

Query: 157 EVLRKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXX 204
           E  R RRL+ K+            + FE I            L R++ T  V A      
Sbjct: 470 EPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSK 529

Query: 205 XXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-N 262
                  +   +LTE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    
Sbjct: 530 DEMIKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRK 589

Query: 263 TRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSN 322
           T+ +    ARFY SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+      
Sbjct: 590 TKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS------ 643

Query: 323 ERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLE 382
             I++   ++  VK        + ++ D +      R       NS VG+ +Y+A EV+ 
Sbjct: 644 --IQAKDSKVPVVK-----GSAQSTLVDTKICSDGFR------TNSFVGTEEYIAPEVIR 690

Query: 383 GKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISD 442
           G  +   VD+W+LG +++E L G+TPF G +TNET+ N+   K  +  P  N+      D
Sbjct: 691 GNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNI--LKNEVSFPNNNEISRTCKD 748

Query: 443 RAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDF 502
              +L+T+  +  +        VK+  +F ++ +  LR   PP  P L   ++ GY    
Sbjct: 749 LIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEPPLIPVL---SEDGY---- 801

Query: 503 TNEADMAKYADVFKRQ 518
               D AK +   KRQ
Sbjct: 802 ----DFAKLSSNKKRQ 813

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score =  157 bits (396), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/351 (29%), Positives = 163/351 (46%), Gaps = 56/351 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RK+DT+++ A             E  H L ER +L      
Sbjct: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ PE LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                  N++ ND    ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E + G  P+
Sbjct: 491 ------LNMKDND--KTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542

Query: 410 SGSSTNETYENLRHWKRTLRRPFL-NDG-RSAISDRAWELITRLIADPINRL--RSFEHV 465
              +    Y      K+ L++P L  DG   A  D    L++R   DP  RL     + +
Sbjct: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593

Query: 466 KRMNYFHEINFD--TLRQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513
           +   +F +I++    L+   PP+ P + +E D   FD +FT E  +    D
Sbjct: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVD 644

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 159/294 (54%), Gaps = 36/294 (12%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-NTRTLRSPHARF 273
           IL E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    ++ +    A+F
Sbjct: 542 ILAEQEILATSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKF 601

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
           Y SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+        I++   ++ 
Sbjct: 602 YASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS--------IQAKDAKVP 653

Query: 334 EVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYW 393
            VK        + ++ D +      R       NS VG+ +Y+A EV+ G  +   VD+W
Sbjct: 654 VVK-----GNAQSTVVDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWW 702

Query: 394 SLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LI 452
           +LG +++E L G+TPF G +TNET+ N+   K+ +  P  N+    +S    +LI + LI
Sbjct: 703 TLGILIYEMLFGFTPFKGENTNETFSNI--LKKDVTFPNNNE----VSRNCKDLIKKLLI 756

Query: 453 ADPINRLRS---FEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFT 503
            +   RL S      +K+  +F ++N+  LR   PP  P L   T+ GY  DFT
Sbjct: 757 KNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQEPPLIPVL---TENGY--DFT 805

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  157 bits (398), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/328 (30%), Positives = 165/328 (50%), Gaps = 32/328 (9%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-NTRTLRSPHARF 273
           IL E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    T+ +    ARF
Sbjct: 506 ILAEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARF 565

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
           Y SE+  A+  LH +G+ +RDLKPEN L+   GH+ L+DF L+             ++ +
Sbjct: 566 YASEVTAALEYLHLMGFIYRDLKPENILLHQSGHVMLSDFDLS-------------VQAK 612

Query: 334 EVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYW 393
             +N +     + S+ D +      R       NS VG+ +Y+A EV+ G  +  +VD+W
Sbjct: 613 GTRNPQVKGNAQSSLVDTKVCSDGFR------TNSFVGTEEYIAPEVIRGNGHTASVDWW 666

Query: 394 SLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA 453
           +LG + +E L G+TPF G +TN+T+ N+   K  +  P  ND      D   +L+ +  +
Sbjct: 667 TLGILTYEMLFGFTPFKGDNTNQTFSNI--LKNDVYFPNNNDISRTCKDLIKKLLVKKES 724

Query: 454 DPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGY-FDDFTNEADMAKYA 512
             +        +K+  +F  + +  LR   PP  P L   T+ GY F   +++ D+ K  
Sbjct: 725 KRLGSKFGASEIKKHPFFKTVQWALLRNQEPPLIPVL---TEDGYDFAKLSHKKDVKKAE 781

Query: 513 DVFKRQD-----KLAAMVDDSEVDSKLI 535
                 D     K+AA +D  E   +++
Sbjct: 782 KFGPSGDSTHKFKVAASIDSVEEQERIM 809

>Kwal_47.16761
          Length = 744

 Score =  156 bits (394), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 174/381 (45%), Gaps = 64/381 (16%)

Query: 169 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRS 228
           +DFE++              RK+DTK + A             E  H + ER+IL  T S
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 229 E---WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNAL 285
           +   ++V L ++FQ P  LYL  +F+ GG+    L          ARFYI+E+  A+  L
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAEDRARFYIAELVLALEYL 451

Query: 286 HELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTE 345
           HE    +RDLKPEN L+DA G+I L DFGL                            ++
Sbjct: 452 HENDIVYRDLKPENILLDANGNIALCDFGL----------------------------SK 483

Query: 346 KSIEDRRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYTVDYWSLGCMLFEALI 404
             ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG ++FE   
Sbjct: 484 ADLKDR--------------TNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCC 529

Query: 405 GYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELITRLIADPINRLRSFE 463
           G++PF      + Y+ +   K    R  L+ +GRS +      L+ R   +P +RL + +
Sbjct: 530 GWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKG----LLNR---NPRHRLGAID 582

Query: 464 HVKRMN---YFHEINFDTLRQ--LSPPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQ 518
             + +    +F EI+++ LRQ  + PPF P L  ETD   FD      +  + +  F  +
Sbjct: 583 DGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFD-----PEFTQTSTSFMNK 637

Query: 519 DKLAAMVDDSEVDSKLIGFTF 539
             +AA      + +K +GFTF
Sbjct: 638 QGIAATPLSPAMQAKFVGFTF 658

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  155 bits (393), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 165/350 (47%), Gaps = 38/350 (10%)

Query: 157 EVLRKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXX 204
           E  R RRL+ K+            + FE I            L R+RDT ++ A      
Sbjct: 298 EPRRSRRLRTKSFGNKFQDITVEPQSFEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNK 357

Query: 205 XXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-N 262
                  +   +LTE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    
Sbjct: 358 HEMIKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRK 417

Query: 263 TRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSN 322
           ++ +    A+FY SE+  A+  LH LG+ +RDLKPEN L+   GH+ L+DF L+     +
Sbjct: 418 SKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGS 477

Query: 323 ERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLE 382
           ++                P   + +  D +      R       NS VG+ +Y+A EV+ 
Sbjct: 478 KK----------------PTMKDSTYLDTKICSDGFR------TNSFVGTEEYLAPEVIR 515

Query: 383 GKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISD 442
           G  +   VD+W+LG +++E L G TPF G ++NET+ N+    + ++ P   +      D
Sbjct: 516 GNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNI--LTKDVKFPHDKEVSKNCKD 573

Query: 443 RAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDN 492
              +L+ +  A  +        +KR  +F ++ +  LR   PP  P L++
Sbjct: 574 LIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQDPPLIPALND 623

>Kwal_23.6458
          Length = 868

 Score =  155 bits (393), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 113/379 (29%), Positives = 181/379 (47%), Gaps = 48/379 (12%)

Query: 157 EVLRKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXX 204
           E  R RRL+ K+            + FE I            L +++ T  + A      
Sbjct: 438 EPQRSRRLRNKSFSSKFKEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSK 497

Query: 205 XXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-N 262
                  +   IL E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    
Sbjct: 498 EEMIKRKKIKRILAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRK 557

Query: 263 TRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSN 322
           T+ +    ARFY SE+  A+  LH +G+ +RDLKPEN L+   GHI L+DF L+      
Sbjct: 558 TKCIDEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLS------ 611

Query: 323 ERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLE 382
                  ++ ++ KN       + S+ D +      R       NS VG+ +Y+A EV+ 
Sbjct: 612 -------VQAKDTKNPVVKGSAQSSLLDTKICSDGFR------TNSFVGTEEYIAPEVIR 658

Query: 383 GKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISD 442
           G  +   VD+W+LG +++E L G+TP+ G +TN+T+ N+   K  +  P  N+    +S 
Sbjct: 659 GNGHTAAVDWWTLGILIYEMLFGFTPYKGDNTNKTFSNV--LKNEVSFPNNNE----VSR 712

Query: 443 RAWELITR-LIADPINRLRS---FEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGY 498
              +LI + LI     RL S      +K+  +F ++ +  LR   PP  P L   T+ GY
Sbjct: 713 NCKDLIRKLLIKSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQEPPLIPVL---TENGY 769

Query: 499 FDDFTNEADMAKYADVFKR 517
             DFT  ++     ++ K+
Sbjct: 770 --DFTRLSNNVNKGNIRKQ 786

>Scas_689.25*
          Length = 409

 Score =  150 bits (379), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/298 (31%), Positives = 151/298 (50%), Gaps = 51/298 (17%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L+ +   ++V+L   FQD E L++ M++V GG+  +LL  ++   +P A
Sbjct: 140 QVEHTNDERRMLSVSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVA 199

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A++ LH L   +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 200 KFYAAEVCLALDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFAKYV------------ 247

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                                         D+ Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 248 -----------------------------PDVTY--TLCGTPDYIAPEVISAKPYNKSVD 276

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WS G +++E L G+TPF  SST +TYEN+ +      + F  D +  +S     LITR 
Sbjct: 277 WWSFGILIYEMLSGHTPFYDSSTMKTYENILNAPLKFPKYFTPDAQDLLS----RLITRD 332

Query: 452 IADPINRLRS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQL-DNETDAGYFDDFTNE 505
           + + +  L++  E +K   +F E+ +D L  R +  P+ P +   + D   FD +  E
Sbjct: 333 LTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDRYPEE 390

>Scas_651.18
          Length = 371

 Score =  149 bits (375), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 101/350 (28%), Positives = 163/350 (46%), Gaps = 51/350 (14%)

Query: 160 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTE 219
           RK   K    DF+++            L R        A             +  H   E
Sbjct: 48  RKTSGKYTLNDFQILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKHTIVKLKQVEHTNDE 107

Query: 220 RDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMF 279
           R +L+     +LV++   FQD E +++ M+++ GG+  +LL  ++   +P A+FY +E+ 
Sbjct: 108 RLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVC 167

Query: 280 CAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLE 339
            A+  LH +   +RDLKPEN L+D  GHIK+TDFG A                       
Sbjct: 168 LALEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFAKYV-------------------- 207

Query: 340 FPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCML 399
                                 DI Y  ++ G+PDY+A EV+  K Y+ +VD+WS G ++
Sbjct: 208 ---------------------PDITY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILI 244

Query: 400 FEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRL 459
           +E L GYTPF  S+T +TYEN+ + K      F +D +  +S    +LIT+ + + +  L
Sbjct: 245 YEMLAGYTPFYDSNTMKTYENILNCKLKFPNFFHDDVKDLLS----KLITKNLTERLGNL 300

Query: 460 RS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQL-DNETDAGYFDDFTNE 505
           ++  E VKR  +F E+ ++ L  R +  P+ P +   + D   FD +  E
Sbjct: 301 QNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDRYPEE 350

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  155 bits (391), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 165/349 (47%), Gaps = 36/349 (10%)

Query: 154 KEHEVLRKRRLKPKNKD-------FEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXX 206
           K  E LR +    K +D       FE I            L R++ T  + A        
Sbjct: 355 KRSERLRNKSFSNKFQDILVGPQSFEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPE 414

Query: 207 XXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF-RTLLI-NTR 264
                +   ILTE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    T+
Sbjct: 415 MIKRKKIKRILTEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTK 474

Query: 265 TLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNER 324
            +    ARFY SE+  A+  LH +G+ +RDLKPEN L+   GHI L+DF L+        
Sbjct: 475 CISEDDARFYSSEVTAALEYLHLMGFIYRDLKPENILLHQSGHIMLSDFDLS-------- 526

Query: 325 IESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGK 384
                ++ ++ KN +       S+ D +      R       NS VG+ +Y+A EV+ G 
Sbjct: 527 -----VQAKDTKNPQVKGNASHSLVDTKICSDGFR------TNSFVGTEEYIAPEVIRGN 575

Query: 385 KYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRA 444
            +   VD+W+LG +++E L G+TPF G +TN+T+ N+   K  +  P  N+   A  D  
Sbjct: 576 GHTAAVDWWTLGILIYEMLFGFTPFKGDNTNQTFSNI--LKNEVVIPNNNETSRACKDLI 633

Query: 445 WELITRLIADPINRLRS---FEHVKRMNYFHEINFDTLRQLSPPFTPQL 490
            +L   LI +   RL S      +K+  +F    +  LR   PP  P L
Sbjct: 634 RKL---LIKNENKRLGSKLGASDIKKHPFFKNDQWSLLRNQEPPLIPVL 679

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 183/395 (46%), Gaps = 66/395 (16%)

Query: 155 EHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETN 214
           E+   +KR+  P+  DFE++              RK+DT  + A             E  
Sbjct: 311 EYTSTKKRQYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIA 368

Query: 215 HILTERDILTTTRSE---WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           H + ER+IL  T S+   ++V L ++FQ P  LYL  +F+ GG+    L          A
Sbjct: 369 HTIGERNILVRTASKSSPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEDRA 428

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FYI+E+  A+  LH+    +RDLKPEN L+DA G+I L DFGL                
Sbjct: 429 KFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGL---------------- 472

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVL-EGKKYDYTV 390
                       ++  ++DR               N+  G+ +Y+A E+L +   Y   V
Sbjct: 473 ------------SKADLKDR--------------TNTFCGTTEYLAPELLMDETGYTKMV 506

Query: 391 DYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELIT 449
           D+WSLG ++FE   G++PF  S   + Y+ +   K    R  L+ +GRS +      L+ 
Sbjct: 507 DFWSLGVLIFEMCCGWSPFFASDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKG----LLN 562

Query: 450 RLIADPINRLRSFEHVKRMN---YFHEINFDTLRQ--LSPPFTPQLDNETDAGYFDDFTN 504
           R   +P +RL + +  + +    +F++I+++ +RQ  + PPF P L +ETD   FD    
Sbjct: 563 R---NPKHRLGAIDDGRELRAHPFFNDIDWEAVRQKKIPPPFKPHLISETDTSNFD---- 615

Query: 505 EADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTF 539
             +  + +  F  +  +AA      + +K +GFTF
Sbjct: 616 -PEFTQTSTSFMNKQPIAATPLSPAMQAKFVGFTF 649

>Scas_703.5
          Length = 749

 Score =  153 bits (387), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/442 (28%), Positives = 196/442 (44%), Gaps = 71/442 (16%)

Query: 111 DMFDYVISRRQ--RTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVLRKRRLKPKN 168
           DMF   +  R    T Q  S  + Y     + DE +  +    ++ E+   +KR   P  
Sbjct: 286 DMFMGQVRLRPNIHTTQFASQDKWYPLKSRVLDENVTGDI--LIKWEYSSTKKRHYGPN- 342

Query: 169 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTR- 227
            DFE++              +K+DTK + A             E  H + ER+IL TT  
Sbjct: 343 -DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEVAHTIGERNILVTTAT 401

Query: 228 --SEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNAL 285
             S ++V L ++FQ P  LYL  +F+ GG+    L          A+FYI+E+  A+  L
Sbjct: 402 KASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTEERAKFYIAELVLALEYL 461

Query: 286 HELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTE 345
           H+    +RDLKPEN L+DA G+I L DFGL                            ++
Sbjct: 462 HDNDIVYRDLKPENILLDANGNIALCDFGL----------------------------SK 493

Query: 346 KSIEDRRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYTVDYWSLGCMLFEALI 404
             ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG ++FE   
Sbjct: 494 ADLKDR--------------TNTFCGTTEYLAPELLLDEAGYTKMVDFWSLGVLIFEMCC 539

Query: 405 GYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELITRLIADPINRLRSFE 463
           G++PF      + Y+ +   K    R  L+ +GRS +      L+ R   +P +RL + +
Sbjct: 540 GWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKG----LLNR---NPKHRLGAID 592

Query: 464 HVKRMN---YFHEINFDTLRQ--LSPPFTPQLDNETDAGYFD-DFTNEADMAKYADVFKR 517
             + +    +F +I++D LR+  + PPF P L +ETD   FD +FT  +          +
Sbjct: 593 DGRELRAHPFFADIDWDALREKKIPPPFKPHLVSETDTSNFDPEFTQTS-----TSYMNK 647

Query: 518 QDKLAAMVDDSEVDSKLIGFTF 539
              +AA      + +K  GFTF
Sbjct: 648 HQPIAATPLSPAMQAKFAGFTF 669

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  153 bits (386), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 126/443 (28%), Positives = 201/443 (45%), Gaps = 73/443 (16%)

Query: 111 DMFDYVISRRQ--RTKQMISNIQEYKQNHTIPDEQLNEEWNNYLQKEHEVL-RKRRLKPK 167
           DMF   +  R    T   +S+ Q Y     + DE++  E    L K H  L +KR   P+
Sbjct: 282 DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGE---ILVKWHYTLTKKRHYGPQ 338

Query: 168 NKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTR 227
             DFE++              +K+DTK + A             E  H + ER+IL TT 
Sbjct: 339 --DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTS 396

Query: 228 SE---WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNA 284
           S+   ++V L ++FQ P  LYL  +++ GG+    L          A+FYI+E+  A+  
Sbjct: 397 SKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAELVLALEH 456

Query: 285 LHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFT 344
           LH+    +RDLKPEN L+DA G+I L DFGL+                            
Sbjct: 457 LHDNDIVYRDLKPENILLDANGNIALCDFGLS---------------------------- 488

Query: 345 EKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYTVDYWSLGCMLFEAL 403
           +  ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG ++FE  
Sbjct: 489 KADLKDR--------------TNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMC 534

Query: 404 IGYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELITRLIADPINRLRSF 462
            G++PF      + Y+ +   K    R  L+ +GRS +      L+ R   +P +RL + 
Sbjct: 535 CGWSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSFVKG----LLNR---NPKHRLGAI 587

Query: 463 EHVKRMN---YFHEINFDTLRQ--LSPPFTPQLDNETDAGYFD-DFTNEADMAKYADVFK 516
           +  + +    +F +I+++ L+Q  + PPF P L +ETD   FD +FT  +          
Sbjct: 588 DDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS-----TSYMN 642

Query: 517 RQDKLAAMVDDSEVDSKLIGFTF 539
           +  ++AA      + +K  GFTF
Sbjct: 643 KHHQMAATPLSPGMQAKFAGFTF 665

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 165/385 (42%), Gaps = 64/385 (16%)

Query: 145 NEEWNNYLQKEHEVLRKRRLKP-KNK-----DFEMITXXXXXXXXXXXLARKRDTKEVCA 198
           N +W N  +    V      KP KNK     DF+++              +K+DT ++ A
Sbjct: 357 NHQWLNMEKGLGRVNITIDYKPSKNKPLSIDDFDLLKVIGKGSFGKVMQVKKKDTNKIYA 416

Query: 199 XXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRT 258
                        E  H L ER +L    + ++V L ++FQ PE LYL + F+ GG+   
Sbjct: 417 LKAIRKSYIVSKSEVTHTLAERTVLARVDNPFIVPLKFSFQSPEKLYLVLAFINGGELFF 476

Query: 259 LLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAG 318
            L          ARFY +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL   
Sbjct: 477 HLQKEGRFDLSRARFYTAELLCALETLHSLNVIYRDLKPENILLDYQGHIALCDFGLC-- 534

Query: 319 TVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMAL 378
                                                  L   D +  N+  G+P+Y+A 
Sbjct: 535 --------------------------------------KLNMKDQDKTNTFCGTPEYLAP 556

Query: 379 EVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF-LNDGR 437
           E+L G+ Y   VD+W+LG +L+E L G  P+      + Y      K+ L+ P    DG 
Sbjct: 557 ELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDEDVPKMY------KKILQEPLRFPDG- 609

Query: 438 SAISDRAWE--LITRLIADPINRL--RSFEHVKRMNYFHEINFDTL--RQLSPPFTPQLD 491
               DR  +  LI  L  DP  RL     + +KR  +F ++++  L  +   PP+ P + 
Sbjct: 610 ---FDREAKNLLIELLCRDPKRRLGYNGADEIKRHPFFSQLSWKRLWMKGYIPPYKPPVM 666

Query: 492 NETDAGYFD-DFTNEADMAKYADVF 515
           +  D   FD +FT E  +    + F
Sbjct: 667 SALDTSNFDQEFTREKPVDSVVNDF 691

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  150 bits (379), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 120/448 (26%), Positives = 204/448 (45%), Gaps = 68/448 (15%)

Query: 106 LDYYCDMFDYVISRRQRTKQMISNIQEYKQN--HTIPDEQLNEEWNN--YLQKEHEVLRK 161
           +  Y    D++   + R   MI N+    Q+  H++    ++E  +    ++  ++  +K
Sbjct: 345 ISVYDAAHDHMFLGQVRLYPMIHNLAHASQHQWHSLKPRVIDEVVSGDILIKWTYKQTKK 404

Query: 162 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERD 221
           R   P+  DFE++              +K+DT+ + A             E  H + ER+
Sbjct: 405 RHYGPQ--DFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERN 462

Query: 222 ILTTTRSE---WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           IL TT S+   ++V L ++FQ P  LYL  +++ GG+    L          A+FYI+E+
Sbjct: 463 ILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAEL 522

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
             A+  LH+    +RDLKPEN L+DA G+I L DFGL                       
Sbjct: 523 VLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGL----------------------- 559

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYTVDYWSLGC 397
                ++  ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG 
Sbjct: 560 -----SKADLKDR--------------TNTFCGTTEYLAPELLLDETGYTKMVDFWSLGV 600

Query: 398 MLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELITRLIADPI 456
           ++FE   G++PF   +  + Y+ +   K    R  L+ +GRS +      L+ R   +P 
Sbjct: 601 LIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKG----LLNR---NPK 653

Query: 457 NRLRSFEHVKRMN---YFHEINFDTLRQ--LSPPFTPQLDNETDAGYFDDFTNEADMAKY 511
           +RL + +  + +    +F +I+++ L+Q  + PPF P L +ETD   FD    E   A  
Sbjct: 654 HRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDP---EFTTAST 710

Query: 512 ADVFKRQDKLAAMVDDSEVDSKLIGFTF 539
           + + K Q  + A      + +K  GFTF
Sbjct: 711 SYMNKHQPMMTATPLSPAMQAKFAGFTF 738

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  146 bits (368), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/340 (27%), Positives = 159/340 (46%), Gaps = 51/340 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++            L R        A             +  H   ER++L+     
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           +++++   FQD + L++ M+++ GG+  +LL  ++   +P A+FY +E+  A+  LH  G
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D  GHIKLTDFG A                                 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFAKYV------------------------------ 293

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                       D+ Y  ++ G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF
Sbjct: 294 -----------PDVTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 340

Query: 410 SGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRS-FEHVKRM 468
             S+T +TYEN+ +        F +D +  IS    +LITR ++  +  L++  E VK  
Sbjct: 341 YDSNTIKTYENILNAPVRFPPFFHSDAQDLIS----KLITRDLSQRLGNLQNGSEDVKNH 396

Query: 469 NYFHEINFDTL--RQLSPPFTPQLD-NETDAGYFDDFTNE 505
            +F E+ ++ L  + +  P+ P +   + D   +D +  E
Sbjct: 397 PWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDRYPEE 436

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  149 bits (375), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 112/389 (28%), Positives = 175/389 (44%), Gaps = 66/389 (16%)

Query: 161 KRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTER 220
           KR   P+  DFE++              RK+DTK + A             E  H + ER
Sbjct: 296 KRHYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGER 353

Query: 221 DILTTTRSE---WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISE 277
           +IL  T S+   ++V L ++FQ P  LYL  +F+ GG+    L          A+FYI+E
Sbjct: 354 NILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEERAKFYIAE 413

Query: 278 MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKN 337
           +  A+  LH+    +RDLKPEN L+DA G+I L DFGL+                     
Sbjct: 414 LVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGLS--------------------- 452

Query: 338 LEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYTVDYWSLG 396
                  +  ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG
Sbjct: 453 -------KADLKDR--------------TNTFCGTTEYLAPELLLDETGYTKMVDFWSLG 491

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN-DGRSAISDRAWELITRLIADP 455
            ++FE   G++PF      + Y+ +   K    R  L+ +GRS +      L+ R   +P
Sbjct: 492 VLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKG----LLNR---NP 544

Query: 456 INRLRSFE---HVKRMNYFHEINFDTLR--QLSPPFTPQLDNETDAGYFDDFTNEADMAK 510
            +RL +      V+   +  +I+++ LR  Q+ PPF P L +ETD   FD      +  +
Sbjct: 545 KHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFD-----PEFTQ 599

Query: 511 YADVFKRQDKLAAMVDDSEVDSKLIGFTF 539
            +  F  +  +AA      + +K  GFTF
Sbjct: 600 TSTSFMNKQPIAATPLSPAMQAKFAGFTF 628

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score =  148 bits (373), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 100/350 (28%), Positives = 151/350 (43%), Gaps = 54/350 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RK+DT++V A             E  H L ER +L      
Sbjct: 346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCP 405

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ PE LY  + F+ GG+    L          ARFY +E+ CA++ LH+L 
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLD 465

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 466 VVYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 492

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                   L   D +  ++  G+P+Y+A E+L G  Y   VD+W+LG +L+E L G  P+
Sbjct: 493 -------KLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPY 545

Query: 410 SGSSTNETYENLRHWKRTLRRPFL-NDGRSAISDRAWELITRLIADPINRL--RSFEHVK 466
                 + Y      K+ L+ P +  DG     D    LI  L  DP  RL     + ++
Sbjct: 546 YDEDVPKMY------KKILQEPLVFPDGFD--RDAKDLLIGLLSRDPTRRLGYNGADEIR 597

Query: 467 RMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513
              +F ++++  L  +   PP+ P + N  D   FD +FT E  +    D
Sbjct: 598 NHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVD 647

>Kwal_33.13846
          Length = 375

 Score =  143 bits (360), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 149/298 (50%), Gaps = 51/298 (17%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L+     +++++   FQD E +++ M+++ GG+  +LL  ++   +P A
Sbjct: 106 QVEHTNDERRMLSVVSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVA 165

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A+  LH     +RDLKPEN L+D  GH+K+TDFG A               
Sbjct: 166 KFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGHVKITDFGFAKFV------------ 213

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                                         D+ Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 214 -----------------------------PDVTY--TLCGTPDYIAPEVVSTKPYNKSVD 242

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WS G ++FE L GYTPF  S+T +TYEN+ + +     PF +   S + D   +LITR 
Sbjct: 243 WWSFGILIFEMLAGYTPFYDSNTMKTYENILNAELQF-PPFFH---SDVQDLLSQLITRD 298

Query: 452 IADPINRLR-SFEHVKRMNYFHEINFDTL--RQLSPPFTPQLD-NETDAGYFDDFTNE 505
           ++  +  L+   E VK   +F E+ ++ L  R +  P+ P +   + D   +D +  E
Sbjct: 299 LSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDRYPEE 356

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  143 bits (361), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/358 (27%), Positives = 163/358 (45%), Gaps = 57/358 (15%)

Query: 169 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRS 228
           K+F+++            L R R      A             +  H   ER +L+    
Sbjct: 85  KNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTH 144

Query: 229 EWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHEL 288
            +++++   FQD + +++ M+++ GG+  +LL  ++   +P A+FY +E+  A+  LH  
Sbjct: 145 PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSK 204

Query: 289 GYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSI 348
              +RDLKPEN L+D  GHIK+TDFG A                                
Sbjct: 205 DIIYRDLKPENILLDKNGHIKITDFGFAKYV----------------------------- 235

Query: 349 EDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTP 408
                        D+ Y  ++ G+PDY+A EV+  K Y+ ++D+WS G +++E L GYTP
Sbjct: 236 ------------PDVTY--TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTP 281

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLR-SFEHVKR 467
           F  S+T +TYE + + +     PF N+    + D    LITR ++  +  L+   E VK 
Sbjct: 282 FYDSNTMKTYEKILNAELRF-PPFFNED---VKDLLSRLITRDLSQRLGNLQNGTEDVKN 337

Query: 468 MNYFHEINFDTL--RQLSPPFTPQL-DNETDAGYFDDFTNE------ADMAKYADVFK 516
             +F E+ ++ L  R +  P+ P +   + D   FD +  E           YAD+F+
Sbjct: 338 HPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFR 395

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score =  141 bits (355), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 150/298 (50%), Gaps = 51/298 (17%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L+     +++++   FQD + +++ M+++ GG+  +LL  ++   +P A
Sbjct: 129 QVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVA 188

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 189 KFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV------------ 236

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                                         D+ Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 237 -----------------------------PDVTY--TLCGTPDYIAPEVVSTKPYNKSVD 265

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WS G +++E L GYTPF  S+T +TYEN+ + +      F  D +  +     +LITR 
Sbjct: 266 WWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLK----KLITRD 321

Query: 452 IADPINRLRS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQL-DNETDAGYFDDFTNE 505
           +++ +  L++  E VK   +F+E+ ++ L  R +  P+ P +   + D   FD +  E
Sbjct: 322 LSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  139 bits (351), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/373 (26%), Positives = 166/373 (44%), Gaps = 61/373 (16%)

Query: 144 LNEEWNNYLQKEHEVLRKRRLKPKNK-------DFEMITXXXXXXXXXXXLARKRDTKEV 196
           +  EW    Q+    LR R+L+ +         DF+++            L R       
Sbjct: 45  MRAEWA---QESGRQLRGRKLEGRTTKGKYTLYDFQILRTLGTGSFGRVHLVRSNHNGRF 101

Query: 197 CAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDF 256
            A             +  H   ER +L+     +++++   FQD   +++ M+++ GG+ 
Sbjct: 102 YAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHPFIIRMWGTFQDAHQVFMIMDYIEGGEL 161

Query: 257 RTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLA 316
            +LL  ++   +P A+FY +E+  A+  LH     +RDLKPEN L+D  GHIKLTDFG A
Sbjct: 162 FSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFA 221

Query: 317 AGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYM 376
                                                        D+ Y  ++ G+PDY+
Sbjct: 222 KYV-----------------------------------------PDVTY--TLCGTPDYI 238

Query: 377 ALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDG 436
           A EV+  K Y+ +VD+WS G +++E L GYTPF   +T  TYEN+ + +     PF N  
Sbjct: 239 APEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYDQNTMGTYENILNAEVKF-PPFFN-- 295

Query: 437 RSAISDRAWELITRLIADPINRLR-SFEHVKRMNYFHEINFDTL--RQLSPPFTPQLD-N 492
            + + D   +LITR ++  +  L+   + VK   +F E+ +D L  R +  P+ P +   
Sbjct: 296 -AKVRDLLSQLITRDLSKRLGNLQNGSQDVKAHPWFSEVIWDKLLCRNIETPYEPPIHAG 354

Query: 493 ETDAGYFDDFTNE 505
           + D   +D +  E
Sbjct: 355 QGDTSQYDRYPEE 367

>Scas_721.124
          Length = 684

 Score =  143 bits (360), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 150/352 (42%), Gaps = 54/352 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RK+DT+++ A             E  H L ER +L      
Sbjct: 350 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCP 409

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ P+ LYL +  + GG+    L          +RFY +E+ CA+  LH L 
Sbjct: 410 FIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRFDLSRSRFYAAELLCALETLHNLN 469

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 470 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 496

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                   L   D +  ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 497 -------KLNMKDDDKTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 549

Query: 410 SGSSTNETYENLRHWKRTLRRPF-LNDGRSAISDRAWELITRLIADPINRL--RSFEHVK 466
                 + Y      K+ L+ P    DG     D    LI  L  DP  RL     + +K
Sbjct: 550 YDEDVPKMY------KKILQDPLRFPDGFD--RDAKDLLIGLLSRDPTRRLGCNGADEIK 601

Query: 467 RMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYADVF 515
              +F ++++  L  +   PP+ P + +  D   FD +FT E  +    D F
Sbjct: 602 NHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPVDSVVDEF 653

>Kwal_26.7635
          Length = 691

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 104/373 (27%), Positives = 155/373 (41%), Gaps = 60/373 (16%)

Query: 145 NEEWNNYLQKEHEVLRKRRLKPKNK------DFEMITXXXXXXXXXXXLARKRDTKEVCA 198
           N +W    Q   ++      KP         DFE++              RK+DT +V A
Sbjct: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385

Query: 199 XXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRT 258
                        E  H L ER +L    + ++V L + FQ P+ LY+ + F+ GG+   
Sbjct: 386 LKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445

Query: 259 LLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAG 318
            L          AR Y +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL   
Sbjct: 446 HLQREGRFSLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLCK- 504

Query: 319 TVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMAL 378
                                                 N++  D    N+  G+P+Y+A 
Sbjct: 505 -------------------------------------LNMKGQD--KTNTFCGTPEYLAP 525

Query: 379 EVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF-LNDGR 437
           E+L G+ Y   VD+W+LG +L+E + G  P+      + Y      K+ L+ P    DG 
Sbjct: 526 ELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDGF 579

Query: 438 SAISDRAWELITRLIADPINRL--RSFEHVKRMNYFHEINFDTL--RQLSPPFTPQLDNE 493
               D    LI  L  DP  RL     + +K   +F ++++  L  +   PP+ P + N 
Sbjct: 580 D--KDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVMNS 637

Query: 494 TDAGYFD-DFTNE 505
            D   FD +FT E
Sbjct: 638 LDTSNFDQEFTKE 650

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  142 bits (359), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 98/350 (28%), Positives = 153/350 (43%), Gaps = 54/350 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RK+DTK++ A             E  H L ER +L      
Sbjct: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ  E LYL +  + GG+    L          +RFY +E+ CA++ LH++ 
Sbjct: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMD 488

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 489 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 515

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                   L   D +  ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 516 -------KLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 568

Query: 410 SGSSTNETYENLRHWKRTLRRPFL-NDGRSAISDRAWELITRLIADPINRL--RSFEHVK 466
              +  + Y      K+ L+ P +  DG     D    LI  L  DP  RL     + +K
Sbjct: 569 YDENVPKMY------KKILQDPLVFPDGFD--RDAKDLLIGLLSRDPQRRLGYNGADEIK 620

Query: 467 RMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513
              +F ++++  L  +   PP+ P + + TD   FD +FT E  +    D
Sbjct: 621 NHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVD 670

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/353 (27%), Positives = 150/353 (42%), Gaps = 56/353 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RKRDT ++ A             E  H L ER +L    + 
Sbjct: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ  E LYL + F+ GG+    L          +RFY +E+ CA+ ALH+  
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRFDLSRSRFYTAELLCALEALHDFD 500

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 501 IIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 527

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                   L   D     +  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 528 -------KLNMKDQEKTTTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPPY 580

Query: 410 SGSSTNETYENLRHWKRTLRRP--FLNDGRSAISDRAWELITRLIADPINRL--RSFEHV 465
                 + Y+ +   +  LR P  F  D +         LI  L  DP  RL     + +
Sbjct: 581 YDEDVPKMYKKI--LQDPLRFPDDFDKDAKDL-------LIGLLCRDPKRRLGYHGSDEI 631

Query: 466 KRMNYFHEINFDTLRQLS--PPFTPQLDNETDAGYFD-DFTNEADMAKYADVF 515
           K   +F+++++  L+     PP+ P +    D   FD +FT E  +    + F
Sbjct: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFDQEFTREQPVDSVVNDF 684

>Scas_717.69
          Length = 674

 Score =  141 bits (356), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/351 (27%), Positives = 147/351 (41%), Gaps = 56/351 (15%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DF+++              RKRDT+++ A             E  H L ER +L      
Sbjct: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++V L ++FQ PE LYL +  + GG+    L          ARFY +E+ CA+  LH L 
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRFELSRARFYTAELLCALETLHNLD 463

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 464 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 490

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                   L   D +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P+
Sbjct: 491 -------KLNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPPY 543

Query: 410 SGSSTNETYENLRHWKRTLRRP--FLNDGRSAISDRAWELITRLIADPINRL--RSFEHV 465
                 + Y  +   +  LR P  F  D +         LI  L  DP  RL       +
Sbjct: 544 YDEDVPKMYRKI--LQDPLRFPEGFDRDAKDL-------LIGLLSRDPDRRLGCNGAHEI 594

Query: 466 KRMNYFHEINFDTL--RQLSPPFTPQLDNETDAGYFD-DFTNEADMAKYAD 513
           K   +F ++++  L  +   PP+ P + +  D   FD +FT E  +    D
Sbjct: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPIDSVVD 645

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  136 bits (342), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/297 (29%), Positives = 145/297 (48%), Gaps = 49/297 (16%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  TLL  ++   +P A
Sbjct: 92  QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVA 151

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 152 KFYAAEVTLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 196

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
            +EV+ + +                           ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 197 -KEVETVTW---------------------------TLCGTPDYIAPEVIATKPYNKSVD 228

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WSLG +++E L GYTPF  ++  +TYE + H K    + F +D    +S      +TR 
Sbjct: 229 WWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDLLSKLLTADLTRR 288

Query: 452 IADPINRLRSFEHVKRMNYFHEINFDTL--RQLSPPFTPQLDNET-DAGYFDDFTNE 505
           I    N  +  + +K   +F E+ ++ L  + +  P+ P +     D   FD +  E
Sbjct: 289 IG---NLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYPEE 342

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  138 bits (347), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/315 (28%), Positives = 154/315 (48%), Gaps = 57/315 (18%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L+     +++++   FQD + +++ M+++ GG+  +LL  ++   +P A
Sbjct: 193 QVEHTNDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVA 252

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 253 KFYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYVP----------- 301

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                                         D+ Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 302 ------------------------------DVTY--TLCGTPDYIAPEVVSTKPYNKSVD 329

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WS G +++E L GYTPF  ++T +TYE++ + +      F  D    + D   +LITR 
Sbjct: 330 WWSFGILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPD----VQDLLSKLITRD 385

Query: 452 IADPINRLRS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQL-DNETDAGYFDDFTNE-- 505
           ++  +  L++  E VK   +F E+ ++ L  R +  P+ P +   + D   FD +  E  
Sbjct: 386 LSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEI 445

Query: 506 ----ADMAKYADVFK 516
                    YAD+F+
Sbjct: 446 NYGVQGEDPYADLFR 460

>Kwal_56.24059
          Length = 353

 Score =  134 bits (338), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 97/361 (26%), Positives = 162/361 (44%), Gaps = 55/361 (15%)

Query: 153 QKEHEVLRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXX 208
           +++  +L +R    K K    DF+++            L R        A          
Sbjct: 21  ERQRSMLPQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVI 80

Query: 209 XXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRS 268
              +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++   +
Sbjct: 81  RMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPN 140

Query: 269 PHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESM 328
           P A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A            
Sbjct: 141 PVAKFYAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA------------ 188

Query: 329 KIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDY 388
               +EV  + +                           ++ G+PDY+A EV+  K Y+ 
Sbjct: 189 ----KEVDTVTW---------------------------TLCGTPDYIAPEVIATKPYNK 217

Query: 389 TVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELI 448
           +VD+WSLG ++FE L GYTPF  ++  +TYE +   K     PF +     + D   +LI
Sbjct: 218 SVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGK-VAYPPFFH---PDVVDLLCKLI 273

Query: 449 TRLIADPINRLRSF-EHVKRMNYFHEINFDTL--RQLSPPFTPQLDNET-DAGYFDDFTN 504
           T  +   +  L+S  + VK   +F E+ ++ L  + +  P+ P +     D   FD +  
Sbjct: 274 TSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQYPE 333

Query: 505 E 505
           E
Sbjct: 334 E 334

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  132 bits (331), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 146/302 (48%), Gaps = 59/302 (19%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++   +P A
Sbjct: 77  QIEHTNDERRMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVA 136

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 137 KFYAAEVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 181

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
            +EV  + +                           ++ G+PDY+A EV+  K Y+ ++D
Sbjct: 182 -KEVDTVTW---------------------------TLCGTPDYIAPEVITTKPYNKSID 213

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WSLG ++FE L GYTPF   +  +TYE +   K      F  D        A +L+ +L
Sbjct: 214 WWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPD--------AIDLLGKL 265

Query: 452 IADPINR----LRS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQLDNET-DAGYFDDFT 503
           I D + R    L+S  + +K   +F E+ ++ L  + +  P+ P +     D+  FD + 
Sbjct: 266 ITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYP 325

Query: 504 NE 505
            E
Sbjct: 326 EE 327

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  132 bits (331), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 167/375 (44%), Gaps = 57/375 (15%)

Query: 141 DEQLNEEWNNYL--QKEHEVLRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTK 194
           D  +  +  +YL  Q++  +L +R    K K    DF+++            L R     
Sbjct: 26  DVTVGSQSTDYLLAQQKESLLPQRSTVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNG 85

Query: 195 EVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGG 254
              A             +  H   ER +L      +L+++   FQD  +L++ M+++ GG
Sbjct: 86  RYYAIKVLKKHQIIRMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGG 145

Query: 255 DFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG 314
           +  +LL  ++   +P A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG
Sbjct: 146 ELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFG 205

Query: 315 LAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPD 374
            A                +EV                           I    ++ G+PD
Sbjct: 206 FA----------------KEV---------------------------ITVTWTLCGTPD 222

Query: 375 YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
           Y+A EV+  K Y+ +VD+WSLG ++FE L GYTPF   +  +TYE +      +  PF +
Sbjct: 223 YIAPEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYEKILA-GEVVYPPFFH 281

Query: 435 DGRSAISDRAWELITRLIADPINRLRSF-EHVKRMNYFHEINFDTL--RQLSPPFTPQLD 491
                + D   +LIT  +   +  L+S  + +K   +F E+ ++ L  + +  P+ P + 
Sbjct: 282 ---PDVVDLLGKLITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPIA 338

Query: 492 -NETDAGYFDDFTNE 505
               D+  FD +  E
Sbjct: 339 VGVGDSSLFDQYPEE 353

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  134 bits (338), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 122/243 (50%), Gaps = 33/243 (13%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L    TL      FY +
Sbjct: 218 FAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYAA 277

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  + SN   E +    E   
Sbjct: 278 EISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNE--- 334

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLG 396
                                    D+N  +S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 335 -----------------------GEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLG 371

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRP-FLNDGRSAISDRAWELITRLIADP 455
           C+L++ L G  P++G++       +++ K+  + P +L+DG   +      L   L +DP
Sbjct: 372 CLLYDMLTGKPPYTGANHKVIANKIKNDKQGPKIPYYLSDGMKDV------LGALLKSDP 425

Query: 456 INR 458
             R
Sbjct: 426 KKR 428

>Scas_690.13
          Length = 354

 Score =  130 bits (327), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 142/298 (47%), Gaps = 51/298 (17%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++   +P A
Sbjct: 85  QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 144

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           +FY +E+   +  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 145 KFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 189

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
            +EV  + +                           ++ G PDY+A EV+  K Y+ +VD
Sbjct: 190 -KEVDTVTW---------------------------TLCGPPDYIAPEVIATKPYNKSVD 221

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           +WSLG ++FE L GYTPF  ++  +TYE +   K      F  D    + D   +LIT  
Sbjct: 222 WWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGKVVYPTFFHPD----VVDLLGKLITAD 277

Query: 452 IADPINRLRS-FEHVKRMNYFHEINFDTL--RQLSPPFTPQLDNET-DAGYFDDFTNE 505
           +   I  L+S  + +K   +F E+ ++ L  + +  P+ P +     D   FD +  E
Sbjct: 278 LTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQYPEE 335

>Kwal_56.22788
          Length = 515

 Score =  132 bits (331), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 105/196 (53%), Gaps = 25/196 (12%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             ER IL+      +VKL Y+F D   LYL ++F+PGG+    L    TL      FY +
Sbjct: 185 FAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVAFYAA 244

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH+ G  +RDLKPEN L+D  GH+ LTDFGL+  + S++             
Sbjct: 245 EISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDS------------ 292

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQND-INYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                        D   +  N  + + +   +S++G+P+Y A E+LEGK Y    D++SL
Sbjct: 293 ------------ADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSL 340

Query: 396 GCMLFEALIGYTPFSG 411
           GC++F+ LIG  P++G
Sbjct: 341 GCLIFDMLIGKPPYTG 356

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  132 bits (331), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 115/221 (52%), Gaps = 31/221 (14%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L    TL      FY +
Sbjct: 229 FAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFYAA 288

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  +V ++             
Sbjct: 289 ELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDD------------- 335

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLG 396
                A T +  E+  ++Y            S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 336 -----AATPEEGENVNQLY------------SIIGTPEYCAPEILAGEPYTQNCDWYSLG 378

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRP-FLNDG 436
           C++++ LIG  PF+G +       ++  K   R P +L+DG
Sbjct: 379 CLVYDMLIGKPPFTGVNHKIILNKIKQEKTGARIPSYLSDG 419

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  131 bits (330), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 117/225 (52%), Gaps = 31/225 (13%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L    TL      FY +
Sbjct: 200 FAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETTVSFYAA 259

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  + ++  ++          
Sbjct: 260 EISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVD---------- 309

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLG 396
                   E+  E+   +Y            S++G+P+Y A E+L GK Y    D++SLG
Sbjct: 310 --------EEDPENVNALY------------SIIGTPEYCAPEILLGKAYSQNCDWYSLG 349

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPF-LNDGRSAI 440
           C+L++ L+G  P++GS+       ++  K+  + PF L++G   I
Sbjct: 350 CLLYDMLVGKPPYTGSNHKVIINKIQQNKQGPKIPFYLSEGMKDI 394

>Scas_593.14d
          Length = 495

 Score =  129 bits (323), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 128/249 (51%), Gaps = 32/249 (12%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             E+ IL       +VKL Y+F D   LYL ++++PGG+    L    TL      FY +
Sbjct: 196 FAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVAFYAA 255

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH+ G  +RDLKPEN L++ +GH+ LTDFGL+  +V+            EV 
Sbjct: 256 EISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANP-----SEVT 310

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLG 396
           +L  P+                   D++  +S++G+P+Y A E+L+G  Y+   D++SLG
Sbjct: 311 SLNEPS------------------EDLSTLHSIIGTPEYCAPEILQGLPYNKNCDWYSLG 352

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRP-FLNDGRSAI--------SDRAWEL 447
           C++++ L G  P++G++       ++  K+  + P +L++G   +          + W++
Sbjct: 353 CLIYDMLSGKPPYTGANHKVILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRWDV 412

Query: 448 ITRLIADPI 456
                A+PI
Sbjct: 413 DKYWAAEPI 421

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  126 bits (316), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 144/320 (45%), Gaps = 36/320 (11%)

Query: 159 LRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILT 218
           L K  +K   KDF+              LA  RD+ +  A             +  ++  
Sbjct: 113 LTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTV 172

Query: 219 ERDILTTTR-SEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISE 277
           E+  L     ++ + KL + FQD  SLY  +E+ P GDF  L+    +L    AR+Y S+
Sbjct: 173 EKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQ 232

Query: 278 MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKN 337
           +  AV++LH +G  HRD+KPEN L+D    +KLTDFG A            KI  EE  N
Sbjct: 233 IIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTA------------KILPEEPSN 280

Query: 338 LEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGC 397
                          K Y +L       + S VG+ +Y++ E+L     D   D W+ GC
Sbjct: 281 TA-----------DGKPYFDLYAK----SKSFVGTAEYVSPELLNDNYTDSRCDIWAFGC 325

Query: 398 MLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPIN 457
           +L++ L G  PF  ++   T++ +   +      F       + D   +L+ R   DP +
Sbjct: 326 ILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGF----PQIVKDLVKKLLVR---DPND 378

Query: 458 RLRSFEHVKRMNYFHEINFD 477
           RL + + +K   +FHE+NF+
Sbjct: 379 RL-TIKQIKAHLFFHEVNFE 397

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  126 bits (316), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 96/381 (25%), Positives = 162/381 (42%), Gaps = 72/381 (18%)

Query: 141  DEQLNEEWNNYLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXX 200
            D+Q  ++       +H+    +R K    +F ++            L++ ++T  +CA  
Sbjct: 794  DQQSPQKSQTSTSAKHKKRAAKRRKVSLDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIK 853

Query: 201  XXXXXXXXXXXETNHILTERDIL---TTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFR 257
                       +      E+ +    T T+  +L  L  +FQ    +Y AMEF+ GGD  
Sbjct: 854  VLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLM 913

Query: 258  TLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAA 317
              + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+  EGHIK+ D+GL  
Sbjct: 914  WHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLC- 971

Query: 318  GTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN---SMVGSPD 374
                                                      ++++ Y N   +  G+P+
Sbjct: 972  ------------------------------------------KDEMWYGNRTSTFCGTPE 989

Query: 375  YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
            +MA E+L+ ++Y   VD+W+ G +L++ L+  +PFSG   +E +  +           L 
Sbjct: 990  FMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-----------LT 1038

Query: 435  DGRSAISDRAWELIT----RLIADPINRL----RSFEHVKRMNYFHEINFDTLRQL--SP 484
            D      D A E++      L  DP  RL    R  + V    +F  INFD +  L   P
Sbjct: 1039 DEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKP 1098

Query: 485  PFTPQLDNETDAGYFD-DFTN 504
            P+ P++ +  D  YF+ +FT+
Sbjct: 1099 PYIPEIKSPEDTSYFEQEFTS 1119

>Scas_715.34
          Length = 1150

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/332 (26%), Positives = 147/332 (44%), Gaps = 66/332 (19%)

Query: 187  LARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDIL---TTTRSEWLVKLLYAFQDPES 243
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 839  LSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 898

Query: 244  LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+ 
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 957

Query: 304  AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             +GHIK+ D+GL                                   + +++ N      
Sbjct: 958  PQGHIKIADYGLC----------------------------------KDEMWYN------ 977

Query: 364  NYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH 423
            N  ++  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 978  NKTSTFCGTPEFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-- 1035

Query: 424  WKRTLRRPFLNDGRSAISDRAWELIT----RLIADPINRL----RSFEHVKRMNYFHEIN 475
                     L D      D A +++      L  DP NRL    R    V    +F  IN
Sbjct: 1036 ---------LTDEPLYPIDMAGDIVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNIN 1086

Query: 476  FDTLRQL--SPPFTPQLDNETDAGYFD-DFTN 504
            F+ +  L   PP+ P++ +  D  YF+ +FT+
Sbjct: 1087 FEDILNLRVQPPYVPEIKSPEDTSYFEHEFTS 1118

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/332 (27%), Positives = 144/332 (43%), Gaps = 66/332 (19%)

Query: 187  LARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDIL---TTTRSEWLVKLLYAFQDPES 243
            LAR ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 850  LARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENR 909

Query: 244  LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            +Y AMEF+ GGD    + N R L    A+FY +E+  ++   H+ G  +RDLK EN L+ 
Sbjct: 910  IYFAMEFIGGGDLMWHVQNRR-LSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLT 968

Query: 304  AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             EGHIK+ D+GL                     N+ +                       
Sbjct: 969  PEGHIKIADYGLCK------------------DNMWYG---------------------- 988

Query: 364  NYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH 423
            N  ++  G+P++MA E+L+G+ Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 989  NKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAI-- 1046

Query: 424  WKRTLRRPFLNDGRSAISDRAWELIT----RLIADPINRL----RSFEHVKRMNYFHEIN 475
                     L D      D A +++      L  DP  RL    +    +    +F  IN
Sbjct: 1047 ---------LTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPKDALEIMAEPFFSNIN 1097

Query: 476  FDTLRQL--SPPFTPQLDNETDAGYFD-DFTN 504
            FD +  L   PPF P++    D  YF+ +FT+
Sbjct: 1098 FDDILNLRVEPPFVPEIKAADDTSYFEKEFTS 1129

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  124 bits (310), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 128/261 (49%), Gaps = 30/261 (11%)

Query: 221 DILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFC 280
           ++L       ++KL Y F D E+LY  ++F PGG+  +LL    T      R + +++  
Sbjct: 65  NLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLID 124

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
           A+  +H  G  HRDLKPEN L+D +G + +TDFG AA    +   +S K   +       
Sbjct: 125 ALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDS------ 178

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLF 400
                           N  +++ N A S VG+ +Y++ E+L   +  Y  D W+LGCM++
Sbjct: 179 ----------------NGSKDNQNCA-SFVGTAEYVSPELLLYNQCGYGSDIWALGCMIY 221

Query: 401 EALIGYTPFSGSSTNETYENLRH----WKRTLRRPFLNDGRSAISDRAWELITRLIADPI 456
           + + G  PF G +  +T+E +      W    R   +N+  S I+     L+ +++   +
Sbjct: 222 QFVQGQPPFRGENELKTFEKIVALDYPWGPNNR---INNSTSPINPLVINLVQKILVIEV 278

Query: 457 NRLRSFEHVKRMNYFHEINFD 477
           N   S E +KR  YF +++++
Sbjct: 279 NERISLEQIKRHPYFSKVDWN 299

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  122 bits (305), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 117/248 (47%), Gaps = 44/248 (17%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++KL Y F D E+LY  M+  PGG+   LL   R      AR Y+ ++   V  +H +G 
Sbjct: 73  IIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+D EG + + DFG AA TV      S                       
Sbjct: 133 IHRDLKPENVLLDKEGRLMIADFG-AAYTVGQSDAGS----------------------- 168

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFS 410
                     +    A S VG+ +Y++ E+L   K  Y+ D W+LGCML++ L G  PF 
Sbjct: 169 ----------DGDKPATSFVGTAEYVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFR 218

Query: 411 GSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFEHVKRMN 469
           G +  ET+E + +   T R P         +  A  L+++ L+ DP  R  + E +K+  
Sbjct: 219 GQNEMETFEQIVNLDYTWRIP--------ANPLAAGLVSKILVLDPSQRY-TLEQIKKHK 269

Query: 470 YFHEINFD 477
           +F  ++++
Sbjct: 270 WFSGVDWN 277

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  120 bits (301), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 108/220 (49%), Gaps = 31/220 (14%)

Query: 217 LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L    TL      FY +
Sbjct: 212 FAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAA 271

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           E+ CA+  LH  G  +RDLKPEN L+D +GH+ LTDFGL+   V+         ++EE+ 
Sbjct: 272 EISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEELY 331

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLG 396
                                          S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 332 -------------------------------SIIGTPEYCAPEILCGQPYTQNCDWYSLG 360

Query: 397 CMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDG 436
            + ++ LIG  PF+G++       ++  K      +L+DG
Sbjct: 361 SLTYDMLIGKPPFTGANHKVILSKIKQDKGIKIPHYLSDG 400

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/335 (26%), Positives = 143/335 (42%), Gaps = 72/335 (21%)

Query: 187  LARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDIL---TTTRSEWLVKLLYAFQDPES 243
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 833  LSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 892

Query: 244  LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+ 
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILLT 951

Query: 304  AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             EGHIK+ D+GL                                            ++ +
Sbjct: 952  PEGHIKIADYGLC-------------------------------------------KDGM 968

Query: 364  NYAN---SMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
             Y N   +  G+P++MA E+L  + Y   VD+W+ G +L++ L+  +PFSG   +E +  
Sbjct: 969  WYGNKTSTFCGTPEFMAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNA 1028

Query: 421  LRHWKRTLRRPFLNDGRSAISDRAWELIT----RLIADPINRL----RSFEHVKRMNYFH 472
            +           L D      D A +++      L  DP  RL    R    +    +F 
Sbjct: 1029 I-----------LTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFR 1077

Query: 473  EINFDTLRQL--SPPFTPQLDNETDAGYFD-DFTN 504
             INFD L  L   PP+ P++ +  D  YF+ +FT+
Sbjct: 1078 NINFDDLLNLRIKPPYIPEIKSAEDTSYFEQEFTS 1112

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/326 (26%), Positives = 144/326 (44%), Gaps = 38/326 (11%)

Query: 152 LQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 211
           + KE    +K  +K   KDF+  +           LA   DTK+  A             
Sbjct: 160 IAKESSKAQKNIIKKGIKDFKFGSVIGDGAYSTVMLATSIDTKKRYAAKVLNKEYLIRQK 219

Query: 212 ETNHILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPH 270
           +  ++  E+  L     S  +V+L   FQD  SLY  +E+ P GDF +L+    +L    
Sbjct: 220 KVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETC 279

Query: 271 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKI 330
           AR+Y +++  A++ LH  G  HRD+KPEN L+D E  IKLTDFG A            K+
Sbjct: 280 ARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTA------------KL 327

Query: 331 RLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTV 390
                 ++  P +    +  R K              S VG+ +Y++ E+L     DY  
Sbjct: 328 LNPTNNSVSKPEY---DLSTRSK--------------SFVGTAEYVSPELLNDSFTDYRC 370

Query: 391 DYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR 450
           D W+ GC+LF+ + G  PF  ++   T++ +   +      F    R        +L+ +
Sbjct: 371 DIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTPGFPLIIR--------DLVKK 422

Query: 451 LIADPINRLRSFEHVKRMNYFHEINF 476
           ++   ++R  +   +K  ++F ++NF
Sbjct: 423 ILVKNLDRRLTISQIKEHHFFKDLNF 448

>Kwal_27.10581
          Length = 1154

 Score =  121 bits (303), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 95/374 (25%), Positives = 154/374 (41%), Gaps = 77/374 (20%)

Query: 153  QKEHEVLRKRRLKPKNK-----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXX 207
            Q  H   R +R  PK +     DF ++            LA  ++ + +CA         
Sbjct: 804  QASHTSTRHKRRTPKRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHI 863

Query: 208  XXXXETNHILTERDIL---TTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTR 264
                +      E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N R
Sbjct: 864  IKNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR 923

Query: 265  TLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNER 324
             L    A+FY +E+  A+   H+ G  +RDLK EN L+  EGHIK+ D+GL         
Sbjct: 924  -LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLC-------- 974

Query: 325  IESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN---SMVGSPDYMALEVL 381
                                               ++++ Y N   +  G+P++MA E+L
Sbjct: 975  -----------------------------------KDEMWYGNKTSTFCGTPEFMAPEIL 999

Query: 382  EGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAIS 441
            + ++Y   VD+W+ G +L++ L+  +PFSG   +E +  +           L D      
Sbjct: 1000 KEQEYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFNAI-----------LTDEPLYPI 1048

Query: 442  DRAWELIT----RLIADPINRL----RSFEHVKRMNYFHEINFDTLRQL--SPPFTPQLD 491
            D A +++      L  DP  RL    R    V    +F  I FD +  L   PP+ P++ 
Sbjct: 1049 DMAGDIVQIFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIK 1108

Query: 492  NETDAGYFD-DFTN 504
               D  YF+ +FT+
Sbjct: 1109 AADDTSYFEKEFTS 1122

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 95/363 (26%), Positives = 150/363 (41%), Gaps = 71/363 (19%)

Query: 160  RKRRLKPKNK-----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETN 214
            R +R  PK +     DF ++            LAR ++T  +CA             +  
Sbjct: 806  RHKRKTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIE 865

Query: 215  HILTERDIL---TTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
                E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N R L    A
Sbjct: 866  SARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRA 924

Query: 272  RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
            +FY +E+  A+   H+ G  +RDLK EN L+  EGHIK+ D+GL                
Sbjct: 925  KFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLC--------------- 969

Query: 332  LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                               + +++        N  ++  G+P++MA E+L  + Y   VD
Sbjct: 970  -------------------KDEMWFG------NRTSTFCGTPEFMAPEILREQAYTKAVD 1004

Query: 392  YWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELIT-- 449
            +W+ G +L++ L+  +PFSG   +E +  +           L D      D A +++   
Sbjct: 1005 WWAFGVLLYQMLLCQSPFSGDDEDEVFNAI-----------LTDEPLYPIDMAGDIVQIF 1053

Query: 450  --RLIADPINRL----RSFEHVKRMNYFHEINFDTLRQL--SPPFTPQLDNETDAGYFD- 500
               L  DP  RL    R    V    +F  INFD +  L   PP+ P +    D  YF+ 
Sbjct: 1054 QGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTSYFEK 1113

Query: 501  DFT 503
            +FT
Sbjct: 1114 EFT 1116

>Kwal_56.22693
          Length = 984

 Score =  116 bits (291), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 85/344 (24%), Positives = 147/344 (42%), Gaps = 52/344 (15%)

Query: 145 NEEWNN---------YLQKEHEVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKE 195
           ++EW N          L  E  V+ +  +K   KDF               LAR  D+ +
Sbjct: 123 HDEWANRGAAKIVKEVLNPETGVMARHVIKKGIKDFRFGEVLGDGSYSTVMLARSNDSGK 182

Query: 196 VCAXXXXXXXXXXXXXETNHILTERDILT-TTRSEWLVKLLYAFQDPESLYLAMEFVPGG 254
             A             +  ++  E++ L        ++KL + FQD  SLY  +E+ P G
Sbjct: 183 KYAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNG 242

Query: 255 DFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG 314
           DF +++    +L    A +Y +++  A++ LH  G  HRD+KPEN L+D +  +KLTDFG
Sbjct: 243 DFLSVIKKFGSLSQECAVYYSAQILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFG 302

Query: 315 LAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPD 374
            A     +E  ++                                 N +  + S VG+ +
Sbjct: 303 TARILEKDETTQTF--------------------------------NLLERSKSFVGTAE 330

Query: 375 YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
           Y++ E+L     DY  D W+ GC+LF+ + G  PF  ++   T++ +   +      F  
Sbjct: 331 YVSPELLNDNYVDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPL 390

Query: 435 DGRSAISDRAWELITR-LIADPINRLRSFEHVKRMNYFHEINFD 477
             R        +LI + L+  P  RL +   +K+ ++F ++NF+
Sbjct: 391 VIR--------DLIKKILVKSPEQRLDA-SQIKKHHFFKDVNFN 425

>Scas_660.20
          Length = 957

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 138/298 (46%), Gaps = 51/298 (17%)

Query: 190 KRDTKEVCAXXXXXXXXXXXXXETNHILTERD---ILTTTRSEWLVKLLYAFQDPESLYL 246
           KR+TK + A             +  ++  E++   +L       +VKL Y F D E+LY 
Sbjct: 31  KRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPGIVKLYYTFHDEENLYY 90

Query: 247 AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEG 306
            ++++PGG+  +LL   +T     ++ +  ++   +  +H  G  HRDLKPEN L+D +G
Sbjct: 91  VLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIHSQGVIHRDLKPENVLLDRDG 150

Query: 307 HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDIN-Y 365
            + +TDFG A  T +                                       ND N  
Sbjct: 151 KLMITDFGAAYTTTAG-------------------------------------NNDANKS 173

Query: 366 ANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH-- 423
           ++S VG+ +Y++ E+L   +  ++ D W+LGCM+F+ + G  PF G +  +T+E +    
Sbjct: 174 SSSFVGTAEYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVALD 233

Query: 424 --WKRT--LRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFD 477
             W  T      FLN+    I +   ++   L+ +P +RL S + +K+  +F  +N++
Sbjct: 234 YPWSSTNIHNNKFLNNINPLIINLVRKI---LVLEPKDRL-SLKKIKQDPWFATVNWN 287

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 117/249 (46%), Gaps = 39/249 (15%)

Query: 228 SEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE 287
           ++ ++ L + FQD  SLY  +E+ P GD  +L+    ++     ++Y +++  A+  +H+
Sbjct: 213 TKGIISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHD 272

Query: 288 LGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKS 347
            G  HRDLKPEN L+D +  +KLTDFG A                            + +
Sbjct: 273 KGVIHRDLKPENILLDVDMKVKLTDFGTAR-------------------------LLDST 307

Query: 348 IEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYT 407
            ED      +L+ + +  +NS VG+ +Y++ E+L     D+  D W+ GC+LF+ + G  
Sbjct: 308 SED------DLKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKP 361

Query: 408 PFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKR 467
           PF  ++   T++ +   +      F    R  + +        LI +P  RL     +K 
Sbjct: 362 PFKANNEYLTFQKVMKVQFAFTAGFPMTVRDLVKN-------ILIKNPERRLL-INQIKA 413

Query: 468 MNYFHEINF 476
             +F ++NF
Sbjct: 414 HQFFADVNF 422

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  110 bits (275), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 121/251 (48%), Gaps = 39/251 (15%)

Query: 228 SEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE 287
           S  +VKL + FQD  SLY  +E+ P GDF +++    +L     R+Y +++   +  LH 
Sbjct: 240 SRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLHS 299

Query: 288 LGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKS 347
            G  HRD+KPEN L+D +  +K+TDFG A         + ++ + E+  N EF       
Sbjct: 300 KGIIHRDIKPENILLDKDMKVKITDFGTA---------KILEPKNEDEDNPEF------- 343

Query: 348 IEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYT 407
                        N +  + S VG+ +Y++ E+L     D   D W+ GCM+F+ + G  
Sbjct: 344 -------------NLLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKP 390

Query: 408 PFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFEHVK 466
           PF  ++   T++ +   +      F    R        +L+ R L+  P  RL +   ++
Sbjct: 391 PFKATNEYLTFQKVMKVQYAFTAGFPVVVR--------DLVKRILLKVPEQRL-TIPQIE 441

Query: 467 RMNYFHEINFD 477
           + +++ +I+F+
Sbjct: 442 KHHFYKDISFE 452

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  110 bits (274), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 126/271 (46%), Gaps = 47/271 (17%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAV 282
           L ++R   ++KL + FQD  +LY  +E+ P GDF +++    TL     ++Y +++  A+
Sbjct: 255 LNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAI 314

Query: 283 NALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPA 342
           + LH+ G  HRD+KPEN L+D    IKLTDFG                            
Sbjct: 315 HHLHKQGIIHRDVKPENILLDKTMKIKLTDFG---------------------------- 346

Query: 343 FTEKSI--EDRRKIYQNLRQNDINY-ANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCML 399
            T K I  ED  K Y      D+N  + S VG+ +Y++ E+L     D   D W+ GC+L
Sbjct: 347 -TAKLIGREDENKPY------DLNTRSKSFVGTAEYVSPELLNDNYVDSRCDIWAFGCIL 399

Query: 400 FEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRL 459
           F+ + G  PF  ++   T++ +   +      F    R  I          L+  P  RL
Sbjct: 400 FQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQ-------LLVKKPEQRL 452

Query: 460 RSFEHVKRMNYFHEINFDTLRQLSPPFTPQL 490
            +   +++ ++F++INF      S P  PQ+
Sbjct: 453 -TILQIEKHHFFNDINFRNGSVWSNP-APQI 481

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score =  108 bits (271), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 89/342 (26%), Positives = 139/342 (40%), Gaps = 61/342 (17%)

Query: 190 KRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAME 249
           K D+ E+ A                 +L+E  I  +     +V+ +  F+D  ++Y+ +E
Sbjct: 100 KDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLE 159

Query: 250 FVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIK 309
             P G    LL   + L  P  RF+ +++  A+  +H     HRDLK  N   D+  ++K
Sbjct: 160 ICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLK 219

Query: 310 LTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSM 369
           + DFGLAA  ++N                          E  RK              ++
Sbjct: 220 IGDFGLAA-VLAN--------------------------ESERKY-------------TI 239

Query: 370 VGSPDYMALEVLEGKK--YDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL--RHWK 425
            G+P+Y+A EVL GK   + + VD WSLG ML+  LIG  PF     N  YE +  R + 
Sbjct: 240 CGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 426 RTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPP 485
               +P  ++G+  I D        L  DPI R  S   +    +F        R   PP
Sbjct: 300 FPRDKPISDEGKILIRD-------ILSLDPIER-PSLTEIMDYVWF--------RGTFPP 343

Query: 486 FTPQLDNETDAGYFDDFTNEADMAKYADVFKRQDKLAAMVDD 527
             P     ++A  F+D   E  +  + D  ++   L +M  D
Sbjct: 344 SIPS-TVMSEAPNFEDIPEEQSLVNFKDCMEKSLLLESMSSD 384

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 140/326 (42%), Gaps = 40/326 (12%)

Query: 154 KEHEVLRKRRLKPKN-KDFEMITXXXXXXXXXXXLA-RKRDTKEVCAXXXXXXXXXXXXX 211
           K+ E+ R++ +  K  KDF+              LA  K D+ +  A             
Sbjct: 100 KDAEIFRRQTIIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQK 159

Query: 212 ETNHILTERDILTTTRS-EWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPH 270
           +  ++  E+  L   +S   ++ L + FQD  +LY  +E+ P GDF +L+    TL    
Sbjct: 160 KVKYVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEEC 219

Query: 271 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKI 330
             +Y +++  A+ ++H  G  HRD+KPEN L+D    IKLTDFG A              
Sbjct: 220 TIYYSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTA-------------- 265

Query: 331 RLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTV 390
                         +K  +   K + NL    +  ++S VG+ +Y++ E+L     DY  
Sbjct: 266 -----------KLLQKKSDKNGKPHYNL----LTRSSSFVGTAEYVSPELLSDNYTDYKC 310

Query: 391 DYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR 450
           D W+ GC++++ + G  PF  ++   T++ +   +      F     + I D    +   
Sbjct: 311 DIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGF----PTIIRDLVKNI--- 363

Query: 451 LIADPINRLRSFEHVKRMNYFHEINF 476
           L+  P  RL +   +K    F  INF
Sbjct: 364 LVKQPEKRL-TIPQIKEHCLFENINF 388

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  107 bits (267), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 125/258 (48%), Gaps = 29/258 (11%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +VKL Y F D E+LY  +++  GG+  +LL    T     A+ + +++   +  +H  G 
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFMHARGV 134

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+  EG + +TDFG AA T +N                    F++K    
Sbjct: 135 IHRDLKPENVLLSKEGILMITDFG-AAATQNN--------------------FSDKD-NT 172

Query: 351 RRKIYQNLRQNDI------NYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALI 404
           R    + + ++D+         +S VG+ +Y++ E+L   K  +  D W+LGCM+++ + 
Sbjct: 173 RSNANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQ 232

Query: 405 GYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEH 464
           G+ PF G +  +T+E +     +   P        I+ +   L+ R++     +  + + 
Sbjct: 233 GFPPFRGENELKTFEKIVSLDYSW-NPERQTNFGTINIQVVNLVRRMLTIDTTQRATIDQ 291

Query: 465 VKRMNYFHEINFDTLRQL 482
           +KR  +F  +++   ++L
Sbjct: 292 IKRDPWFANVDWGDKKKL 309

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  105 bits (262), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 85/165 (51%), Gaps = 2/165 (1%)

Query: 162 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERD 221
           + L P  KD+++I            LARK+ T +  A             +  ++ +ER 
Sbjct: 773 KPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERA 832

Query: 222 ILTTTRSEWLVKLLYA-FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFC 280
           I+     +  V  LYA FQ+ ++L+L ME++PGGD  TLL     L     + Y+SE+  
Sbjct: 833 IMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIII 892

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTVSNER 324
            V  +H  G  H DLKPEN LID  GH+KLTDFGL+ AG V   R
Sbjct: 893 GVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHR 937

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 73/136 (53%), Gaps = 8/136 (5%)

Query: 371  GSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRR 430
            G+PDY+A E +EG   D   D+WS+GC+LFE + GY PF   + ++ + N+   K  +  
Sbjct: 1105 GTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETPDQVFRNILEGK--IDW 1162

Query: 431  PF---LNDGRSAISDRAWELITR-LIADPINRL--RSFEHVKRMNYFHEINFDTLRQLSP 484
            P    + + R  IS  A +LI + LI DP  RL     E +K   YF ++ +D +   + 
Sbjct: 1163 PIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPYFKDVKWDHVYDETA 1222

Query: 485  PFTPQLDNETDAGYFD 500
             + P +++  D  YFD
Sbjct: 1223 SYVPNIEDPEDTDYFD 1238

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score =  103 bits (258), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 114/255 (44%), Gaps = 57/255 (22%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E D+L       +VKL   F+D ++ Y+ MEFV GGD    +    T+     R    ++
Sbjct: 238 ELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQV 297

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGH--IKLTDFGLAAGTVSNERIESMKIRLEEVK 336
             AV  +H+ G +HRDLKP+N +I+ +    IK+TDFGLA                    
Sbjct: 298 LEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAK------------------- 338

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK---------YD 387
                                  QN   + N+  G+  Y+A EV++GK          Y 
Sbjct: 339 ----------------------VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYS 376

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWEL 447
             VD WS+GC+++  L G+ PFSG S NE ++ ++  + +     L D R  IS+ A   
Sbjct: 377 SLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIK--RGSYHEGPLKDYR--ISEEARNF 432

Query: 448 ITRLI-ADPINRLRS 461
           I  L+  DP  R+ +
Sbjct: 433 IDCLLNVDPKERMNA 447

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  102 bits (255), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 111/251 (44%), Gaps = 56/251 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++KL Y F D E+LY  ++F PGG+   LL           + ++ ++  A+  +H    
Sbjct: 73  IIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIHGCKV 132

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+ +EG + +TDFG+A+   + + + S                       
Sbjct: 133 VHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSS----------------------- 169

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFS 410
                           +S VG+ +Y++ E+L   K ++  D W++GCML++   G  PF 
Sbjct: 170 ---------------TSSFVGTAEYVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFR 214

Query: 411 GSSTNETYENLR----HWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFEHV 465
           G +    +E +     HW               +S    +L+++ L+ DP +R  +   +
Sbjct: 215 GENELAAFEKIVNLDYHWIY------------MVSQHITDLVSKILVLDPDSRY-TLPQI 261

Query: 466 KRMNYFHEINF 476
           K   +F  I++
Sbjct: 262 KNHAWFQGIDW 272

>Kwal_56.24091
          Length = 381

 Score =  100 bits (249), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 126/299 (42%), Gaps = 51/299 (17%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DFE+               + + T  +CA                    E +I ++ +  
Sbjct: 122 DFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKHP 181

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
            L +L   F D + +YL ME++  G+    L +        A  ++ +M  A+N +H   
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKN 241

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRD+KPEN L+  +  +KLTDFG +   V N                           
Sbjct: 242 ILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNS-------------------------- 275

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
            +RK              ++ G+ DY++ E+++ ++YD  VD W+LG + +E L+G  PF
Sbjct: 276 -KRK--------------TLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPF 320

Query: 410 SGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA-DPINRLRSFEHVKR 467
              +   TY+  R  KR LR P        +S  A +LI+RL+  DP NR+   + VKR
Sbjct: 321 EEDTKELTYK--RIIKRDLRFP------DQVSPHARDLISRLLEYDPQNRI-PLKDVKR 370

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  102 bits (253), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 86/157 (54%), Gaps = 2/157 (1%)

Query: 166 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTT 225
           P  KD++++            LARK+ T +  A             +  ++ +ER I+  
Sbjct: 789 PSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMV 848

Query: 226 TRSE-WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNA 284
              + ++ +L  +FQ+ ++L+L ME++PGGD  TL+     L    A+ Y++E+   VN 
Sbjct: 849 QSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVND 908

Query: 285 LHELGYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTV 320
           +H+ G  H DLKPEN LID  GH+KLTDFGL+ AG +
Sbjct: 909 MHQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGLI 945

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 17/186 (9%)

Query: 371  GSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLR 429
            G+PDY+A E +EGK  D    D+WS+GC+ FE L+GY PF   + +  ++ +      ++
Sbjct: 1149 GTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKKI--LSGVIQ 1206

Query: 430  RP-FLNDGRSA--ISDRAWELITR-LIADPINRL--RSFEHVKRMNYFHEINFDTLRQLS 483
             P F N+      ++  A +LI + L+ DP  RL  +  + +K   YF  +++D +    
Sbjct: 1207 WPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDWDHVYDEE 1266

Query: 484  PPFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQD------KLAAMVDDSEVDSKLIGF 537
              F P +DN  D  YFD     A++  + D  +  +      K     D SE+ +  +  
Sbjct: 1267 ASFVPTIDNPEDTDYFD--LRGAELQDFGDDIENDNANILFGKHGINTDVSELSAANLSP 1324

Query: 538  TFRHKN 543
               HKN
Sbjct: 1325 PLNHKN 1330

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 63/192 (32%), Positives = 98/192 (51%), Gaps = 3/192 (1%)

Query: 162 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERD 221
           + + P  +D+++I            LA+KR T E  A             +  ++ +ER 
Sbjct: 693 KSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERA 752

Query: 222 ILTTTRSEWLVKLLYA-FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFC 280
           I+     +  V  LYA FQ+ E+L+L M+++ GGD  TL+     L    A+ YI E+  
Sbjct: 753 IMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVIS 812

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            V+ +H+ G  H DLKP+N LID+ GHIKLTDFGL+   +     E  K R  ++++   
Sbjct: 813 GVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSRMGLLRRHKE--KRRNSQIQSSRN 870

Query: 341 PAFTEKSIEDRR 352
           P+FT  S   R+
Sbjct: 871 PSFTCDSSVTRK 882

>Scas_502.2
          Length = 1116

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 114/250 (45%), Gaps = 42/250 (16%)

Query: 228 SEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE 287
           S  +++L + FQD  SLY  +E+ P GD  +L+    +L      +Y +++  A+  +H 
Sbjct: 232 SRSIIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAIKFMHS 291

Query: 288 LGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKS 347
            G  HRD+KPEN L+D +  +K+TDFG  A  + N+                 P  T   
Sbjct: 292 KGIIHRDIKPENILLDKDMKVKITDFG-TAKILDNK-----------------PPGTSYD 333

Query: 348 IEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYT 407
           +  R K              S VG+ +Y++ E+L     D   D W+ GC++F+ + G  
Sbjct: 334 LLTRSK--------------SFVGTAEYVSPELLNDNYTDARSDIWAFGCIVFQMIAGKP 379

Query: 408 PFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFEHVK 466
           PF  ++   T++ +   +      F    R        +L+ R LI  P  RL + E ++
Sbjct: 380 PFKATNEYLTFQKVMKVQYAFTAGFPTVVR--------DLVKRILIKAPEQRL-TIEAIE 430

Query: 467 RMNYFHEINF 476
           + ++F   NF
Sbjct: 431 KHHFFRSKNF 440

>Kwal_56.22476
          Length = 697

 Score =  100 bits (249), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 109/246 (44%), Gaps = 49/246 (19%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           +L+E  I  + R   +V+ +  F+D  ++Y+ +E  P G    LL   + L  P  RF+ 
Sbjct: 123 LLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFT 182

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
           +++  AV  +H     HRDLK  N   D   ++K+ DFGLAA  ++N             
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAA-VLAN------------- 228

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK--YDYTVDYW 393
                         DR + Y            ++ G+P+Y+A EVL GK   + Y VD W
Sbjct: 229 --------------DRERKY------------TVCGTPNYIAPEVLTGKHTGHSYEVDIW 262

Query: 394 SLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA 453
           S G M++  LIG  PF     N  YE ++         F+      IS  A  LI  +++
Sbjct: 263 SCGVMIYALLIGKPPFQAKEVNIIYERIKCGD------FVFPKDKFISPEALVLIKDILS 316

Query: 454 -DPINR 458
            DP+ R
Sbjct: 317 IDPLER 322

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score =  100 bits (248), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 142/338 (42%), Gaps = 68/338 (20%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           +L+E  I  +     +V+ +  F+D  ++Y+ +E  P G    L+   +T+  P  RF++
Sbjct: 125 LLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFM 184

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
           +++   +  +H     HRDLK  N   D   ++K+ DFGLAA  ++N+R           
Sbjct: 185 TQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAA-VLANDR----------- 232

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK--YDYTVDYW 393
                           RK              ++ G+P+Y+A EVL GK   + Y VD W
Sbjct: 233 ---------------ERKF-------------TICGTPNYIAPEVLMGKHSGHSYEVDIW 264

Query: 394 SLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA 453
           S+G ML+  LIG  PF     N  YE ++      +R F       IS  A  LI  +++
Sbjct: 265 SIGVMLYALLIGKPPFQAKDVNTIYERIK------QRNFAYPKDKKISQDAKYLIDDILS 318

Query: 454 -DPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFT--------PQLDNETDAGYFDDFTN 504
            +P+ R  S + +    +F        R   PP+T        P   + T    F +F N
Sbjct: 319 LNPMER-PSIQEIMDYVWF--------RGTFPPYTLNSVMTTVPDYSHITPQESFMNFQN 369

Query: 505 EADMAKYADVFKRQDKLAAMVDDSEVDSKLIGFTFRHK 542
             + +    V   Q+ + A + +  V +  +     HK
Sbjct: 370 CLEASGLLSV--HQNHMVANISERTVPTNKLHIAPAHK 405

>Kwal_26.8796
          Length = 796

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 112/255 (43%), Gaps = 56/255 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           +  E ++L       +V L   ++D +S YL MEFV GGD    +    ++     R   
Sbjct: 231 VARELEVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREIT 290

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLI--DAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
            ++  AV  +H +G +HRDLKP+N LI  D    +K+TDFGLA            KI   
Sbjct: 291 RQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLA------------KI--- 335

Query: 334 EVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK-------- 385
                                     Q +  +  +  G+  Y+A EV+ GK         
Sbjct: 336 --------------------------QGNGTFMKTFCGTLAYVAPEVISGKNSGEKEGNT 369

Query: 386 YDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAW 445
           Y   VD WS+GC+++  L G+ PFSGS+ N+ Y+ +     +     L D R  ISD A 
Sbjct: 370 YSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQITAG--SYHEGPLKDYR--ISDDAR 425

Query: 446 ELITRLI-ADPINRL 459
           + I   +  DP NR+
Sbjct: 426 DFIESFLQVDPRNRM 440

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 115/272 (42%), Gaps = 49/272 (18%)

Query: 190 KRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAME 249
           K D+ +V A                 +L+E  I  + +   +V+    F+D  ++Y+ +E
Sbjct: 91  KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLE 150

Query: 250 FVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIK 309
             P G    LL   + L  P  RF+ +++  A+  +H     HRDLK  N   D   ++K
Sbjct: 151 ICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLK 210

Query: 310 LTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSM 369
           + DFGLAA  ++N                           DR + Y            ++
Sbjct: 211 IGDFGLAA-VLAN---------------------------DRERKY------------TI 230

Query: 370 VGSPDYMALEVLEGKK--YDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRT 427
            G+P+Y+A EVL GK   + + VD WS+G M++  LIG  PF     N  YE +    + 
Sbjct: 231 CGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERI----KV 286

Query: 428 LRRPFLNDGRSAISDRAWELITRLIA-DPINR 458
               F  D    IS  A  LI  +++ DP+ R
Sbjct: 287 CDFSFPKD--KPISSEAKVLIKDILSLDPLER 316

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score = 98.6 bits (244), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 80/152 (52%), Gaps = 1/152 (0%)

Query: 166 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTT 225
           P  KD+++I            LA KR T E  A             +  ++ +ER I+  
Sbjct: 677 PSIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMV 736

Query: 226 TRSEWLVKLLYA-FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNA 284
              +  V  LYA FQ+ E+L+L ME++ GGD  TL+     L    A+ YI+E+   V+ 
Sbjct: 737 QSEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDD 796

Query: 285 LHELGYTHRDLKPENFLIDAEGHIKLTDFGLA 316
           +H  G  H DLKP+N LID+ GH+KLTDFGL+
Sbjct: 797 MHMSGIIHHDLKPDNLLIDSNGHVKLTDFGLS 828

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 72/136 (52%), Gaps = 8/136 (5%)

Query: 371  GSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRR 430
            G+PDY++ E + G       D+WS+GC+LFE L+GY PF  S+  + ++N+   +  +  
Sbjct: 1003 GTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNILSGQ--IDW 1060

Query: 431  PFLNDGRSA---ISDRAWELITRLI-ADPINRLRS--FEHVKRMNYFHEINFDTLRQLSP 484
            P   +  +    +S  A +LI +L+ ++P  RL +   + +K   YF  IN+  +     
Sbjct: 1061 PSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWSKVYDEEA 1120

Query: 485  PFTPQLDNETDAGYFD 500
             F P +DN  D  YFD
Sbjct: 1121 SFVPTVDNPEDTDYFD 1136

>Scas_700.54
          Length = 698

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 129/298 (43%), Gaps = 63/298 (21%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E ++L       +V+L   ++D +S Y+ MEFV GGD    +     +     +    ++
Sbjct: 269 ELEVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQI 328

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEG--HIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
             AV  +H  G +HRDLKP+N LI+ +    +K+TDFGLA                    
Sbjct: 329 LEAVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK------------------- 369

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGK--------KYDY 388
                                  Q + ++  +  G+  Y+A EV+ GK        +Y  
Sbjct: 370 ----------------------VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEYSS 407

Query: 389 TVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELI 448
            VD WS+GC+++  L G+ PFSGS+  + Y+ +   + +     L D R  ISD A   I
Sbjct: 408 LVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQIS--RGSYHEGPLKDFR--ISDEARSFI 463

Query: 449 TRLI-ADPINRL---RSFEH--VKRMNYFHEINFDTLRQLSPPFTPQ--LDNETDAGY 498
             L+  +P NRL   R+ EH  +K   Y       +   L+   + Q  L++  DA Y
Sbjct: 464 DSLLQVNPGNRLTAARALEHPWIKMAQYSQSFKEASQISLTESLSQQKLLESMDDAQY 521

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/262 (29%), Positives = 118/262 (45%), Gaps = 61/262 (23%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E ++L       +V L   ++D ES YL MEFV GGD    +    ++     R    ++
Sbjct: 263 ELEVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQI 322

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGH--IKLTDFGLAAGTVSNERIESMKIRLEEVK 336
             AV  +HE G +HRDLKP+N LI+ +    +K+TDFGLA            KI      
Sbjct: 323 LEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLA------------KI------ 364

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK----------Y 386
                                  Q++  +  +  G+  Y+A EV+ GK           Y
Sbjct: 365 -----------------------QDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANGNLY 401

Query: 387 DYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWE 446
              VD WS+GC+++  L G+ PFSGS+  + Y+ + +   +     L D    ISD A +
Sbjct: 402 SSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANG--SYHEGPLKD--YWISDEARD 457

Query: 447 LITRLI-ADPINRL---RSFEH 464
            I  L+  +P++RL   R+ +H
Sbjct: 458 FIDSLLQINPVDRLTAERALQH 479

>Kwal_47.18307
          Length = 621

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 120/269 (44%), Gaps = 47/269 (17%)

Query: 212 ETNHILTERDILTTTRSEW---LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRS 268
           +  ++  E+D+L          +VKL   F D E+LY  +E+V GG+   L+     L  
Sbjct: 52  KVKYVTIEKDLLNMLAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTE 111

Query: 269 PHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESM 328
             +R   +++   V+ +H  G  HRDLKPEN L+  EG + +TDFG AA T ++ + E+ 
Sbjct: 112 DLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGRVVITDFG-AACTAADRKFENT 170

Query: 329 KIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDY 388
           K                                      S VG+ +Y++ E+L   +  +
Sbjct: 171 K-----------------------------------RTASFVGTAEYVSPELLLHSQCGF 195

Query: 389 TVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELI 448
           + D W+LGC++++   G  PF G +  +T+E +      L   +L      +      + 
Sbjct: 196 SSDIWALGCIIYQLNQGKPPFRGENELQTFEKI----VALDYKWLFSNSPQVVSIVQSI- 250

Query: 449 TRLIADPINRLRSFEHVKRMNYFHEINFD 477
             L+ DP+ R  S   +K+  +F  I++D
Sbjct: 251 --LVTDPLKR-PSAAQLKQNPWFASIDWD 276

>Kwal_14.1159
          Length = 1521

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 87/169 (51%), Gaps = 2/169 (1%)

Query: 166 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTT 225
           P  KD+++I            LA++R T E  A             +  ++ +ER I+  
Sbjct: 672 PSIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMV 731

Query: 226 TRSEWLVKLLYA-FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNA 284
             ++  V  LYA FQ+  +L+L ME++ GGD  TL+    +L     + YISE+   V  
Sbjct: 732 QSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVED 791

Query: 285 LHELGYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTVSNERIESMKIRL 332
           +H+ G  H DLKP+N LID  GH+KLTDFGL+  G V+     + K RL
Sbjct: 792 MHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGLVTRHTGATQKSRL 840

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 77/154 (50%), Gaps = 23/154 (14%)

Query: 371  GSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRR 430
            G+PDY+A E +EG     + D+WS+GCMLFE + GY PF  S+  E + N+      +  
Sbjct: 960  GTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNI--LAGNIDW 1017

Query: 431  PFLND---GRSAISDRAWELITR-LIADPINRLRS------FEHVKRMNYFHEINFDTLR 480
            P   D    R  IS  A +LI + L+ DP  RL +      FEH     YF +++++ L 
Sbjct: 1018 PAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEH----PYFQDVDWENLY 1073

Query: 481  QLSPPFTPQLDNETDAGYFD-------DFTNEAD 507
            + +  F P + +     YFD       DF++  D
Sbjct: 1074 KDTGSFVPDIAHPESTDYFDLRGAQLEDFSDSDD 1107

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 100/239 (41%), Gaps = 48/239 (20%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           +L+E  I  + +   +V+    F+D  ++Y+ +E  P G    LL   + L  P  RF +
Sbjct: 134 LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCM 193

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            ++  A+  +H     HRDLK  N   D E ++K+ DFGLAA                  
Sbjct: 194 IQIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAA------------------ 235

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK--YDYTVDYW 393
                                 +  ND     ++ G+P+Y+A EVL GK   + Y VD W
Sbjct: 236 ----------------------VLANDKERKYTICGTPNYIAPEVLTGKHTGHSYEVDIW 273

Query: 394 SLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI 452
           S+G ML+  L G  PF        YE ++       R F+      +S  A  LI+ L+
Sbjct: 274 SIGVMLYALLFGKPPFQAKEVETIYERIKC------RDFIFPADKPVSSDAKNLISHLL 326

>Scas_707.3
          Length = 1598

 Score = 96.3 bits (238), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/186 (31%), Positives = 95/186 (51%), Gaps = 6/186 (3%)

Query: 160 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTE 219
           + + L P  KD+ ++            LARK+ T +  A             +  ++ +E
Sbjct: 688 QTKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSE 747

Query: 220 RDILTTTRSEWLVKLLYA-FQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           R I+     +  V  L+A FQ+ E+L+L ME++PGGD  TL+     L     + Y++E+
Sbjct: 748 RAIMMVQSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTEI 807

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTVSN----ERIESMKIRLE 333
              V+ +H     H DLKP+N LID  GH+KLTDFGL+ AG +      +R++S+    E
Sbjct: 808 IVGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHKFVDRVKSLSPSTE 867

Query: 334 EVKNLE 339
            + N++
Sbjct: 868 ILSNIK 873

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 81/155 (52%), Gaps = 10/155 (6%)

Query: 371  GSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRR 430
            G+PDY+A E +EG       D+WS+GC++FE L GY PF  ++    +  +   K  +  
Sbjct: 1007 GTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKILSGK--IEW 1064

Query: 431  P---FLNDGRSAISDRAWELITR-LIADPINRLRS--FEHVKRMNYFHEINFDTLRQLSP 484
            P    + + R  +S  A +LI + L+ DP  RL +   + +K+  YF ++N+D +     
Sbjct: 1065 PQFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNWDHVYDEEA 1124

Query: 485  PFTPQLDNETDAGYFDDFTNEADMAKYADVFKRQD 519
             F P ++N  D  YFD  T  A +  + D ++ ++
Sbjct: 1125 SFVPTVENPEDTDYFD--TRGAVLENFGDDYEDKE 1157

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 94.0 bits (232), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 115/284 (40%), Gaps = 69/284 (24%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E ++L       +V L   ++D  + Y+ MEF+ GGD    +     +     R    ++
Sbjct: 234 ELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQI 293

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGH--IKLTDFGLAAGTVSNERIESMKIRLEEVK 336
             A+  +H  G +HRDLKP+N LI+ +    +K+TDFGLA                    
Sbjct: 294 LEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK------------------- 334

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEG------------- 383
                                  Q + +   +  G+  Y+A EV+ G             
Sbjct: 335 ----------------------VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETEEE 372

Query: 384 -KKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISD 442
             +Y   VD WS+GC++F  L G+ PFSGS+  + YE +R  K +     L D R  ISD
Sbjct: 373 RIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIR--KGSYHEGPLKDFR--ISD 428

Query: 443 RAWELITRLIADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPF 486
            A + I  L+          +  KRM     +N   ++Q S  F
Sbjct: 429 EARDFIDGLL--------QVDQSKRMTVDDALNHPWIKQCSSQF 464

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 122/292 (41%), Gaps = 50/292 (17%)

Query: 169 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRS 228
           +DFE+               + R+T  +CA                    E +I  + + 
Sbjct: 98  QDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKH 157

Query: 229 EWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHEL 288
           + L +L   F D + +YL ME+V  G+    L N   L    A +++ +M  A++ +H  
Sbjct: 158 KNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSK 217

Query: 289 GYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSI 348
              HRD+KPEN LI     IKLTDFG    +V NE  +  K                   
Sbjct: 218 NILHRDIKPENILIGFNNTIKLTDFGW---SVYNEDGQKRK------------------- 255

Query: 349 EDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTP 408
                              ++ G+ DY++ E+++ ++Y+  VD W+LG + +E L+G  P
Sbjct: 256 -------------------TLCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPP 296

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA-DPINRL 459
           F   +   TY   R  +  L+ P        +S +A +LI RL+  +P  R+
Sbjct: 297 FEEDTKEMTYR--RILRCDLKFPL------NVSPQARDLIVRLLQFEPSKRI 340

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 117/291 (40%), Gaps = 50/291 (17%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DFE+               R  ++  VCA                    E +I ++ R  
Sbjct: 108 DFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEIQSSLRHP 167

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
            L +L   F D + +YL ME++  G+    L          A +Y+ +M  A++ +HE  
Sbjct: 168 NLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMADALDYMHERN 227

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRD+KPEN +I     IKLTDFG +  T                              
Sbjct: 228 ILHRDIKPENIIIGFNNTIKLTDFGWSVITPKG--------------------------- 260

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
            +RK              ++ G+ DY++ E++  ++Y+  VD W+LG + +E L+G  PF
Sbjct: 261 SKRK--------------TLCGTVDYLSPELIRSREYNEKVDVWALGVLTYELLVGSPPF 306

Query: 410 SGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA-DPINRL 459
              S   TY      KR L+R  +      +   A  LI+RL+  DP +R+
Sbjct: 307 EEESKELTY------KRILKRNLIFP--DHVDTEARHLISRLLEYDPGDRI 349

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ LL  +++   LYL +E+V GG+    L++   L  P A  Y +++   V+  H    
Sbjct: 188 VMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNI 247

Query: 291 THRDLKPENFLIDAEGH-IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            HRDLKPEN L+D +   IK+ DFG+AA  + N+ +E                       
Sbjct: 248 CHRDLKPENLLLDKKNKVIKIADFGMAALELPNKLLE----------------------- 284

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTP 408
                             +  GSP Y + E++ GK Y     D WS G +LF  L G+ P
Sbjct: 285 ------------------TSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLP 326

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
           F+  +  +    ++  +  L     ND +        +LITR L+ +P  RL
Sbjct: 327 FNDDNIKKLLLKVQAGRFQLPPYLTNDAK--------DLITRILVTNPEKRL 370

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 108/239 (45%), Gaps = 49/239 (20%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +++L   ++  + LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 88  VLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 147

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+D + ++KL DFG+AA                              +E 
Sbjct: 148 VHRDLKPENLLLDHKFNVKLADFGMAA------------------------------LES 177

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTPF 409
           + K+ +           +  GSP Y A E++ G  Y  +  D WS G +L+  L G  PF
Sbjct: 178 KDKLLE-----------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 226

Query: 410 SGSSTNETYENLRHWKRTLRR-PFLNDGRSAISDRAWELITRLI-ADPINRLRSFEHVK 466
                +E   N+R+    ++   F   G   IS  A +LI R++  DP  R+++ E +K
Sbjct: 227 -----DEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>Scas_644.15
          Length = 726

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 105/244 (43%), Gaps = 49/244 (20%)

Query: 218 TERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISE 277
           +E  I  + +   +V  +  F+D  ++Y+ +E    G    L+   +TL  P  RF+ ++
Sbjct: 138 SEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQ 197

Query: 278 MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKN 337
           +  AV  +H     HRDLK  N   D + ++K+ DFGLAA   +N               
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANN--------------- 242

Query: 338 LEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK--YDYTVDYWSL 395
                        R + Y            ++ G+P+Y+A EVL GK   + + VD WS+
Sbjct: 243 -------------RERKY------------TVCGTPNYIAPEVLMGKHAGHSFEVDIWSI 277

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA-D 454
           G M++  L+G  PF     N  Y+ ++  +    +         +S  A  LI  ++  D
Sbjct: 278 GVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYPK------DKYVSSEAKTLIADILCVD 331

Query: 455 PINR 458
           P+ R
Sbjct: 332 PVER 335

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 80/143 (55%), Gaps = 8/143 (5%)

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH 423
           N + +  G+PDY+A E ++G     T D+WS+GC+ FE L GY PF G++ +E +EN+  
Sbjct: 58  NESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEVFENI-- 115

Query: 424 WKRTLRRPFLNDGRSA---ISDRAWELITRLIA-DPINRLRS--FEHVKRMNYFHEINFD 477
               +R P   D  +    IS  A +L+ +L+  DP  RL +   + +K   YF ++++D
Sbjct: 116 IGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKDVDWD 175

Query: 478 TLRQLSPPFTPQLDNETDAGYFD 500
            +    P F P++++  D  YFD
Sbjct: 176 HVYDEQPSFVPRVEHPEDTEYFD 198

>Scas_616.10
          Length = 1461

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 198 VMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNI 257

Query: 291 THRDLKPENFLIDAEG-HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            HRDLKPEN L+D +   IK+ DFG+AA                    LE P        
Sbjct: 258 CHRDLKPENLLLDKKNKSIKIADFGMAA--------------------LELP-------- 289

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTP 408
              K+ Q           +  GSP Y + E++ GK Y     D WS G +LF  L G+ P
Sbjct: 290 --NKLLQ-----------TSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLP 336

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
           F+  +  +    ++  K   R P      S +S  A +LI+R L+ DP  R+
Sbjct: 337 FNDDNIKKLLLKVQAGK--FRMP------STLSPEAQDLISRILVIDPSKRI 380

>Scas_627.7
          Length = 349

 Score = 85.9 bits (211), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 102/252 (40%), Gaps = 41/252 (16%)

Query: 170 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSE 229
           DFE+               R ++T  +CA                    E +I T+    
Sbjct: 90  DFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSLNHP 149

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
            L KL   F D + +YL ME++  G+   LL +        A  ++ ++  A+N LH+  
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQ 209

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLKPEN LI     IKLTDFG                                SI 
Sbjct: 210 IIHRDLKPENILIGFNNVIKLTDFGW-------------------------------SII 238

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
           + R + +           ++ G+ DY++ E++  ++YD  VD W+LG + +E ++G  PF
Sbjct: 239 NPRGVKR----------KTLCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPF 288

Query: 410 SGSSTNETYENL 421
              +   TY+ +
Sbjct: 289 EEDTKELTYKRI 300

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 89/202 (44%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINTRT-------LR 267
           I+ E  ++  +R E +V  L A+   E  L++ ME++ GG    ++ N+ T       L 
Sbjct: 626 IVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLS 685

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D +  +K+TDFG             
Sbjct: 686 EPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFG------------- 732

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                          F  K  + R K              +MVG+P +MA EV++ K+YD
Sbjct: 733 ---------------FCAKLTDQRSK------------RATMVGTPYWMAPEVVKQKEYD 765

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             VD WSLG M  E L G  P+
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPY 787

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 100/232 (43%), Gaps = 52/232 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ L   +++   LYL +E+V GG+    LI    L    A  Y  ++   V+  H    
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNI 185

Query: 291 THRDLKPENFLIDAEGH-IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            HRDLKPEN L+D +   +K+ DFG+AA   +N  +E                       
Sbjct: 186 CHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLE----------------------- 222

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTP 408
                             +  GSP Y + E++ G+KY  +  D WS G +LF  L G+ P
Sbjct: 223 ------------------TSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLP 264

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
           F+  +  +    ++H +  +         S +S  A +LI++ L+ DP  R+
Sbjct: 265 FNDDNVRKLLLKVQHGRYQM--------PSNVSKEAKDLISKILVVDPEKRI 308

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 108/239 (45%), Gaps = 49/239 (20%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +++L   ++  + LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 90  VLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGI 149

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+D + +IKL DFG+AA                              +E 
Sbjct: 150 VHRDLKPENLLLDHKFNIKLADFGMAA------------------------------LES 179

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTPF 409
           + K+ +           +  GSP Y A E++ G  Y  +  D WS G +L+  L G  PF
Sbjct: 180 KDKLLE-----------TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228

Query: 410 SGSSTNETYENLRHWKRTLRR-PFLNDGRSAISDRAWELITRLI-ADPINRLRSFEHVK 466
                +E   N+R+    ++   +   G   IS  A +LI +++  +P  R+++ E +K
Sbjct: 229 -----DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILK 282

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 94/220 (42%), Gaps = 47/220 (21%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
           +LYL +E+   G+   LL++   L    A     ++   ++  H LG  HRDLKPEN L+
Sbjct: 101 NLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLL 160

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           D+  +IK+ DFG+AA                                          Q D
Sbjct: 161 DSFYNIKIADFGMAA-----------------------------------------LQTD 179

Query: 363 INYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL 421
            +   +  GSP Y A E++ G  Y+ +  D WS G +LF  L G  PF   + N     L
Sbjct: 180 ADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239

Query: 422 RHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLR 460
           +  K     P  ND  + IS  A +LI + L+ DP  R++
Sbjct: 240 KVQKGQFEMP--ND--TEISRDAQDLIGKILVVDPRQRIK 275

>Scas_493.2
          Length = 1117

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 107/248 (43%), Gaps = 49/248 (19%)

Query: 222 ILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCA 281
           I+   R   ++ L   ++   +LY+ +E+   G+   LL+    L    A  +  ++   
Sbjct: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146

Query: 282 VNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFP 341
           ++  H LG  HRDLKPEN L+D + +IK+ DFG+AA    ++ +E               
Sbjct: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLE--------------- 191

Query: 342 AFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLF 400
                                     +  GSP Y A E++ G  Y  +  D WS G +LF
Sbjct: 192 --------------------------TSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILF 225

Query: 401 EALIGYTPFSGSSTNETYENLRHWKRTLRR-PFLNDGRSAISDRAWELITRLI-ADPINR 458
             L G  PF     +E   N+R+    ++   F       +S  A +LI+R++  DP  R
Sbjct: 226 ALLTGRLPF-----DEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKR 280

Query: 459 LRSFEHVK 466
           +++ E +K
Sbjct: 281 IKTREILK 288

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 93/218 (42%), Gaps = 55/218 (25%)

Query: 242 ESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFL 301
           E L++ +E   GGD    +     +    A+FY  ++  A+N LH++G  HRD+KPEN L
Sbjct: 88  EYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENIL 147

Query: 302 IDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQN 361
           +D +G++KL DFGLA+                               + RRK        
Sbjct: 148 LDKKGNLKLADFGLAS-------------------------------QFRRK------DG 170

Query: 362 DINYANSMVGSPDYMALEVLEGKKYDYTV-DYWSLGCMLFEALIGYTPFSGSS------- 413
            +  +    GSP YMA E+L  + Y   + D WS G +LF  L G  P+S  +       
Sbjct: 171 TLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYE 230

Query: 414 ---TNETYENLRHWKRT-------LRRPFLNDGRSAIS 441
               NE   +L  W+R        LR+    D R  +S
Sbjct: 231 WFVNNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVS 268

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 104/239 (43%), Gaps = 49/239 (20%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +++L   ++    LYL +E+   G+   +L+    L    A     ++   ++  H LG 
Sbjct: 91  VLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGV 150

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+D + +IK+ DFG+AA                              +E 
Sbjct: 151 VHRDLKPENLLLDNKLNIKIADFGMAA------------------------------LES 180

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPF 409
             K+ +           +  GSP Y A E++ G  Y+ ++ D WS G +LF  L G  PF
Sbjct: 181 EDKLLE-----------TSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229

Query: 410 SGSSTNETYENLRHWKRTLRR-PFLNDGRSAISDRAWELITRLI-ADPINRLRSFEHVK 466
                +E   N+R+    +++  F       I+  A +L+ RL+  DP  R+   E +K
Sbjct: 230 -----DEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 102/238 (42%), Gaps = 47/238 (19%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +++L   ++    LYL +E+   G+   LL+    L    A  +  ++   V+  H LG 
Sbjct: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLKPEN L+D + +IK+ DFG+AA                              +E 
Sbjct: 153 VHRDLKPENLLLDHKYNIKIADFGMAA------------------------------LET 182

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPF 409
             K+ +           +  GSP Y A E++ G  Y  +  D WS G +LF  L G  PF
Sbjct: 183 EGKLLE-----------TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231

Query: 410 SGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINRLRSFEHVK 466
                N     L+  K     P  ++    IS  A +LI +++  DP  R+++ + +K
Sbjct: 232 DEEDGNIRTLLLKVQKGEFEMPSDDE----ISREAQDLIRKILTVDPERRIKTRDILK 285

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++  AV   H    
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNI 195

Query: 291 THRDLKPENFLIDAEGH-IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            HRDLKPEN L+D +   IK+ DFG+AA   S++ +E                       
Sbjct: 196 CHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLE----------------------- 232

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTP 408
                             +  GSP Y + E++ G+KY  +  D WS G +LF  L G+ P
Sbjct: 233 ------------------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLP 274

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
           F+  +  +    ++  K  + +         +S  A +LI+R L+ DP  R+
Sbjct: 275 FNDDNVKKLLLKVQSGKYQMPQ--------WLSVEAKDLISRILVVDPNRRI 318

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/298 (25%), Positives = 119/298 (39%), Gaps = 49/298 (16%)

Query: 169 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRS 228
           KDFE+               R + +  +CA                 +  E DI      
Sbjct: 98  KDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDH 157

Query: 229 EWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHEL 288
             ++KL   F D + +YL ME    G+    L N        A  YI ++  A++ +H+ 
Sbjct: 158 PNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKK 217

Query: 289 GYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSI 348
              HRD+KPEN LI  +  +KL DFG +                  + N E         
Sbjct: 218 RIIHRDVKPENVLIGFDNVVKLADFGWS------------------ILNPE--------- 250

Query: 349 EDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTP 408
             +RK              ++ G+ DY++ E++  ++YD  VD W+LG + +E ++G  P
Sbjct: 251 GSKRK--------------TLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPP 296

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVK 466
           F  +S   TY+  R  K  L  P       +IS  A +LI++L+     +  S   VK
Sbjct: 297 FEENSKELTYK--RILKCDLNFP------ESISKDAKDLISKLLVTDTTQRLSLTGVK 346

>Scas_700.28
          Length = 896

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 49/237 (20%)

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++ KL         +++A+E+ PG +    +++   + +       +++   V+  H L 
Sbjct: 90  YITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLN 149

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLK EN L+D  G  KLTDFG     ++   +E                       
Sbjct: 150 CVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLE----------------------- 186

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                             ++ G+  YMA E++E K YD + +D WSLG +L+  + G  P
Sbjct: 187 ------------------TICGTTVYMAPELIERKSYDGFKIDIWSLGVILYTMINGSMP 228

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHV 465
           F     +E  E    WK   + P LN+  + ++  A +LI RL+A   N   + E +
Sbjct: 229 F-----DEDDETKTEWKIVHQTPQLNE--NIVTADAKDLILRLLAKNPNDRPTVEQI 278

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 81/167 (48%), Gaps = 13/167 (7%)

Query: 248  MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
            ME+  GG    LL + R       + Y  ++   +  LHE G  HRD+KPEN L+D  G 
Sbjct: 1344 MEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGV 1403

Query: 308  IKLTDFGLAAGTVSN-ERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYA 366
            IK  DFG A    +N  R+ SM     +++N +        + D + +     +N+ N  
Sbjct: 1404 IKYVDFGAAKKIANNGTRLASMN----KIENADGEHEDVTHVSDSKAV-----KNNENAL 1454

Query: 367  NSMVGSPDYMALEVLEGKKYDYTV---DYWSLGCMLFEALIGYTPFS 410
              M+G+P YMA E + G      +   D WSLGC++ E + G  P++
Sbjct: 1455 LDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWA 1501

>Scas_660.28
          Length = 623

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 109/256 (42%), Gaps = 53/256 (20%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + ME+  G +    ++    +    AR +  
Sbjct: 92  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQ 150

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 190

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
           N+                       D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 191 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 229

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADP 455
           G +L+  L    PF   S    ++N+ +   T+ + FL+ G S +  +       LI +P
Sbjct: 230 GVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPK-FLSQGASTLIKKM------LIVNP 282

Query: 456 INRLRSFEHVKRMNYF 471
           +NR+ S + + +  +F
Sbjct: 283 LNRI-SIQEIMQDEWF 297

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 113/270 (41%), Gaps = 56/270 (20%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 101 EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ 159

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 199

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
                               N+   D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 200 --------------------NI-MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 238

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADP 455
           G +L+  L    PF   S    ++N+ +   TL + FL+ G + +  R       LI +P
Sbjct: 239 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAAGLIKRM------LIVNP 291

Query: 456 INRLRSFEHVKRMNYFHEINFDTLRQLSPP 485
           +NR+ S   + + ++F     D    L PP
Sbjct: 292 LNRI-SIHEIMQDDWF---KVDLPEYLLPP 317

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 104/239 (43%), Gaps = 52/239 (21%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNI 235

Query: 291 THRDLKPENFLIDAEG-HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            HRDLKPEN L+D +   IK+ DFG+AA                    LE P        
Sbjct: 236 CHRDLKPENLLLDKKNRRIKIADFGMAA--------------------LELP-------- 267

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTP 408
              K+ +           +  GSP Y + E++ G+ Y     D WS G +LF  L G+ P
Sbjct: 268 --NKLLK-----------TSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLP 314

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFEHVK 466
           F+  +  +    ++  K  +         S +S  A +LI++ L+ DP  R+ + E +K
Sbjct: 315 FNDDNIKKLLLKVQSGKYQM--------PSNLSSEARDLISKILVIDPEKRITTQEILK 365

>Kwal_55.21545
          Length = 865

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 77/167 (46%), Gaps = 42/167 (25%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           L++ ME+  GG  RTLL   + +   +    + E+  A+  +H+ G  HRD+K  N LI 
Sbjct: 91  LWVIMEYCAGGSLRTLLRPGK-IGEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLIT 149

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
            +GHIKL DFG+AA      ++   KIR                           RQ   
Sbjct: 150 NDGHIKLCDFGVAA------QLSQTKIR---------------------------RQ--- 173

Query: 364 NYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
               +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 174 ----TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 216

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 106/249 (42%), Gaps = 54/249 (21%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQ 143

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 183

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
           N+                       D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 184 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 222

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIAD 454
           G +L+  L    PF   S    ++N+ +   TL + FL+ G S       +LI R LI +
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAS-------DLIKRMLIVN 274

Query: 455 PINRLRSFE 463
           P+NR+   E
Sbjct: 275 PLNRISIHE 283

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 82/172 (47%), Gaps = 42/172 (24%)

Query: 242 ESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALH-ELGYTHRDLKPENF 300
           E +++ +E   GGD    +     + S  A+FY  ++  A+N LH E G  HRD+KPEN 
Sbjct: 89  EYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAINYLHVECGVAHRDIKPENI 148

Query: 301 LIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360
           L+D  G++KL DFGLA    S  R +   +R+              S++ R         
Sbjct: 149 LLDKNGNLKLADFGLA----SQFRRKDGTLRV--------------SMDQR--------- 181

Query: 361 NDINYANSMVGSPDYMALEVL---EGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                     GSP YMA EVL   EG   D T D WS+G +LF  L G TP+
Sbjct: 182 ----------GSPPYMAPEVLYSEEGYYADRT-DIWSIGILLFVLLTGQTPW 222

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 80/181 (44%), Gaps = 42/181 (23%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +VKL    Q+ + + + +E+  GG+F   +   R L+  HA    S++  AV+ +H  G 
Sbjct: 129 IVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGL 188

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D E ++ +TDFG                        EF          
Sbjct: 189 VHRDLKLENLLLDNEENLIITDFGFVN---------------------EF---------- 217

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDY-TVDYWSLGCMLFEALIGYTP 408
                  LRQN +    +  GSP Y A E V+  + YD    D WS G +LF  L GY P
Sbjct: 218 -------LRQNGM--MKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLP 268

Query: 409 F 409
           +
Sbjct: 269 W 269

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 90/202 (44%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAF-QDPESLYLAMEFVPGGDFRTLLINTRT-------LR 267
           I+ E  ++  +R + +V  L A+ +  + L++ MEF+ GG    ++ N+ T       L 
Sbjct: 607 IVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLT 666

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D    +K+TDFG  A          
Sbjct: 667 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCA---------- 716

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                               + D+R           +   +MVG+P +MA EV++ ++YD
Sbjct: 717 -------------------RLTDKR-----------SKRATMVGTPYWMAPEVVKQREYD 746

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             +D WSLG M  E L G  P+
Sbjct: 747 EKIDVWSLGIMTIEMLEGEPPY 768

>Scas_675.2
          Length = 527

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 80/168 (47%), Gaps = 39/168 (23%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE-LGYTHRDLKPENFLI 302
           +++ ME   GGD    +     + S  A+FY  ++  A++ LHE  G  HRD+KPEN L+
Sbjct: 91  MWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENILL 150

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           D  G++KL DFGL+    S  R +   +R+                 D+R          
Sbjct: 151 DKNGNLKLADFGLS----SQYRRKDGTLRIS---------------TDQR---------- 181

Query: 363 INYANSMVGSPDYMALEVLEGKK-YDYTVDYWSLGCMLFEALIGYTPF 409
                   GSP YMA E+L  +  Y ++ D WS+G +LF  L G TP+
Sbjct: 182 --------GSPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPW 221

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 80.5 bits (197), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 89/204 (43%), Gaps = 50/204 (24%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQ-DPESLYLAMEFVPGGDFRTLL-----INTRTLRSP 269
           I+ E  ++  +R E +V  L A+  D E L++ ME++ GG    +L      NT    SP
Sbjct: 419 IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSP 478

Query: 270 ----HARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERI 325
                  + + E    +  LH     HRD+K +N L++++G +K+TDFG           
Sbjct: 479 LNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFG----------- 527

Query: 326 ESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK 385
                            F  +  E R K              +MVG+P +MA E++  K 
Sbjct: 528 -----------------FCVELTEKRSK------------RATMVGTPYWMAPEIVNQKG 558

Query: 386 YDYTVDYWSLGCMLFEALIGYTPF 409
           YD  VD WSLG ML E + G  P+
Sbjct: 559 YDEKVDVWSLGIMLIEMIEGEPPY 582

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 100/231 (43%), Gaps = 53/231 (22%)

Query: 220 RDILTTTRSEW---LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           R+++  TR      +V++L      E L++AME   GGD    +     + S  ARFY  
Sbjct: 64  REVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQ 123

Query: 277 EMFCAVNALHE-LGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
           ++  A+  LHE  G  HRD+KPEN L+D  G++K+ DFGLA      +    +       
Sbjct: 124 QLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLA------ 177

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDY-TVDYWS 394
                         DRR                  G+  Y+A EV+  + Y   T D WS
Sbjct: 178 -------------RDRR------------------GTLPYLAPEVVGERAYHADTADIWS 206

Query: 395 LGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAW 445
            G ++F  L G TP+S  S ++           + R F+ DG + +SD  W
Sbjct: 207 AGVLVFVLLTGETPWSEPSVDD----------GMFRAFVADGGN-LSDGPW 246

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 75/165 (45%), Gaps = 33/165 (20%)

Query: 248  MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
            ME+  GG   +LL + R       + Y  +M   +  LHE G  HRD+KPEN L+D  G 
Sbjct: 1269 MEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGI 1328

Query: 308  IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
            IK  DFG A    SN    S K+ LE+  ++E                            
Sbjct: 1329 IKYVDFGAAKVLASN---GSKKLNLEQ--HME--------------------------GE 1357

Query: 368  SMVGSPDYMALEVLEGKKYDY--TVDYWSLGCMLFEALIGYTPFS 410
             M+G+P YM+ E + G  Y    + D WSLGC++ E + G  P++
Sbjct: 1358 KMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWA 1402

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 77/181 (42%), Gaps = 42/181 (23%)

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++ KL         +++ +E+  G +    L+  + L    ++   S++  AV   HEL 
Sbjct: 89  YITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELK 148

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLK EN L+D  GH KLTDFG      +  ++E                       
Sbjct: 149 CVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLE----------------------- 185

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                             ++ G+  YMA E++E K YD + VD WSLG +L+  + GY P
Sbjct: 186 ------------------TICGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMP 227

Query: 409 F 409
           F
Sbjct: 228 F 228

>Kwal_26.7788
          Length = 1267

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 92/219 (42%), Gaps = 52/219 (23%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           L+L +E+V GG+    L++   L    A  Y  ++       H     HRDLKPEN L+D
Sbjct: 132 LFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCHGFNICHRDLKPENLLLD 191

Query: 304 AEG-HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
            +   IK+ DFG+AA   SN+ +E                                    
Sbjct: 192 KKNKRIKIADFGMAALQTSNKLLE------------------------------------ 215

Query: 363 INYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL 421
                +  GSP Y + E++ GK Y+    D WS G +LF  L G+ PF+  +       +
Sbjct: 216 -----TSCGSPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKV 270

Query: 422 RHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
           +  K  + +        ++S  A +LI+R L+ DP  R+
Sbjct: 271 QAGKYQMPQ--------SVSSGAQDLISRILVVDPDKRI 301

>Kwal_47.18233
          Length = 598

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 132/325 (40%), Gaps = 75/325 (23%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 77  EREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 135

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 175

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
           N+                       D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 176 NI---------------------MTDGNFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSS 214

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIAD 454
           G +L+  L    PF   S    ++N+ +   TL + FL+ G       A  LI R LI +
Sbjct: 215 GVILYVMLCRRLPFDDESIPVLFKNISNGIYTLPK-FLSPG-------AANLIKRMLIVN 266

Query: 455 PINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYADV 514
           P+NR+ +   + +  +F     D    L PP               D  NEA+   +   
Sbjct: 267 PLNRI-TIHEIMQDEWF---KVDMQDYLIPP---------------DLKNEAENHGHDGE 307

Query: 515 FKRQDKLAAMVDDSEVD--SKLIGF 537
            + Q+     VDDS V   SK +G+
Sbjct: 308 QQGQNDAEEEVDDSLVTMLSKTMGY 332

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINTRT-------LR 267
           I+ E  ++  ++   +V  L A+   E  L++ ME++ GG    ++ N+ T       L 
Sbjct: 644 IVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLT 703

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D  G +K+TDFG  A          
Sbjct: 704 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFGFCA---------- 753

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                               + D+R           +   +MVG+P +MA EV++ ++YD
Sbjct: 754 -------------------KLTDKR-----------SKRATMVGTPYWMAPEVVKQREYD 783

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             VD WSLG M  E L    P+
Sbjct: 784 EKVDVWSLGIMTIEMLESEPPY 805

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 102/244 (41%), Gaps = 38/244 (15%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESL-----YLAMEFVPGGDFRTLLINTRTLRSPHARF 273
           E +IL   +   +V LL +F +P S      YL +E +  G+    ++    LR   ++ 
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
              ++   +  LHE    HRD+KPEN L++                           R E
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNI-------------------------TRRE 342

Query: 334 EVKNLEFPAFTEKSIEDRRKIYQ-NLRQ--NDINYANSMVGSPDYMALEVLEGKKYDYTV 390
               ++   + E  I+ + KI    L +   ++ + N++ G+P Y+A EVL  K Y   V
Sbjct: 343 NPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTSKV 402

Query: 391 DYWSLGCMLFEALIGYTPFSGSSTNETY-ENLRHWKRTLRRPFLNDGRSAISDRAWELIT 449
           D WS G +L+  L G+ PFS      +  E +   K     P+ +     I D    LI+
Sbjct: 403 DLWSAGVILYVCLCGFPPFSDQLGPPSLKEQILQAKYAFYSPYWD----KIDDSVLHLIS 458

Query: 450 RLIA 453
            L+ 
Sbjct: 459 NLLV 462

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 82/328 (25%), Positives = 138/328 (42%), Gaps = 71/328 (21%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 143

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 183

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
           N+                       D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 184 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 222

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITR-LIAD 454
           G +L+  L    PF   S    ++N+ +   ++ + FL+ G       A  LI R LI +
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISNGVYSIPK-FLSQG-------AANLIKRMLIVN 274

Query: 455 PINRLRSFEHVKRMNYFHEINFDTLRQLS-PPFTPQLDNETDA----GYFDDFTNEADMA 509
           P+NR+            HEI  D   ++  P +   +D + DA    G  D+  +EA +A
Sbjct: 275 PLNRIT----------IHEIMEDEWFKVDLPDYLVPVDMKADATSKPGTDDERIDEALVA 324

Query: 510 KYADV--FKRQDKLAAMVDDSEVDSKLI 535
             A+   + + +   A+ D ++ D  ++
Sbjct: 325 VLANTMSYDKDEIYEALEDPNQTDPTVL 352

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 105/248 (42%), Gaps = 52/248 (20%)

Query: 219 ERDI--LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYIS 276
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 81  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQ 139

Query: 277 EMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVK 336
           ++  AV+  H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 179

Query: 337 NLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY-DYTVDYWSL 395
           N+                       D N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 180 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 218

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADP 455
           G +L+  L    PF   S    ++N+ +   T+   FL+ G +++  +       LI +P
Sbjct: 219 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPN-FLSQGAASLIKKM------LIVNP 271

Query: 456 INRLRSFE 463
           +NR+   E
Sbjct: 272 VNRITVHE 279

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 74/166 (44%), Gaps = 27/166 (16%)

Query: 248  MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
            ME+  GG   +LL + R       + Y  E+   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1112 MEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGI 1171

Query: 308  IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
            IK  DFG A   V +        R   V+N    A  +  +E +               N
Sbjct: 1172 IKYVDFGTARTVVGS--------RTRTVRN---AAVQDFGVETKS-------------LN 1207

Query: 368  SMVGSPDYMALEVLEGKKYDYTV---DYWSLGCMLFEALIGYTPFS 410
             M+G+P YMA E + G      +   D W+LGC++ E   G  P+S
Sbjct: 1208 EMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWS 1253

>Kwal_23.5290
          Length = 819

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINTRT-------LR 267
           I+ E  ++  ++ + +V  L A+   E  L++ ME++ GG    L+ N+         L 
Sbjct: 584 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLT 643

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D    +K+TDFG  A          
Sbjct: 644 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFGFCA---------- 693

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                               + D+R           +   +MVG+P +MA EV++ ++YD
Sbjct: 694 -------------------KLTDKR-----------SKRATMVGTPYWMAPEVVKQREYD 723

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             VD WSLG M  E L G  P+
Sbjct: 724 EKVDVWSLGIMTIEMLEGEPPY 745

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 81/194 (41%), Gaps = 43/194 (22%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I++E D+L       +VK     Q   +LY+ +E+   G  + L+   R +    A+ Y+
Sbjct: 64  IMSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYV 123

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            +    +N LHE G  HRD+K  N L+D+E  +KL DFG+           S K+     
Sbjct: 124 RQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLADFGV-----------STKVN---- 168

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                       N A ++ GS ++MA E++  +      D WSL
Sbjct: 169 ----------------------------NTAMTLAGSLNWMAPEIIGNRGASTLSDIWSL 200

Query: 396 GCMLFEALIGYTPF 409
           G  + E L G  PF
Sbjct: 201 GATVVELLTGNPPF 214

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 64/279 (22%), Positives = 115/279 (41%), Gaps = 33/279 (11%)

Query: 188 ARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPES---- 243
           AR ++T E  A              T     E  IL + +   +VKL+  F +P S    
Sbjct: 118 ARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQI 177

Query: 244 -LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
             YL +E +  G+    ++    LR    +    ++   +  LH     HRD+KPEN L+
Sbjct: 178 QTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILL 237

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
                 + +   +A G   ++ ++ +++++ +    +F                     +
Sbjct: 238 SISK--RRSPEEIALGPWDDDELD-IQVKIADFGLAKFTG-------------------E 275

Query: 363 INYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGS-STNETYENL 421
           + + N++ G+P Y+A EVL    Y   VD WS G +L+  L G+ PFS   +     E +
Sbjct: 276 MKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQI 335

Query: 422 RHWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINRL 459
              K     P+ ++    I D    LI+  L+ +P +R 
Sbjct: 336 LQGKFAFYSPYWDN----IDDSVLHLISNLLVVNPASRF 370

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 78.2 bits (191), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 89/202 (44%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINT-------RTLR 267
           I+ E  ++  ++ + +V  L A+   E  L++ ME++ GG    ++ N+         + 
Sbjct: 558 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMT 617

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D  G +K+TDFG  A          
Sbjct: 618 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFGFCA---------- 667

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                               + D+R           +   +MVG+P +MA EV++ ++YD
Sbjct: 668 -------------------KLTDKR-----------SKRATMVGTPYWMAPEVVKQREYD 697

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             VD WSLG M  E L G  P+
Sbjct: 698 EKVDVWSLGIMTIEMLEGEPPY 719

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 78.2 bits (191), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 75/168 (44%), Gaps = 42/168 (25%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
           SL++ ME+  GG  R+LL   + +   +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 87  SLWIIMEYCAGGSLRSLLRPGK-IDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLI 145

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
             EG +KL DFG+AA      ++    +R                           RQ  
Sbjct: 146 TNEGQVKLCDFGVAA------QLNQTSLR---------------------------RQ-- 170

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 171 -----TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/297 (23%), Positives = 109/297 (36%), Gaps = 71/297 (23%)

Query: 188 ARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESL--- 244
           A+ + T E  A             +      E  IL       +V LL +F +P S    
Sbjct: 210 AKNKTTGETVAVKIFHPQQNDDQKKNKQFREETTILMKIHHPNIVNLLDSFVEPISKTQI 269

Query: 245 --YLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
             YL +E +  G+    ++   +L    ++    ++   +  LH     HRD+KPEN L+
Sbjct: 270 QKYLVLEKIDDGELFDRIVKKTSLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILL 329

Query: 303 -------------------DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAF 343
                              + +  +K+ DFGLA  T                        
Sbjct: 330 NIRRRQSPDERQLGPWDEDEIDIQVKIADFGLAKFT------------------------ 365

Query: 344 TEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEAL 403
                             ++ + N++ G+P Y+A EVL  K Y   VD WS G +L+  L
Sbjct: 366 -----------------GEMQFTNTLCGTPSYVAPEVLVKKGYTSKVDLWSAGVILYVCL 408

Query: 404 IGYTPFSGSSTNETY-ENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIA-DPINR 458
            G+ PFS      +  E +   K     P+ ++    I D A  LI+ L+  DP NR
Sbjct: 409 CGFPPFSDQLGPPSLKEQIMSAKYAFYSPYWDE----IDDAALHLISNLLVLDPENR 461

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 87/201 (43%), Gaps = 48/201 (23%)

Query: 215 HILTERDILTTTRSEWLVKLLYAFQDPE--SLYLAMEFVPGGDFRTL---LINTRTLRSP 269
            +L E     + +SE++V+    F D +  S+Y+AME++ G     +   L++     S 
Sbjct: 223 QLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISE 282

Query: 270 HARFYISEMFC-AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESM 328
                ISE     ++ LHE    HRD+KP+N L++ +G +KL DFG     VS E + S+
Sbjct: 283 KVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFG-----VSGEAVNSL 337

Query: 329 KIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDY 388
                                                A +  G+  YMA E ++G+ Y  
Sbjct: 338 -------------------------------------ATTFTGTSYYMAPERIQGQPYSV 360

Query: 389 TVDYWSLGCMLFEALIGYTPF 409
           T D WSLG  + E   G+ PF
Sbjct: 361 TCDVWSLGLTILEVAQGHFPF 381

>Scas_668.22
          Length = 893

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 84/194 (43%), Gaps = 41/194 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I+ E  ++  +R   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 653 IINEILVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 711

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ E+
Sbjct: 712 RETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCA-------------QINEI 758

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 759 ---------------------NLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 791

Query: 396 GCMLFEALIGYTPF 409
           G M+ E + G  P+
Sbjct: 792 GIMIIEMIEGEPPY 805

>Scas_598.6
          Length = 790

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINTRT-------LR 267
           I+ E  ++  +R + +V  L A+   E  L++ MEF+ GG    ++ N+         L 
Sbjct: 555 IVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLT 614

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            P   + + E    +  LH+    HRD+K +N L+D    +K+TDFG             
Sbjct: 615 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFG------------- 661

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
                          F  K  + R K              +MVG+P +MA EV++ ++YD
Sbjct: 662 ---------------FCAKLTDQRSK------------RATMVGTPYWMAPEVVKQREYD 694

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
             VD WSLG M  E L    P+
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPY 716

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 83/194 (42%), Gaps = 41/194 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           IL E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 ILNEILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSL-TDVVTHCLLSEGQIGAVC 720

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +  LH  G  HRD+K +N L+  +G+IKLTDFG  A    N             
Sbjct: 721 RETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN------------- 767

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 768 ---------------------NLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 396 GCMLFEALIGYTPF 409
           G M+ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 87/222 (39%), Gaps = 47/222 (21%)

Query: 188 ARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLA 247
           A KR T + CA             E N  + E D+L   R + +V+     Q    LY+ 
Sbjct: 27  AVKRGTNKPCAIKQIEFEDES---ELNEHMLEIDLLKNLRHQNIVEYRGFIQKAHELYII 83

Query: 248 MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
           +E+   G  R +L +   L       Y+++    +  LHE G  HRD+K  N L+  EG 
Sbjct: 84  LEYCARGSLRDILKHGPLLEDDTVN-YVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGI 142

Query: 308 IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
           +KL DFG++       RI  M                                     A 
Sbjct: 143 VKLADFGVST------RINRM-------------------------------------AM 159

Query: 368 SMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
           +  GSP++MA EV+ G+      D WSLG  + E L G  PF
Sbjct: 160 TYAGSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPF 201

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 19/174 (10%)

Query: 237 AFQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDL 295
           AFQ+  + Y L  E V GG+    ++         AR  I+++  A+  +H +G  HRD+
Sbjct: 201 AFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDV 260

Query: 296 KPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIY 355
           KPEN L +      +  +GL  G +  E   ++ +    +  ++   F          + 
Sbjct: 261 KPENLLFEP-----IPFYGLD-GDMQKEDEFTLGVGGGGIGLVKLMDF---------GLA 305

Query: 356 QNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
           + LR N    A +  G+ +Y+A EV   K+Y   VD WS+GC+LF  L GY PF
Sbjct: 306 KKLRNNT---AKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFTLLCGYPPF 356

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 87/182 (47%), Gaps = 42/182 (23%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE-LGYTHRDLKPENFLI 302
           L++AME   GGD    +     + S  A+FY  ++  A++ LH+  G  HRD+KPEN L+
Sbjct: 91  LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDTCGVAHRDIKPENILL 150

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           D +G++KL DFGLA+                         F  K  +  ++I ++ R   
Sbjct: 151 DKDGNLKLADFGLAS------------------------LFKRK--DGSKRISRDQR--- 181

Query: 363 INYANSMVGSPDYMALEVL--EGKKYDYTVDYWSLGCMLFEALIGYTPFS-GSSTNETYE 419
                   GS  YMA E++  +G   D T D WS+G +LF  L G TP+      +ET+ 
Sbjct: 182 --------GSLPYMAPEIIYCDGYYADMT-DIWSIGVLLFVLLTGETPWELPHEDDETFR 232

Query: 420 NL 421
           N 
Sbjct: 233 NF 234

>Scas_618.15
          Length = 620

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 89/228 (39%), Gaps = 32/228 (14%)

Query: 245 YLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDA 304
           Y+  E++ GG+    ++          R  I ++  AV  LH +G  HRD+KPEN L + 
Sbjct: 253 YIVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIKPENLLFEP 312

Query: 305 EGHIKLTDFGLAAGTVSNERIESMKIR-------LEEVKNLEFPAFTEKSIEDRRKIYQN 357
             HI  T   L        +++    R       +  VK  +F    + S E        
Sbjct: 313 IQHIPSTHVKLRKTDNPFTKVDEGMFRPAIGGGGIGAVKLTDFGLSKQLSTET------- 365

Query: 358 LRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNET 417
                    N+  G+  Y A E++   +YD  +D W +GC+L+  L G+ PF        
Sbjct: 366 --------TNTPCGTISYAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHKSV 417

Query: 418 YENLRHWKRTLRRPFLNDGRSAISDRAWEL----------ITRLIADP 455
              +RH +     P+ ++  S   +    L          I  L+ADP
Sbjct: 418 TRKIRHGEYHFLSPWWDEISSGAKNCVKHLLEVDVSKRYNIDDLLADP 465

>Scas_720.94
          Length = 1683

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 99/222 (44%), Gaps = 27/222 (12%)

Query: 248  MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
            ME+  GG   +LL + R       + Y  E+   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1439 MEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGI 1498

Query: 308  IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
            IK  DFG A     N           +V N+   +  +   +++        +   N  +
Sbjct: 1499 IKYVDFGAARKIAKNG---------TKVTNINSKSKDDDEPDEKDT------EGGANSVH 1543

Query: 368  SMVGSPDYMALEVLEGKKYDYTV---DYWSLGCMLFEALIGYTPFSGSSTNETYENLRHW 424
             M+G+P YMA E + G K        D WS GC++ E + G  P+  ++ +  +  + H 
Sbjct: 1544 DMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPW--ANLDNEWAIIYHV 1601

Query: 425  K--RTLRRPFLNDGRSAISDRAWELITR-LIADPINRLRSFE 463
               +T + P+ N+    +S      + R L+ DPI R  + E
Sbjct: 1602 AAGQTPQLPYPNE----VSPAGRRFLQRCLVQDPIKRATAVE 1639

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 100/273 (36%), Gaps = 71/273 (26%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPES-----LYLAMEFVPGGDFRTLLINTRTL 266
           +T     E  IL     E +VKLL  F +P S      YL +E +  G+    ++    L
Sbjct: 196 KTRQFREETKILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKL 255

Query: 267 RSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI-------------------DAEGH 307
                R    ++   +  LH+    HRD+KPEN L+                   + +  
Sbjct: 256 HQDETRALFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDIT 315

Query: 308 IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
           +K+ DFGLA  T                                          ++ +  
Sbjct: 316 VKIADFGLAKFT-----------------------------------------GEMQFTT 334

Query: 368 SMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGS-STNETYENLRHWKR 426
           ++ G+P Y+A EVL    Y   VD WS G +L+  L G+ PFS   +     E +   K 
Sbjct: 335 TLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQGKF 394

Query: 427 TLRRPFLNDGRSAISDRAWELITR-LIADPINR 458
               P+ ++    I D    LI+  L+ DP  R
Sbjct: 395 AFYSPYWDE----IDDSVLHLISNLLVVDPAKR 423

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 85/194 (43%), Gaps = 41/194 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I+ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 IINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 720

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +  LH  G  HRD+K +N L+  EG IKLTDFG  A             ++ E+
Sbjct: 721 RETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA-------------QINEL 767

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 768 ---------------------NLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 396 GCMLFEALIGYTPF 409
           G M+ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 75/168 (44%), Gaps = 42/168 (25%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
           SL++ ME   GG  R+LL   + +   +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 94  SLWIIMEHCAGGSLRSLLRPGK-IDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLI 152

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
             EG++KL DFG+AA      ++    +R                           RQ  
Sbjct: 153 TNEGNVKLCDFGVAA------QVNQTSLR---------------------------RQ-- 177

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 178 -----TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPY 220

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 93/224 (41%), Gaps = 49/224 (21%)

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++ KL         +++A+E+ PG +    L+  + +     R   +++  AV   H L 
Sbjct: 89  FITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFAQIVSAVFYAHSLQ 148

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLK EN L+D  G+  LTDFG         R  + K +LE V              
Sbjct: 149 CVHRDLKLENILLDKNGYAMLTDFGFT-------RECATKTQLETV-------------- 187

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                                G+  YMA E+++ + YD Y VD WSLG +L+  L GY P
Sbjct: 188 --------------------CGTTVYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMP 227

Query: 409 FSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI 452
           F    T  T   + H       P + D     S +A +LI RL+
Sbjct: 228 FDEDDTVRTGLKIMH-----EEPAVLD--EYTSPQAKDLIVRLL 264

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 71/165 (43%), Gaps = 30/165 (18%)

Query: 248  MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGH 307
            MEF  G    +LL + R       + Y  ++   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1337 MEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGV 1396

Query: 308  IKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYAN 367
            IK  DFG A     N    S +I L+                           N      
Sbjct: 1397 IKYVDFGAAKLIAKN---GSKRISLDA-------------------------NNKSTGGK 1428

Query: 368  SMVGSPDYMALEVLEGKKYDY--TVDYWSLGCMLFEALIGYTPFS 410
             M+G+P YMA E + G+ +    + D WSLGC++ E + G  P++
Sbjct: 1429 DMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWA 1473

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 78/181 (43%), Gaps = 42/181 (23%)

Query: 230 WLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++ KL         +++A+E+ PG +    L++   L +       +++  AV+  H L 
Sbjct: 94  YITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLN 153

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLK EN L+D  G+ KLTDFG    +++   +E                       
Sbjct: 154 CVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLE----------------------- 190

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                             ++ G+  YMA E+++ K YD + VD WSLG +L+  L G  P
Sbjct: 191 ------------------TVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLP 232

Query: 409 F 409
           F
Sbjct: 233 F 233

>Kwal_14.2497
          Length = 418

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 78/176 (44%), Gaps = 39/176 (22%)

Query: 248 MEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHE-LGYTHRDLKPENFLIDAEG 306
           ME   GGD    +     + S  ARFY  ++  A++ LH   G  HRD+KPEN L+D  G
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 307 HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYA 366
           ++KL DFGLA+                         F  K  +  ++I  + R       
Sbjct: 61  NLKLADFGLAS------------------------QFKRK--DGSKRIMSDTR------- 87

Query: 367 NSMVGSPDYMALEVLEGKK-YDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL 421
               GS  YMA E++  K  Y  + D WS G ++F  L G TP+   S +  +++ 
Sbjct: 88  ----GSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWDSPSDDSRFDDF 139

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 93/211 (44%), Gaps = 39/211 (18%)

Query: 242 ESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFL 301
           E++YL  E +   D + + IN + L   H ++++ ++  A+ +LH     HRDLKP N L
Sbjct: 88  EAVYLVQELM-ETDLQKI-INQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLL 145

Query: 302 IDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQN 361
           +++   +K+ DFGLA    S+++                                  R+N
Sbjct: 146 LNSNCDLKVCDFGLARCLASSDQS---------------------------------REN 172

Query: 362 DINYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
            + +    V +  Y A E+ L  ++Y   +D WS GC+L E ++G   F G    + +  
Sbjct: 173 MVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPG---KDYHHQ 229

Query: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           L      L  P L D     S RA E I++L
Sbjct: 230 LWIILEVLGSPTLEDFEQIKSKRAKEYISQL 260

>Kwal_26.8751
          Length = 848

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 92/223 (41%), Gaps = 49/223 (21%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           +++A+E+ PG +    L+  + +         S++  AV   H +   HRDLK EN L+D
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHRDLKLENILLD 162

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
            +GH KLTDFG      +   +E                                     
Sbjct: 163 KKGHAKLTDFGFTRECATKGILE------------------------------------- 185

Query: 364 NYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
               ++ G+  YMA E++E K Y+ Y +D WSLG +L+  + G  PF      +T   + 
Sbjct: 186 ----TICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIV 241

Query: 423 HWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHV 465
           H+  T    + ND    I     ELI++L+    N+  S   V
Sbjct: 242 HYNPT----YDND---YIDSNGKELISQLLEKDPNQRPSLTQV 277

>Kwal_23.3590
          Length = 499

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/289 (23%), Positives = 118/289 (40%), Gaps = 34/289 (11%)

Query: 188 ARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPES---- 243
           A  +D+ +V A             +T     E  IL + + + +VKL+  F +P S    
Sbjct: 203 AIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKLIDRFVEPVSKAQI 262

Query: 244 -LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
             +L +E V  G+    ++    LR         ++   +  LH     HRD+KPEN L+
Sbjct: 263 QTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILL 322

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
                    +  L  G   ++ I+ + I++ +    +F                     +
Sbjct: 323 SIRKRRHSDEQQL--GPWDDDEID-ITIKIADFGLAKFIG-------------------E 360

Query: 363 INYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGS-STNETYENL 421
           + + N++ G+P Y+A EVL    Y   VD WS G +L+  L G+ PFS   +     E +
Sbjct: 361 MQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQI 420

Query: 422 RHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKRMNY 470
            + K     P+ +D    I D    LI+ L+   +N    F+  K +N+
Sbjct: 421 LNGKFAFYSPYWDD----IDDSCLHLISNLLV--VNPAYRFDVQKTINH 463

>Kwal_27.9763
          Length = 868

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 80/195 (41%), Gaps = 45/195 (23%)

Query: 215 HILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFY 274
           H+L E D+L   + E +VK     Q    L++ +E+   G  R L I    +     + Y
Sbjct: 65  HML-EIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSLRDL-IKRGPVEEQQCKTY 122

Query: 275 ISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE 334
           I +    +  LH+ G  HRD+K  N L+DA+  +KL DFG++                  
Sbjct: 123 IRQTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGVST----------------- 165

Query: 335 VKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWS 394
                                   R N  N A +  GSP++MA EV+ G+      D WS
Sbjct: 166 ------------------------RVN--NLAMTYAGSPNWMAPEVMMGQGASTVSDIWS 199

Query: 395 LGCMLFEALIGYTPF 409
           LG  + E L G  PF
Sbjct: 200 LGATVVEILTGNPPF 214

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 99/233 (42%), Gaps = 28/233 (12%)

Query: 238 FQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLK 296
           FQ+ E  Y +  E + GG+    ++         +R  I ++  AV  +H+LG  HRD+K
Sbjct: 211 FQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLSRHVIRQLANAVKYMHQLGIVHRDIK 270

Query: 297 PENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE-------VKNLEFPAFTEKSIE 349
           PEN L +    I      L +    + +++    R          VK  +F         
Sbjct: 271 PENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPGIGGGGIGVVKLADFGL------- 323

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
             ++IYQ           +  G+  Y A EV++ ++Y   VD W +GC+L+  L G+ PF
Sbjct: 324 -SKQIYQT-------NTKTPCGTVGYTAPEVVKDERYSMQVDMWGVGCVLYTVLCGFPPF 375

Query: 410 SGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINRLRS 461
                +   E +   + T  RP+ +     ISD A   + +L+  DP  R  S
Sbjct: 376 FDEKIDVLTEKISRGEYTFLRPWWDQ----ISDGAKNCVRKLLEVDPAKRYTS 424

>Scas_580.6
          Length = 1015

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 75/168 (44%), Gaps = 42/168 (25%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
           SL++ ME+  GG  R+LL   + +   +    + E+  A+  +H+    HRD+K  N LI
Sbjct: 108 SLWIIMEYCAGGSLRSLLRPGK-IDEKYIGVIMRELLVALKYIHKDNVIHRDIKAANVLI 166

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
             EG +KL DFG+AA      ++    +R                           RQ  
Sbjct: 167 TNEGSVKLCDFGVAA------QLNQSTLR---------------------------RQ-- 191

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 192 -----TMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 234

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 88/223 (39%), Gaps = 43/223 (19%)

Query: 187 LARKRDTKEVCAXXXXXXXXXXXXXETNHILTERDILTTTRSEWLVKLLYAFQDPESLYL 246
           L+  R  K  C              E   I+ E  ++++++ + +V  + ++     L++
Sbjct: 582 LSHSRSDKSQCVAIKQMNLEKQPKKEL--IVNEIMVMSSSKHQNIVNYIDSYLSGLDLWV 639

Query: 247 AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEG 306
            ME++ GG   T ++    L          E+   +  LH  G  HRD+K +N L+   G
Sbjct: 640 VMEYMEGGCL-TDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLLSMNG 698

Query: 307 HIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYA 366
            IKLTDFG  A                                           + +   
Sbjct: 699 DIKLTDFGFCAQV----------------------------------------NDTVIKR 718

Query: 367 NSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
            +MVG+P +MA E++  K+Y   VD WSLG M+ E + G  P+
Sbjct: 719 TTMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 761

>Kwal_26.7861
          Length = 955

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 110/269 (40%), Gaps = 47/269 (17%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I+ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 709 IINEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSL-TDVVTHCILTEGQIGAVS 767

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ E+
Sbjct: 768 RETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCA-------------QINEI 814

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 815 ---------------------NLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 847

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADP 455
           G M+ E + G  P+     NET     +   T   P L D  S   D    L   L  +P
Sbjct: 848 GIMIIEMIEGEPPY----LNETPLRALYLIATNGTPELKDADSLSDDLKSFLGWCLHVNP 903

Query: 456 INRLRSFEHVKRMNYFHEINFDTLRQLSP 484
             R  + + +   + F     D +R L+P
Sbjct: 904 DERATASQLLS--DPFISTYADHVRSLAP 930

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 101/243 (41%), Gaps = 45/243 (18%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I+ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 740 IVNEILVMKGSKHNNIVNFIDSYLFRGDLWVVMEYMEGGSL-TDVVTHCILTEGQIGAVS 798

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ EV
Sbjct: 799 RETLKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCA-------------QINEV 845

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 846 ---------------------NLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 878

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADP 455
           G M+ E + G  P+     NET     +   T   P L D  +     A  L   L+ DP
Sbjct: 879 GIMIIEMIEGEPPY----LNETPLRALYLIATNGTPKLKDPGNLSHKMAMFLNWCLMVDP 934

Query: 456 INR 458
            +R
Sbjct: 935 EDR 937

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/189 (28%), Positives = 75/189 (39%), Gaps = 44/189 (23%)

Query: 221 DILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFC 280
           D+L   + E +VK     Q    LY+ +E+   G  R L I    L    A+ Y+ +   
Sbjct: 66  DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDL-IKKEALSEAKAKTYVRQTLR 124

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            +  LH+ G  HRD+K  N L+   G +KL DFG++                        
Sbjct: 125 GLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGVST----------------------- 161

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLF 400
                             R N  N A +  GSP++MA EV+ GK      D WSLG  + 
Sbjct: 162 ------------------RVN--NMAMTYAGSPNWMAPEVMLGKGASTVSDIWSLGATVV 201

Query: 401 EALIGYTPF 409
           E L G  PF
Sbjct: 202 ELLTGNPPF 210

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 86/194 (44%), Gaps = 41/194 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I+ E  ++  +R   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 725 IINEILVMKGSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIAAVS 783

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    ++ LH  G  HRD+K +N L+  +G+IKLTDFG  A             ++ E 
Sbjct: 784 RETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCA-------------QINET 830

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                NL++       +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 831 ---------------------NLKR------TTMVGTPYWMAPEVVSRKEYGPKVDIWSL 863

Query: 396 GCMLFEALIGYTPF 409
           G M+ E + G  P+
Sbjct: 864 GIMIIEMIEGEPPY 877

>Kwal_23.6325
          Length = 1542

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 70/166 (42%), Gaps = 30/166 (18%)

Query: 246  LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAE 305
            L ME+  GG    LL + R       + Y  +M   +  LH+    HRD+KPEN L+D  
Sbjct: 1325 LFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFN 1384

Query: 306  GHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINY 365
            G IK  DFG A    +N                + P    +   D               
Sbjct: 1385 GVIKYVDFGAARSLAAN--------------GTKAPNVGAEGKADG-------------- 1416

Query: 366  ANSMVGSPDYMALEVLEGKKYDY--TVDYWSLGCMLFEALIGYTPF 409
             NSM+G+P YM+ E + G K     + D WSLGC++ E + G  P+
Sbjct: 1417 VNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPW 1462

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 104/251 (41%), Gaps = 53/251 (21%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +L+  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 198 FYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMIS 257

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
           + G IK+ DFGL+                              +I D RK          
Sbjct: 258 SSGEIKIIDFGLS------------------------------NIFDYRK---------- 277

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              ++  GS  + A E+L+ + Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 278 -QLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKIK 336

Query: 423 HWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINR--LRSFEHVKRMNYFHEINFDTL 479
             K         D  S +S     L+TR+I  DP+ R  L++      MN  ++    + 
Sbjct: 337 KGKV--------DYPSHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNRGYDFKAPSY 388

Query: 480 RQLSPPFTPQL 490
                P TP++
Sbjct: 389 VPNRVPLTPEM 399

>Scas_673.20*
          Length = 758

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 81/194 (41%), Gaps = 41/194 (21%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I TE  +L   +   ++  + ++   ++L++ ME++ GG    + ++  T          
Sbjct: 523 IWTEMLVLKEYQHPNIINFINSYLLHDTLWIVMEYMDGGSLADI-VSFFTPTEEQMATIC 581

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            E    +N LH  G  HRD+K +N L+   G IK+TDFG                     
Sbjct: 582 RETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFCG------------------ 623

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                   TE + +                  +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 624 ------QLTESNTK----------------RTTMVGTPYWMAPEVIASKEYGPKVDVWSL 661

Query: 396 GCMLFEALIGYTPF 409
           G M+ E + G  P+
Sbjct: 662 GIMIIEMIEGEPPY 675

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 82/191 (42%), Gaps = 37/191 (19%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E +IL     E +V    + Q+  +L + +E+VPGG   ++L N      P  + +  ++
Sbjct: 518 EMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGPFDEPLVKNFTRQI 577

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
              +  LH+    HRD+K  N LID +G +K+TDFG++                      
Sbjct: 578 LIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGIS---------------------- 615

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCM 398
                  K +    K  QN R        S+ GS  +MA EV++        D WS+GC+
Sbjct: 616 -------KKLSPLNK-QQNKRA-------SLQGSVYWMAPEVVKQVVTTEKADIWSVGCV 660

Query: 399 LFEALIGYTPF 409
           + E   G  PF
Sbjct: 661 IVEMFTGKHPF 671

>Scas_477.5
          Length = 703

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 91/225 (40%), Gaps = 48/225 (21%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E ++L     E +V    + Q+  +L + +E+VPGG   ++L N           +I ++
Sbjct: 491 EMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGPFEESLIVNFIRQV 550

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
              V  LH     HRD+K  N LID +G +K+TDFG++                      
Sbjct: 551 LIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGISK--------------------- 589

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCM 398
                +  S +D+R               S+ GS  +MA EV++        D WS GC+
Sbjct: 590 ---KLSPLSKQDKRA--------------SLQGSVYWMAPEVVKQTATTEKADIWSTGCV 632

Query: 399 LFEALIGYTPFSGSS---------TNETYENLRHWKRTLRRPFLN 434
           + E   G  PF   S         TN T E +  W   L + FL+
Sbjct: 633 VIEMFTGKHPFPDFSQMQTIFKIGTNTTPE-VPSWASDLGKDFLS 676

>Scas_613.5
          Length = 517

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/260 (23%), Positives = 98/260 (37%), Gaps = 70/260 (26%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESL-----YLAMEFVPGGDFRTLLINTRTLRSPHARF 273
           E +IL       +V LL  F +P S      YL ++ +  G+    ++    LR    + 
Sbjct: 252 ETNILMRIHHPNIVNLLDFFIEPVSKSQIQKYLVLDKIDDGELFERIVKKTCLRQDETKA 311

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLI-------------------DAEGHIKLTDFG 314
             +++   +  LH+    HRD+KPEN L+                   + +  +K+ DFG
Sbjct: 312 IFNQILMGLKHLHQQNIIHRDIKPENILLNITRRTNPEQKQLGPWDEDEIDIQVKIADFG 371

Query: 315 LAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPD 374
           LA  T                                          ++ + N++ G+P 
Sbjct: 372 LAKFT-----------------------------------------GEMQFTNTLCGTPS 390

Query: 375 YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETY-ENLRHWKRTLRRPFL 433
           Y+A EVL  K Y   VD WS G +L+  L G+ PFS      +  E +   K     P+ 
Sbjct: 391 YVAPEVLTKKGYTSKVDMWSAGVILYVCLCGFPPFSEQLGPPSLKEQILQAKFAFYTPYW 450

Query: 434 NDGRSAISDRAWELITRLIA 453
           ++    I D    LI+ L+ 
Sbjct: 451 DN----IDDNVLHLISHLLV 466

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 71/167 (42%), Gaps = 42/167 (25%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           L++ ME+  GG  RTLL     +   +    + E+  A+ ++H     HRD+K  N LI 
Sbjct: 88  LWVIMEYCAGGSLRTLL-RPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA 146

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             G +KL DFG+AA     +  +SM  R                                
Sbjct: 147 NNGSVKLCDFGVAA-----QLSQSMLKR-------------------------------- 169

Query: 364 NYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
               +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 170 ---QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 91/214 (42%), Gaps = 40/214 (18%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPES--LYLAMEFVPGGDFRTLLINTRTLRS-------- 268
           E +++     E +V+L     DPES  +YL +E+   G  +    N   +++        
Sbjct: 104 EIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTF 163

Query: 269 PHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNE-RIES 327
             +R  + ++   +  LH  G THRD+KP N LI + G +K++DFG+A  T +    I+S
Sbjct: 164 QQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQS 223

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
              +L + + L  PAF    +    K Y                                
Sbjct: 224 SHEQLLKSRALGTPAFFAPELCSTEKEYS-----------------------------CS 254

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL 421
             +D WSLG  ++  L G  PF+ +S  E ++++
Sbjct: 255 SAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSI 288

>Scas_628.9
          Length = 621

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 79/177 (44%), Gaps = 38/177 (21%)

Query: 231 LVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           +V  L  FQD +  Y   ME+  GGD  +L+++   L    A  +  ++   V  +H++G
Sbjct: 400 IVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADCFFKQLMRGVVYMHDMG 459

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
            +HRDLKPEN L+ ++G +K+TDFG +         E  K+  E+               
Sbjct: 460 VSHRDLKPENLLLTSDGVLKITDFGNS---------ECFKMAWED--------------- 495

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIG 405
                       DI+ +  + GS  Y+A E    +++D   VD W+ G +      G
Sbjct: 496 ------------DIHLSGGVCGSSPYIAPEEYIKEEFDPRCVDIWACGVIYMAMRTG 540

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 78/191 (40%), Gaps = 36/191 (18%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E  +L   + E +V    + Q+  +L + +E+VPGG   ++L N      P    +  ++
Sbjct: 462 EMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVNFTRQI 521

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
              V  LH     HRD+K  N LID +G +K+TDFG++                      
Sbjct: 522 LIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 559

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCM 398
                         K    L Q + +   S+ GS  +M+ EV++        D WS GC+
Sbjct: 560 --------------KKLSPLNQENQDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCV 605

Query: 399 LFEALIGYTPF 409
           + E   G  P+
Sbjct: 606 VIEMFTGKHPY 616

>Scas_640.16
          Length = 505

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 83/197 (42%), Gaps = 48/197 (24%)

Query: 227 RSEWLVKLLYAFQD--PESLYLAMEFVPGGDFRTLLIN--TRTLR-SPHARFYISE-MFC 280
           +S+++V+    F D    S+Y+AME++ G     +  N  +R  R S      ISE +  
Sbjct: 265 KSDYIVRYYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLR 324

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            ++ LHE    HRD+KP+N L + +G +KL DFG     VS E + S+            
Sbjct: 325 GLSYLHEQKVIHRDIKPQNILFNEKGQVKLCDFG-----VSGEAVNSL------------ 367

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLF 400
                                    A +  G+  YMA E ++G+ Y  T D WSLG  + 
Sbjct: 368 -------------------------ATTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTIL 402

Query: 401 EALIGYTPFSGSSTNET 417
           E   G  PF       T
Sbjct: 403 EVAQGRFPFGSDKITAT 419

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 60/219 (27%), Positives = 87/219 (39%), Gaps = 44/219 (20%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           +L E   L+T    ++      F    +LY+ ME+   G    LL     L      F I
Sbjct: 61  LLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFII 120

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            ++  A+  LHE    HRDLK  N L++ +G ++L D G+                    
Sbjct: 121 LQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGVTG------------------ 162

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
             L+F           R   +NL        N+ VG+P +MA E+++ + YD   D WSL
Sbjct: 163 -QLKF--------NSTRHGGKNL--------NTFVGTPFWMAPEIIKNQSYDGKCDIWSL 205

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
           G    E L G  P S         +L   K  +R P LN
Sbjct: 206 GITTLELLNGKPPMS---------HLDSMKALMRIPKLN 235

>Kwal_55.20326
          Length = 750

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 80/191 (41%), Gaps = 37/191 (19%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E  +L   + E +V    + Q+  +L + +E+VPGG   ++L +      P  R +  ++
Sbjct: 537 EMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQI 596

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
              ++ LH     HRD+K  N LID +G +K+TDFG++                      
Sbjct: 597 LIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 634

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCM 398
                         K    L Q   N   S+ GS  +MA EV++        D WS+GC+
Sbjct: 635 --------------KKLSPLNQQQ-NKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCV 679

Query: 399 LFEALIGYTPF 409
           + E   G  PF
Sbjct: 680 IIEMFTGKHPF 690

>Scas_648.17
          Length = 340

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 87/208 (41%), Gaps = 55/208 (26%)

Query: 216 ILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEF--VPGGDFRTLLINTRTLRSPHAR 272
           I  E  ILT  T    +++LL   QDP S   A+ F  V   DFR L     T   P  +
Sbjct: 89  IYRELKILTNLTGGPNVIELLDIVQDPGSKIPALIFEEVKNMDFRQLY---PTFTLPDIQ 145

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLIDA-EGHIKLTDFGLA----AGTVSNERIES 327
           FY +++  A+N  H +G  HRD+KP+N +ID  E  ++L D+GLA     G   N R+ S
Sbjct: 146 FYFTQLLIALNYCHSMGIMHRDVKPQNVMIDPKERKLRLIDWGLAEFYHPGVDYNVRVAS 205

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
              +  E                   +  NL Q                         YD
Sbjct: 206 RYHKGPE-------------------LLVNLNQ-------------------------YD 221

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTN 415
           Y++D WS+GCML   +    PF   S+N
Sbjct: 222 YSLDLWSVGCMLAAIVFKREPFFKGSSN 249

>Scas_564.7
          Length = 1210

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 90/217 (41%), Gaps = 51/217 (23%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +LR  HAR +   +  A+  +H     HRDLK EN +I 
Sbjct: 261 FYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMIS 320

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             G IK+ DFGL+                              ++ DR+K          
Sbjct: 321 TSGEIKIIDFGLS------------------------------NVFDRKK---------- 340

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              ++  GS  + A E+L+   Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 341 -QLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIK 399

Query: 423 HWKRTLRRPFLNDGRSAISDRAWELITR-LIADPINR 458
             K         D  + +S     L+++ L+ DP+ R
Sbjct: 400 QGKV--------DYPNHLSIEVISLLSKMLVVDPLRR 428

>Kwal_0.155
          Length = 587

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 105/253 (41%), Gaps = 28/253 (11%)

Query: 215 HILTERDILTTTRSEWLVKLLYAFQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARF 273
            +L E  I  T  +   V     FQ+  + Y +  E + GG+    ++         +R 
Sbjct: 218 QVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH 277

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFL---IDAEGH----IKLTDFGLAAGTVSNERIE 326
            I ++  AV  +H +G  HRD+KPEN L   +D E      ++ +D   A       R  
Sbjct: 278 VIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIFRPG 337

Query: 327 SMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKY 386
                +  VK  +F           ++IY            +  G+  Y A EV++ ++Y
Sbjct: 338 IGGGGIGTVKLADFGL--------SKQIYST-------NTKTPCGTVGYTAPEVVKDERY 382

Query: 387 DYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWE 446
              VD W +GC+L+  L G+ PF     +   E +   + T  RP+ ++    ISD A  
Sbjct: 383 SMQVDMWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDE----ISDGAKN 438

Query: 447 LITRLI-ADPINR 458
            + RL+  DP  R
Sbjct: 439 AVRRLLEVDPSKR 451

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 78/191 (40%), Gaps = 45/191 (23%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINT--RTLRSPHARFYISEMFC 280
           L+  RS ++     AF    S+++ ME+  GG    LL  T    +      F +SE+  
Sbjct: 70  LSELRSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLI 129

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            ++ LH     HRD+K  N L+   GH+KL DFG++   +   +                
Sbjct: 130 GLDYLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSGQMMVTRK---------------- 173

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKK--YDYTVDYWSLGCM 398
                                     ++ VG+P +MA EV++  K  Y+   D WSLG  
Sbjct: 174 -------------------------RDTFVGTPFWMAPEVIDRNKQGYNEMADIWSLGIT 208

Query: 399 LFEALIGYTPF 409
           + E L+G+ P 
Sbjct: 209 VIELLMGHPPL 219

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 82/192 (42%), Gaps = 38/192 (19%)

Query: 231 LVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           +V  L  FQD    Y   ME+  GGD  TL+I    L    A  +  ++   V  +H++G
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADCFFKQLLRGVVYMHDMG 419

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLKPEN ++  +G +K+TDFG +         E  K+  EE               
Sbjct: 420 VCHRDLKPENLILTHDGVLKITDFGNS---------ECFKMAWEE--------------- 455

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                       DI+ +  + GS  Y+A E    +++D   VD W+ G +      G   
Sbjct: 456 ------------DIHLSGGVCGSSPYIAPEEYVLEEFDPRPVDIWACGVIYMAMRTGRQL 503

Query: 409 FSGSSTNETYEN 420
           ++ +  ++ + N
Sbjct: 504 WTAAKKDDPFYN 515

>Scas_700.35
          Length = 439

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 81/192 (42%), Gaps = 54/192 (28%)

Query: 227 RSEWLVKLLYAFQDP--ESLYLAMEFVPGGDFRTLLINTRTLRSPHARF------YISE- 277
           +S ++V     F D    S+Y+AME++ G    T+    ++L S   R        I+E 
Sbjct: 205 KSNYIVTYYGMFNDTLNGSIYIAMEYMGGQSLDTIY---KSLLSRGGRIGEKILGKIAES 261

Query: 278 MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKN 337
           +   ++ LHE    HRD+KP+N L++ EG +KL DFG     VS E + S+         
Sbjct: 262 VLRGLSYLHERKIIHRDIKPQNILLNEEGEVKLCDFG-----VSGEAVNSL--------- 307

Query: 338 LEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGC 397
                                       A +  G+  YMA E ++G  Y  T D WSLG 
Sbjct: 308 ----------------------------ATTFTGTSFYMAPERIQGHPYSVTCDVWSLGL 339

Query: 398 MLFEALIGYTPF 409
            + E   G  PF
Sbjct: 340 TILEVAQGRFPF 351

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 74/168 (44%), Gaps = 44/168 (26%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           L++ ME+  GG  RTLL   + +   +    + ++  A+  +H+    HRD+K  N LI 
Sbjct: 97  LWVIMEYCAGGSLRTLLRPGK-IDEKYLGVIVRKLLIALVYIHKDNVIHRDIKAANVLIT 155

Query: 304 AEGHIKLTDFGLAAG-TVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
            EGH+KL DFG+AA  T +N +                                  RQ  
Sbjct: 156 NEGHVKLCDFGVAAQLTAANHK----------------------------------RQ-- 179

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                +M G+P +MA EV +EG  Y+   D WSLG   +E   G  P+
Sbjct: 180 -----TMAGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATGNPPY 222

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 84/205 (40%), Gaps = 43/205 (20%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           ++ L    Q+ + + + +EFV GG+F   +   R L+   A    +++   VN +H  G 
Sbjct: 112 IIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVNYMHYKGL 171

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D   ++ +TDFG       NE  E                        
Sbjct: 172 VHRDLKLENLLLDKHENLVITDFGFV-----NEFFE------------------------ 202

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDY-TVDYWSLGCMLFEALIGYTP 408
                      D     +  GSP Y A E V+  K Y+    D WS G +L+  L GY P
Sbjct: 203 -----------DNELMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLP 251

Query: 409 FSGSSTNETYENL-RHWKRTLRRPF 432
           +     N T +++ R +K   + P 
Sbjct: 252 WDDDHENPTGDDIARLYKYITQTPL 276

>Scas_685.24
          Length = 515

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 78/193 (40%), Gaps = 49/193 (25%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLL--INTRTLRSPHARFYISEMFC 280
           L   +S +++  +    +  S+++ ME+  GG    LL       L      +   E+  
Sbjct: 72  LAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILK 131

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            +  LHE    HRD+K  N L+  EGH+KL DFG++                        
Sbjct: 132 GLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSG----------------------- 168

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEV----LEGKKYDYTVDYWSLG 396
                       ++   LR+  I      VG+P +MA EV    +EG  YD  +D WSLG
Sbjct: 169 ------------QLKSTLRRGTI------VGTPYWMAPEVASQNIEG--YDEKIDIWSLG 208

Query: 397 CMLFEALIGYTPF 409
             +FE L G  P 
Sbjct: 209 ITVFELLKGVPPL 221

>Scas_693.17
          Length = 1049

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 75/183 (40%), Gaps = 42/183 (22%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +L+   AR +  ++  A+  LH     HRDLK EN +I 
Sbjct: 175 FYMLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMIS 234

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
            +G+IKL DFGL+                                     +Y     +  
Sbjct: 235 KDGNIKLIDFGLS------------------------------------NLY-----DKC 253

Query: 364 NYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
           N   +  GS  + A E+L+   Y    +D WS G +L+  + G  PF   ++N  +E ++
Sbjct: 254 NKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIK 313

Query: 423 HWK 425
             K
Sbjct: 314 QGK 316

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 82/192 (42%), Gaps = 38/192 (19%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFY 274
           + +E  I ++ +   +++ L  FQD +  Y   ME+  GGD  TL+I    L    A  +
Sbjct: 381 LTSEFCISSSLKHTNIIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCF 440

Query: 275 ISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE 334
           + ++   V  +H +G  HRDLKPEN L+  +G +K+TDFG                    
Sbjct: 441 LKQLITGVVYMHNMGVCHRDLKPENLLLTHDGTLKITDFG-------------------- 480

Query: 335 VKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYW 393
                             + ++   + +I+ +  + GS  Y+A E    +++D   VD W
Sbjct: 481 ----------------NSECFRMAWEKEIHLSGGVCGSGPYIAPEEYTQEEFDPRAVDIW 524

Query: 394 SLGCMLFEALIG 405
           + G +      G
Sbjct: 525 ACGVIYMAMRTG 536

>Scas_651.19
          Length = 801

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 90/224 (40%), Gaps = 60/224 (26%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLI----NTRTLRSPHARFYISEMFCAVNALH 286
           ++K++   ++ ++ +  MEF P GD  +LL     N   L    A  ++ ++   V  +H
Sbjct: 574 ILKIIDLLENNDTFFEVMEFCPSGDLYSLLTRKSKNGTALHPLEADCFMKQLLHGVKYMH 633

Query: 287 ELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEK 346
           + G  H DLKPEN L   +G +K+ DFG +                              
Sbjct: 634 DHGVAHCDLKPENILFHPDGLLKICDFGTSC----------------------------- 664

Query: 347 SIEDRRKIYQNLRQNDINYANSMVGSPDYMAL-EVLEGKKYD-YTVDYWSLGCMLFEALI 404
                  ++Q   +  +++ +  +GS  Y+A  E + GK+YD   VD WS G +    ++
Sbjct: 665 -------VFQTAWEKHVHFQSGAMGSEPYVAPEEFISGKEYDPRLVDCWSCGVVYCTMVM 717

Query: 405 G--------------YTPFSGSSTNE----TYENLRHWKRTLRR 430
           G              Y  F    T+E     +E LRH    L R
Sbjct: 718 GHYLWKIALKDKDSLYKSFVQEMTDEKEFYIFEELRHVNSDLTR 761

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 81/192 (42%), Gaps = 37/192 (19%)

Query: 218 TERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISE 277
           T+ ++L     E +V    + Q+  +L + +E+VPGG   ++L +      P  + +  +
Sbjct: 486 TKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQ 545

Query: 278 MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKN 337
               +  LH     HRD+K  N LID +G +K+TDFG++                     
Sbjct: 546 TLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGISK-------------------- 585

Query: 338 LEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGC 397
            +     +K         QN R        S+ GS  +MA EV++        D WS+GC
Sbjct: 586 -KLSPLNKK---------QNKRA-------SLQGSVYWMAPEVVKQVVTTEKADIWSVGC 628

Query: 398 MLFEALIGYTPF 409
           ++ E   G  PF
Sbjct: 629 VVVEMFTGKHPF 640

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/276 (22%), Positives = 104/276 (37%), Gaps = 56/276 (20%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF----- 273
           E  IL   +   +V LL   +     YL ME+   GD    +   R+L   H        
Sbjct: 67  EIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFE 126

Query: 274 -------------------YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG 314
                              Y+ ++  A+  L      HRD+KP+N L+       L D+ 
Sbjct: 127 KYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLST----PLVDYN 182

Query: 315 LAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPD 374
             A   +   +    + + ++ +  F  F                  + + A ++ GSP 
Sbjct: 183 DPAEFHARGFVGIYNLPILKIADFGFARFLP----------------NTSLAETLCGSPL 226

Query: 375 YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
           YMA E+L  +KY+   D WS+G +L+E   G  PF  S+  E ++ ++     ++ P   
Sbjct: 227 YMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFPKHA 286

Query: 435 DGRSAISDRAWELITRLIADPINRLRSFEHVKRMNY 470
              SA+ D    L+T            FE  KRM +
Sbjct: 287 ALESAMVDLICGLLT------------FEPAKRMGF 310

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 75/183 (40%), Gaps = 42/183 (22%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +LR  HAR ++  +  A+  LH     HRDLK EN +I 
Sbjct: 197 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMIS 256

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             G IK+ DFGL+                                     +Y N +Q   
Sbjct: 257 TSGEIKIIDFGLS------------------------------------NLYDNKKQ--- 277

Query: 364 NYANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              ++  GS  + A E+L+   Y    VD WS G +++  + G  PF   + +  +E ++
Sbjct: 278 --LHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASVLHEKIK 335

Query: 423 HWK 425
             K
Sbjct: 336 KGK 338

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 82/190 (43%), Gaps = 38/190 (20%)

Query: 231 LVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           +V  L  FQD +  Y   ME+  GGD  TL++    L    A  +  ++   V  +HE+G
Sbjct: 385 IVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGVVYMHEMG 444

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLKPEN L+  +G +K+TDFG +         E  K+  E+               
Sbjct: 445 VCHRDLKPENLLLTHDGVLKITDFGNS---------ECFKMAWEK--------------- 480

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGYTP 408
                       +I+ +  + GS  Y+A E    +++D   VD W+ G +      G   
Sbjct: 481 ------------NIHLSGGVCGSSPYIAPEEYIKEEFDPRPVDIWACGVIYMAMRTGRQL 528

Query: 409 FSGSSTNETY 418
           +S +  ++ +
Sbjct: 529 WSSAEKDDPF 538

>Kwal_33.13831
          Length = 700

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 40/197 (20%)

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRT--LRSPHA 271
            H L+ER+  +      ++K+L   Q  +     +EF P GD  +LL  T    L    A
Sbjct: 453 GHSLSERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEA 512

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIR 331
             ++ ++   V  +H+ G  H DLKPEN L   +G +K+ DFG +               
Sbjct: 513 DCFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSC-------------- 558

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMAL-EVLEGKKYD-YT 389
                                 ++Q   +  +++    VGS  Y+A  E +  ++YD   
Sbjct: 559 ----------------------VFQTAWEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRL 596

Query: 390 VDYWSLGCMLFEALIGY 406
           VD WS G +    ++G+
Sbjct: 597 VDSWSCGVIYCTMVLGH 613

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 76/176 (43%), Gaps = 34/176 (19%)

Query: 237 AFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLK 296
           ++QD E++YL  E +     R +      L   H +++  ++  A+ +LH     HRDLK
Sbjct: 83  SYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLK 142

Query: 297 PENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQ 356
           P N L+++   +KL DFGL+    S++R                                
Sbjct: 143 PSNLLLNSSCDLKLCDFGLSRCLASSDRS------------------------------- 171

Query: 357 NLRQNDINYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSG 411
             R+N + +    V +  Y A E+ L  ++Y   +D WS GC+L E + G   F G
Sbjct: 172 --RENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPG 225

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 87/194 (44%), Gaps = 54/194 (27%)

Query: 225 TTRSEWLVKL--LYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF------YIS 276
           + +S+++V+   ++A ++  ++++AME++ G   R+L    + L S   R        I+
Sbjct: 231 SCKSDFIVRYYGMFACEETSTIFIAMEYMGG---RSLDSVYKHLLSKGGRIGEKVLGKIA 287

Query: 277 E-MFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
           E +   +  LHE    HRD+KP+N L +  G IKL DFG     VS E + S+       
Sbjct: 288 ESVLRGLFYLHERKIIHRDIKPQNILFNEIGQIKLCDFG-----VSGEAVNSL------- 335

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
                                         A +  G+  YMA E ++G+ Y  T D WSL
Sbjct: 336 ------------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSL 365

Query: 396 GCMLFEALIGYTPF 409
           G  L E   G++PF
Sbjct: 366 GLTLLEVAQGHSPF 379

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (43%), Gaps = 21/219 (9%)

Query: 245 YLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDA 304
           YL  E + GG+    ++    L    +R  I ++  AV  +H LG  HRD+KPEN L  +
Sbjct: 257 YLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIKPENLLFKS 316

Query: 305 EGHI--KLTDFGLA--AGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360
             +I  K   F  +    T ++E +    I    +  ++   F        ++I+Q    
Sbjct: 317 IEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADFGLS-----KQIFQK--- 368

Query: 361 NDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
                  +  G+  Y A EV++ +KY   VD W +GC+L+  L G+ PF     +   E 
Sbjct: 369 ----NTKTPCGTIGYTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDEKIDVLTEK 424

Query: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINR 458
           +   + T   P+ ++    IS  A   + +L+  DP  R
Sbjct: 425 ISRGEYTFLEPWWDE----ISPGAKHCVKKLLEVDPRKR 459

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 79/191 (41%), Gaps = 37/191 (19%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E ++L     E +V    A Q+  +L + +E+VPGG   ++L N           +  ++
Sbjct: 504 EMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQI 563

Query: 279 FCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNL 338
              V  LH+    HRD+K  N LID +G +K+TDFG++                      
Sbjct: 564 LIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISK--------------------- 602

Query: 339 EFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCM 398
           +     +K         QN R        S+ GS  +M+ EV++        D WS GC+
Sbjct: 603 KLSPLNKK---------QNKRA-------SLQGSVFWMSPEVVKQTATTAKADIWSTGCV 646

Query: 399 LFEALIGYTPF 409
           + E   G  PF
Sbjct: 647 VIEMFTGKHPF 657

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 75/184 (40%), Gaps = 42/184 (22%)

Query: 245 YLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDA 304
           Y+  EF+ GG     +I   +L+  HAR     +  A+  LH     HRDLK EN ++  
Sbjct: 167 YMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSK 226

Query: 305 EGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDIN 364
            G IKL DFGL+                              ++ D RK  Q        
Sbjct: 227 TGEIKLIDFGLS------------------------------NMYDPRKSLQ-------- 248

Query: 365 YANSMVGSPDYMALEVLEGKKY-DYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRH 423
              +  GS  + A E+L+   Y    VD WS G +L+  + G  PF   +++  +E ++ 
Sbjct: 249 ---TFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKK 305

Query: 424 WKRT 427
            K T
Sbjct: 306 GKVT 309

>Scas_573.10
          Length = 569

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 92/219 (42%), Gaps = 21/219 (9%)

Query: 245 YLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDA 304
           Y+  E + GG+    ++         +R  I ++  AV  LH LG  HRD+KPEN L + 
Sbjct: 223 YIVQELIHGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIKPENLLFEP 282

Query: 305 EGHIKLTDFGLA----AGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360
              I   +  L       T S+E +    +    +  ++   F        ++I+     
Sbjct: 283 IEFIPSKEPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLS-----KQIFAT--- 334

Query: 361 NDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
                  +  G+  Y A EV++ + Y   VD W +GC+L+  L G+ PF     +   E 
Sbjct: 335 ----NTKTPCGTVGYTAPEVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDEKIDVLTEK 390

Query: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINR 458
           +   + T  RP+ ++    IS  A   + RL+  DP  R
Sbjct: 391 ISRGEYTFLRPWWDE----ISAGAKNAVIRLLEVDPNKR 425

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 102/257 (39%), Gaps = 60/257 (23%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHAR--FYISEMFC 280
           L   +S  +   +    +  S+++ ME+  GG    LL  +     P  +  F I E+  
Sbjct: 68  LAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTL 127

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            +  LHE    HRD+K  N L++ EG +KL DFG++                        
Sbjct: 128 GLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSG----------------------- 164

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVL--EGKKYDYTVDYWSLGCM 398
                        I   L++      ++ VG+P +MA EV+  E   Y+   D WSLG  
Sbjct: 165 ------------HIRSTLKR------DTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGIT 206

Query: 399 LFEALIGYTPFSGSSTNETYENLRHWK-RTLRRPFLNDGRSAISDRAWELITR-LIADPI 456
            +E L G  P S     +   NL   K   L+ PF        SD A + +   L+  P 
Sbjct: 207 TYELLKGLPPLSKYDPMKVMTNLPKRKPPKLQGPF--------SDAAKDFVAGCLVKTPA 258

Query: 457 NR-----LRSFEHVKRM 468
           +R     L SFE VK +
Sbjct: 259 DRPSAYNLLSFEFVKNI 275

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 72/168 (42%), Gaps = 38/168 (22%)

Query: 231 LVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELG 289
           ++  L  FQD +  Y   ME+  GGD  +L++    L    A  +  +M   V  +H++G
Sbjct: 286 IINTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADCFFKQMIRGVVYMHDMG 345

Query: 290 YTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIE 349
             HRDLKPEN ++ A G +K+TDFG                                   
Sbjct: 346 VCHRDLKPENLILTANGVLKITDFGNG--------------------------------- 372

Query: 350 DRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLG 396
              + ++   + DI+ +  + GS  Y+A E    +++D   VD W+ G
Sbjct: 373 ---ECFRMAWEKDIHLSGGVCGSSPYIAPEEYSMEEFDPRPVDIWACG 417

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 116/280 (41%), Gaps = 43/280 (15%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPES--LYLAMEFVPGGDFR--------TLLI 261
           E + I  E  I+     + +VKL+    D +S  +YL +E+   G+ +        T   
Sbjct: 192 ENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDCLETEAK 251

Query: 262 NTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG--LAAGT 319
               L     R  +  +   +  LH  G  HRD+KP N L+   G +K++DFG  LAA +
Sbjct: 252 GPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDFGVSLAASS 311

Query: 320 VSNERIESMKIRLEEVKNLEFPAFTEKSI---EDRRKIYQNLRQNDINYANSMVGSPDYM 376
            + +  +     LE  K    PAF    I   ED  + YQ  R+                
Sbjct: 312 SNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDRE---------------- 355

Query: 377 ALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENL--------RHWKRTL 428
             E+ +G    + +D W+LG  L+  + G  PF  S   E +E +        ++     
Sbjct: 356 --ELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLK 413

Query: 429 RRPFLNDGRSAISDRAWELITRLI-ADPINRLRSFEHVKR 467
               L     A  + A +L+TRL+  +PI R+ + E +KR
Sbjct: 414 NNQVLQMTEEAEYEAAKDLLTRLLEKNPIKRI-NIEEIKR 452

>Kwal_33.13222
          Length = 148

 Score = 64.3 bits (155), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/97 (31%), Positives = 56/97 (57%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +++L   ++   +LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 9   VLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 68

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
            HRDLKPEN L+D + +IK+ DFG+AA    ++ +E+
Sbjct: 69  VHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLET 105

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 69/276 (25%), Positives = 112/276 (40%), Gaps = 23/276 (8%)

Query: 215 HILTERDILTTTRSEWLVKLLYAFQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARF 273
            +L E  I     S   +     FQ+ ES Y +  E + GG+    ++         +R 
Sbjct: 163 QVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH 222

Query: 274 YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLE 333
            I ++  AV  +H LG  HRD+KPEN L          DF      + ++R +  +    
Sbjct: 223 VIRQLALAVKHMHSLGIVHRDIKPENLLFSP------IDF------IPSKRQQLRQSDDP 270

Query: 334 EVKNLE--FPAFTEKSIEDRRKIYQNLRQNDINYANSM--VGSPDYMALEVLEGKKYDYT 389
           + K  E  F            K+        I   N+    G+  Y A EV++ ++Y   
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATNTTTPCGTVGYTAPEVVKDERYSMK 330

Query: 390 VDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELIT 449
           VD W +GC+L+  L G+ PF     +   E +   + T  RP+ ++    IS  A   + 
Sbjct: 331 VDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDE----ISPGAKNAVR 386

Query: 450 RLI-ADPINRLRSFEHVKRMNYFHEINFDTLRQLSP 484
           RL+  DP  R    E +    + +  + + LR L P
Sbjct: 387 RLLEVDPDKRYDIDEFLAD-PWLNSYDCNVLRPLVP 421

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 81/190 (42%), Gaps = 48/190 (25%)

Query: 227 RSEWLVKLLYAFQDPE--SLYLAMEFVPGGDFRTLLINT--RTLR-SPHARFYISEMFC- 280
           +SE++V+    F D E  S+Y+AME++ G     +  N   R  R S      I+E    
Sbjct: 276 QSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLR 335

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            ++ LHE    HRD+KP+N L++  G +KL DFG     VS E + S+            
Sbjct: 336 GLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFG-----VSGEAVNSL------------ 378

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLF 400
                                    A +  G+  YMA E ++G+ Y  T D WSLG  + 
Sbjct: 379 -------------------------ATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTIL 413

Query: 401 EALIGYTPFS 410
           E   G  P S
Sbjct: 414 EVANGKFPCS 423

>Kwal_55.21709
          Length = 340

 Score = 67.8 bits (164), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 86/208 (41%), Gaps = 55/208 (26%)

Query: 216 ILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEF--VPGGDFRTLLINTRTLRSPHAR 272
           I  E  ILT  T    ++ LL   QD  S   A+ F  V   DFRTL +       P  +
Sbjct: 89  IYRELKILTNLTGGPNVIALLDIVQDSGSKIPALIFEEVKNVDFRTLYLK---FTLPDIQ 145

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLID-AEGHIKLTDFGLA----AGTVSNERIES 327
           +Y S++  A++  H +G  HRD+KP+N +ID  E  ++L D+GLA     G   N R+ S
Sbjct: 146 YYFSQLLIALDYCHSMGIMHRDVKPQNVMIDPVERKLRLIDWGLAEFYHPGVDYNVRVAS 205

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
              +  E                   +  NL Q                         YD
Sbjct: 206 RYHKGPE-------------------LLVNLNQ-------------------------YD 221

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTN 415
           Y++D WS+GCML   +    PF   STN
Sbjct: 222 YSLDLWSVGCMLAAIVFKKEPFFKGSTN 249

>Kwal_0.307
          Length = 490

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 87/205 (42%), Gaps = 38/205 (18%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYL-AMEFVPGGDFRTLLINTRTLRSPHARFY 274
           + +E  I ++ +   ++  L  FQD +  Y   ME+  GGD  TL+I    L    A  +
Sbjct: 318 LTSEFCISSSLKHTNIIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADCF 377

Query: 275 ISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEE 334
             ++   V  +H++G  HRDLKPEN L+ + G +K+TDFG                    
Sbjct: 378 FKQLIRGVVYMHDMGVCHRDLKPENLLLSSNGTLKITDFG-------------------- 417

Query: 335 VKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYW 393
                             + ++   + DI+ +  + GS  Y+A E    +++D   VD W
Sbjct: 418 ----------------NSECFRMAWEKDIHLSGGVCGSSPYIAPEEYVHEEFDPRPVDIW 461

Query: 394 SLGCMLFEALIGYTPFSGSSTNETY 418
           + G +      G   +S +  ++ +
Sbjct: 462 ACGVIYMAMRTGRQLWSSAQRDDEF 486

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 75/183 (40%), Gaps = 42/183 (22%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +LR  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 207 FYMLFEYVAGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMIS 266

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             G IK+ DFGL+                              ++ D RK          
Sbjct: 267 NSGEIKIIDFGLS------------------------------NVYDTRK---------- 286

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              ++  GS  + A E+L+   Y    VD WS G +L+  + G  PF   +++  +E ++
Sbjct: 287 -QLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIK 345

Query: 423 HWK 425
             K
Sbjct: 346 RGK 348

>Scas_711.25
          Length = 1515

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 82/176 (46%), Gaps = 41/176 (23%)

Query: 237  AFQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDL 295
             F++ +++Y L +E+V GG   +L+        P  R   +++   +  LH  G  HRD+
Sbjct: 1284 GFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDM 1343

Query: 296  KPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIY 355
            K +N L+D +G  K++DFG++  +                                + IY
Sbjct: 1344 KADNLLLDQDGVCKISDFGISRKS--------------------------------KDIY 1371

Query: 356  QNLRQNDINYANSMVGSPDYMALEVLEGKK-YDYTVDYWSLGCMLFEALIGYTPFS 410
             N   +D+    +M G+  +MA E+++ K+ Y   VD WSLGC++ E   G  P+S
Sbjct: 1372 SN---SDM----TMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1420

>Scas_707.36
          Length = 915

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 87/206 (42%), Gaps = 27/206 (13%)

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPES--LYLAMEFVPGGDF-----RTLLINTR-- 264
           N I  E  I+    ++ +VKL+    D  S  +YL +E+   G         L I++R  
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLEIDSRGP 201

Query: 265 -TLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNE 323
             L    AR    ++   +  LH  G  HRD+KP N L+D  G +K++DFG++    +N 
Sbjct: 202 PQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSLA--ANG 259

Query: 324 RIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEG 383
            I++    LE  K +  P F                  +I    + +   +    E+  G
Sbjct: 260 NIDTNDDELELTKTVGTPVFYAP---------------EICLGAAAMERFNLDKDELFNG 304

Query: 384 KKYDYTVDYWSLGCMLFEALIGYTPF 409
               + +D W+LG  L+  L G  PF
Sbjct: 305 SCISFKIDIWALGITLYCLLFGMLPF 330

>Kwal_33.13112
          Length = 505

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 95/239 (39%), Gaps = 50/239 (20%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHAR--FYISEMFC 280
           L+  R+ ++      + +  S+++ MEF  GG    LL +    R P  +  + I E+  
Sbjct: 86  LSELRAPFVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLY 145

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            +  LH     HRD+K  N L+  EG +KL DFG++                        
Sbjct: 146 GLEYLHSQRKIHRDVKAANILLTDEGEVKLGDFGVSG----------------------- 182

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLE-GKKYDYTVDYWSLGCML 399
                       +I   L++      N+ VG+P +MA E++     YD   D WSLG   
Sbjct: 183 ------------QIMATLKR------NTFVGTPYWMAPEIIARDNGYDEKADIWSLGITA 224

Query: 400 FEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINR 458
            E L G  P++     +   N+      LR+P    GR   S R +  +  L  DP  R
Sbjct: 225 MELLTGQPPYAKYDPMKVLMNI-----PLRKPPRLQGRFTSSARDFIALC-LTKDPALR 277

>Scas_713.7
          Length = 983

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 79/199 (39%), Gaps = 44/199 (22%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTR-TLRSPH 270
           E   I+TE D+L       +VK     Q   +LY+ +EF   G  + LL   +  +    
Sbjct: 64  ELIEIMTEIDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD 123

Query: 271 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKI 330
           A+ YI +    +  LHE G  HRD+K  N L+D+   +KL DFG++   VSN        
Sbjct: 124 AKVYIRQTLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGVST-KVSNT------- 175

Query: 331 RLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTV 390
                                              A ++ GS  +M+ E++  +      
Sbjct: 176 -----------------------------------AMTLAGSLHWMSPEIIGNRGASTLS 200

Query: 391 DYWSLGCMLFEALIGYTPF 409
           D WSLG  + E + G  PF
Sbjct: 201 DIWSLGATVVELVTGNPPF 219

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 41/176 (23%)

Query: 237  AFQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDL 295
             F++  ++Y L +E+V GG   +L+        P  +   +++   +  LH  G  HRD+
Sbjct: 1245 GFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDM 1304

Query: 296  KPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIY 355
            K +N L+D +G  K++DFG++  +                                + IY
Sbjct: 1305 KADNLLLDQDGICKISDFGISRKS--------------------------------KDIY 1332

Query: 356  QNLRQNDINYANSMVGSPDYMALEVLEGKK-YDYTVDYWSLGCMLFEALIGYTPFS 410
             N   +D+    +M G+  +MA E+++ K+ Y   VD WSLGC++ E   G  P+S
Sbjct: 1333 SN---SDM----TMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1381

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 83/202 (41%), Gaps = 48/202 (23%)

Query: 214 NHILTERDILTTTRSEWLVKLLYAFQDPE--SLYLAMEFVPG----GDFRTLLINTRTLR 267
             I  E     + +S+++V+    F D E  S+Y+AME++ G      ++ LL +   + 
Sbjct: 278 KQIFRELQFNKSCKSDYIVRYYGMFTDEEHSSIYIAMEYMGGRSLDAIYKHLLKHGGRVG 337

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIES 327
                     +   ++ LH+    HRD+KP+N L++  G +KL DFG     VS E + S
Sbjct: 338 EKVLGKIAESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFG-----VSGEAVNS 392

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
           +                                     A +  G+  YMA E ++G+ Y 
Sbjct: 393 L-------------------------------------ATTFTGTSYYMAPERIQGQPYS 415

Query: 388 YTVDYWSLGCMLFEALIGYTPF 409
            T D WSLG  L E    + PF
Sbjct: 416 VTSDVWSLGLTLLEVAQAHFPF 437

>ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -
           SH] complement(560761..563556) [2796 bp, 931 aa]
          Length = 931

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 43/193 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +V+L    Q+ + + + +++  GG+F   +   R L+ P A    +++   V+ +H  G 
Sbjct: 110 IVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLFAQLISGVHYIHYKGL 169

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D   ++ +TDFG       NE                           
Sbjct: 170 AHRDLKLENLLLDEHENLIITDFGFV-----NE--------------------------- 197

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDYT-VDYWSLGCMLFEALIGYTP 408
                    +ND+    +  GSP Y A E V+  K Y     D WS G +L+  L GY P
Sbjct: 198 -------FHKNDL--MRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLP 248

Query: 409 FSGSSTNETYENL 421
           +     N   E++
Sbjct: 249 WDDDPENPEGEDI 261

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 45/203 (22%)

Query: 223 LTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPH--ARFYISEMFC 280
           L   +S ++   +    +  S+++AME+  GG    LL    T   P    RF   E+  
Sbjct: 55  LAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILK 114

Query: 281 AVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEF 340
            ++ LH     HRD+K  N L+  EG +KL+DFG++   +S+ R                
Sbjct: 115 GLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLSSFR---------------- 158

Query: 341 PAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVL--EGKKYDYTVDYWSLGCM 398
                                     ++ VG+P +MA E++  + + YD   D WSLG  
Sbjct: 159 -------------------------RDTFVGTPYWMAPEIVAHDSEGYDERADIWSLGIT 193

Query: 399 LFEALIGYTPFSGSSTNETYENL 421
           + E L G  P S     +   NL
Sbjct: 194 VIEMLRGSPPLSKYDPMKVIANL 216

>KLLA0F16467g 1519800..1520822 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 340

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 113/279 (40%), Gaps = 70/279 (25%)

Query: 216 ILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEF--VPGGDFRTLLINTRTLRSPHAR 272
           I  E  +LT  T    ++ LL   QDP S   A+ F  V   DFRTL   + TL     +
Sbjct: 90  IYRELKVLTNLTGGPNIIGLLDIVQDPGSKIPALIFEEVKNVDFRTLY-PSFTLSD--TQ 146

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLIDA-EGHIKLTDFGLAAGTVSNERIESMKIR 331
           FY +++  A++  H +G  HRD+KP+N +ID  E  ++L D+GLA               
Sbjct: 147 FYFTQLLTALDYCHSMGIMHRDVKPQNVMIDPNERKLRLIDWGLA--------------- 191

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
                  EF              Y      +I  A+     P+ +    +   +YDY++D
Sbjct: 192 -------EF--------------YHPGVDYNIRVASRYHKGPELL----VSLNQYDYSLD 226

Query: 392 YWSLGCMLFEALIGYTPFSGSSTN--------------ETYENLRHWKRTLRRPFLNDGR 437
            W++GCM+   +    PF   STN              E +  L+H+   L   + ND  
Sbjct: 227 LWAVGCMIAAIVFKKEPFFKGSTNADQLVKIAKVLGTQELFYYLKHYGLDLPAEY-NDIM 285

Query: 438 SAISDRAWE--------LITRLIADPINRLRSFEHVKRM 468
                + W         L    I D I+ L  ++H +R+
Sbjct: 286 KNYERKPWSYFANDKTPLAVDEIIDLIDHLLRYDHQERL 324

>YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II
           (Protein kinase CK2), catalytic (alpha-prime) subunit
           [1020 bp, 339 aa]
          Length = 339

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 87/208 (41%), Gaps = 55/208 (26%)

Query: 216 ILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEF--VPGGDFRTLLINTRTLRSPHAR 272
           I  E  ILT  T    +V L    QD +S   A+ F  +   DFRTL     T + P  +
Sbjct: 89  IYRELKILTNLTGGPNVVGLYDIVQDADSKIPALIFEEIKNVDFRTLY---PTFKLPDIQ 145

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLID-AEGHIKLTDFGLA----AGTVSNERIES 327
           +Y +++  A++  H +G  HRD+KP+N +ID  E  ++L D+GLA     G   N R+ S
Sbjct: 146 YYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPTERKLRLIDWGLAEFYHPGVDYNVRVAS 205

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
              +  E                   +  NL Q                         YD
Sbjct: 206 RYHKGPE-------------------LLVNLNQ-------------------------YD 221

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTN 415
           Y++D WS+GCML   +    PF   S+N
Sbjct: 222 YSLDLWSVGCMLAAIVFKKEPFFKGSSN 249

>Kwal_47.17263
          Length = 1127

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 112/270 (41%), Gaps = 35/270 (12%)

Query: 213 TNHILTERDILTTTRSEWLVKLLYAFQDPES--LYLAMEFV--------PGGDFRTLLIN 262
           ++ I  E  I+     E +VKL+    D  S  +YL +E+         PG    T    
Sbjct: 155 SDKIKREIAIMKKCHHEHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQLETEARG 214

Query: 263 TRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTVS 321
              L    AR     +   +  LH  G  HRD+KP N LI   G +K++DFG++ A + S
Sbjct: 215 PPLLTFQRAREIFRGVVLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGVSFAASKS 274

Query: 322 NERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVL 381
                S+   LE  K    PAF    I              + +  S   +PD  + +  
Sbjct: 275 GAGYGSLD-ELELAKTAGTPAFFAPEI-------------CLGHEASERFAPDRPSSD-- 318

Query: 382 EGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLR--RPFLNDGRSA 439
            G    Y +D W++G  L   L G  PF      E ++ + + +  L+      ++G S 
Sbjct: 319 HGSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISK 378

Query: 440 ISDR-----AWELITRLIA-DPINRLRSFE 463
           IS++     A +L+ RL+  +P  R++  E
Sbjct: 379 ISNQEEYEAAKDLLGRLLTKNPFKRIKIAE 408

>Kwal_14.1416
          Length = 365

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 86/211 (40%), Gaps = 37/211 (17%)

Query: 242 ESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFL 301
           +++YL  E +     + +     +L   H +++  ++  A+ A+H     HRD+KP N L
Sbjct: 88  QAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVIHRDIKPSNLL 147

Query: 302 IDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQN 361
           +++   +K+ DFGLA   +S+                                  + RQN
Sbjct: 148 LNSNCDLKVCDFGLARCLISS---------------------------------THSRQN 174

Query: 362 DINYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
            + +    V +  Y A E+ L  ++Y   +D WS GC+L E + G   F G    + +  
Sbjct: 175 LVGFMTEYVATRWYRAPEIMLTFQQYTVAMDIWSCGCILAEMITGKPLFPG---RDYHHQ 231

Query: 421 LRHWKRTLRRPFLNDGRSAISDRAWELITRL 451
           L      L  P   D  +  S RA E I  L
Sbjct: 232 LWLILEALGTPSYEDFENINSKRAKEYIANL 262

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 75/187 (40%), Gaps = 42/187 (22%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +V+L    Q+ + + + +E+  GG+F   +   R L+   A    +++   V  +H    
Sbjct: 115 VVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNL 174

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D   ++ +TDFG       NE +                         
Sbjct: 175 VHRDLKLENLLLDKNENLVITDFGFV-----NEFLP------------------------ 205

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKY-DYTVDYWSLGCMLFEALIGYTP 408
                      D  Y  +  GSP Y A E V+  + Y     D WS G +L+  L GY P
Sbjct: 206 -----------DNEYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLP 254

Query: 409 FSGSSTN 415
           +   STN
Sbjct: 255 WDDDSTN 261

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 106/248 (42%), Gaps = 38/248 (15%)

Query: 231 LVKLLYAFQDPES-LYLAMEFVPGGDFRTLLINTRTLRS---PHARFYISEMFCAVNALH 286
           ++K+ + F D  + LY+  + +PGGD  + L     L S     +   + ++  A+N LH
Sbjct: 223 IIKVYHTFCDRNNHLYIFQDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLH 282

Query: 287 ELGYTHRDLKPENFLI---DAEGHIKLTDFGLAAGTVSN-ERIESMKIRLEEVKNLEFPA 342
           +    HRDLK +N L+   +    I L DFG+A    SN ER+ ++      V   E+ A
Sbjct: 283 DQDIVHRDLKLDNILLCTPEPCTRIVLADFGIAKDLNSNKERMHTV------VGTPEYCA 336

Query: 343 FTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEA 402
             E      RK YQ+  +                    LE + YD   D WSLG +    
Sbjct: 337 -PEVGFRANRKAYQSFSRA-----------------ATLEQRGYDSKCDLWSLGVITHIM 378

Query: 403 LIGYTPFSG-SSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI-ADPINRLR 460
           L G +PF G  S     +N +  K   +    +     +SD A   +  L+  D + RL 
Sbjct: 379 LTGISPFYGDGSERSIIQNAKIGKLNFKLKQWD----IVSDNAKSFVKDLLQTDVVKRLN 434

Query: 461 SFEHVKRM 468
           S + +K +
Sbjct: 435 SKQGLKHI 442

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 110/262 (41%), Gaps = 66/262 (25%)

Query: 213 TNHI----LTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGD-FRTLLINTRTLR 267
           +NHI    L E DI +       +  LY + D    Y+ ME+  GGD +  +  +T   +
Sbjct: 97  SNHICFEALYEVDIQSKIGKHKNITELYDYFDS---YIIMEYCSGGDLYEAIKADTIPRK 153

Query: 268 SPHARFYISEMFCAVNALHELGYTHRDLKPENFLI-DAEGHIKLTDFGLAAGTVSNERIE 326
           +      IS++  AV  +H  G  HRD+KPEN LI D+   +KLTD+GLA          
Sbjct: 154 TRQLTHIISQILDAVEFVHSKGIYHRDIKPENILIADSNWTVKLTDWGLAT--------- 204

Query: 327 SMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGK-K 385
                            T+++  DR                  VGS  YMA E+ E    
Sbjct: 205 -----------------TDQTSMDRN-----------------VGSERYMAPELFESNLD 230

Query: 386 YD--------YTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGR 437
           YD          VD W++G +L   +    PFS +  N+T ++  ++     R  L D  
Sbjct: 231 YDERNEPYECSKVDIWAIGIVLLNIVFHKNPFSVA--NQTDKSFCYF--AANREALFDVF 286

Query: 438 SAISDRAWELITR-LIADPINR 458
           S +S   ++L+   L  DP NR
Sbjct: 287 STMSYDLYQLLRHSLTIDPTNR 308

>Scas_689.24
          Length = 645

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 71/166 (42%), Gaps = 42/166 (25%)

Query: 247 AMEFVPGGDFRTLLI-NTRTLRSPH---ARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
            MEF   GD  TLL   T  L   H   A  ++ ++  A++ +H+ G  H DLKPEN L 
Sbjct: 432 VMEFCACGDLYTLLTTQTDGLTKLHPLEADCFMKQLLHAISFMHKHGIAHCDLKPENILF 491

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
            ++G +K+ DFG                                       ++Q   +  
Sbjct: 492 QSDGRLKVCDFGTG------------------------------------NVFQTAWEKH 515

Query: 363 INYANSMVGSPDYMAL-EVLEGKKYD-YTVDYWSLGCMLFEALIGY 406
           +++ + M+G+  YM   E L GK+YD   VD WS G +    ++G+
Sbjct: 516 VHFQSGMLGTEPYMPPEEFLPGKEYDPRLVDVWSCGVVYCSMILGH 561

>CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces
           cerevisiae YJL165c HAL5 ser/thr protein kinase, start by
           similarity
          Length = 813

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 69/168 (41%), Gaps = 45/168 (26%)

Query: 247 AMEFVPGGDFRTLLIN-------TRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPEN 299
            ME  P GD  +LL++         +L    A  ++ ++   V  +H+ G  H DLKPEN
Sbjct: 597 VMELCPAGDLHSLLVSRSQSGNAIGSLHPLEADCFMKQLLRGVQYMHDHGIAHCDLKPEN 656

Query: 300 FLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLR 359
            L    G +K+ DFG ++                                    ++Q   
Sbjct: 657 LLFHPNGLLKICDFGTSS------------------------------------VFQTAW 680

Query: 360 QNDINYANSMVGSPDYMALEVLE-GKKYD-YTVDYWSLGCMLFEALIG 405
           +  +++ N ++GS  Y+A EV + GK YD   +D WS G +    + G
Sbjct: 681 EKHVHFQNGVIGSEPYVAPEVFQLGKDYDPRLIDCWSCGIVYCTMVFG 728

>Kwal_23.5576
          Length = 504

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 73/170 (42%), Gaps = 38/170 (22%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
            LYL  E +   D   ++ + + L   H + +I ++ CA+  +H     HRDLKP N L+
Sbjct: 103 GLYLYEELMEC-DIHQIIKSGQPLTDAHYQSFIYQLLCALKYIHSADVLHRDLKPGNLLV 161

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           +A+  +K+ DFGLA G                        ++E  +E+ +          
Sbjct: 162 NADCQLKVCDFGLARG------------------------YSENPVENNQ---------- 187

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSG 411
             +    V +  Y A E+ L  + Y   +D WS GC+L E L G   F G
Sbjct: 188 --FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSCGCILAELLGGKPIFKG 235

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 95/240 (39%), Gaps = 39/240 (16%)

Query: 238 FQDPESLY-LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLK 296
           FQ+ +S Y +  E + GG+    ++         +R  I ++  AV  +H LG  HRD+K
Sbjct: 256 FQETDSYYYIIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIK 315

Query: 297 PENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLE-------FPAFTEKSIE 349
           PEN L +    I+ T               S+K +L +  + +       F         
Sbjct: 316 PENLLFEP---IEFT--------------RSIKPKLRKSDDPQTKADEGIFTPGVGGGGI 358

Query: 350 DRRKIYQNLRQNDINYANSM--VGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYT 407
              K+        I   N+    G+  Y A EV++ + Y   VD W +GC+L+  L G+ 
Sbjct: 359 GIVKLADFGLSKQIFSKNTKTPCGTVGYTAPEVVKDEHYSMKVDMWGIGCVLYTMLCGFP 418

Query: 408 PFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLIADPINRLRSFEHVKR 467
           PF     +   E +   + T  +P+            W+ I+    + + +L   E  KR
Sbjct: 419 PFYDEKIDTLTEKISRGEYTFLKPW------------WDEISAGAKNAVAKLLELEPSKR 466

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 84/227 (37%), Gaps = 49/227 (21%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +VK    F+  E  Y+  +   GG+    ++         A   + +M  AV  +H    
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQNV 174

Query: 291 THRDLKPENFL-IDA--EGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKS 347
            HRDLKPEN L +D   E  + ++DFG+A    S  ++                      
Sbjct: 175 VHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQL---------------------- 212

Query: 348 IEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSLGCMLFEALIGYT 407
                              +   GS  Y+A EVL    +    D WSLG + +  L GY+
Sbjct: 213 ------------------IHRAAGSMGYVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYS 254

Query: 408 PFSGSSTNETYENLRHWKR--TLRRPFLNDGRSAISDRAWELITRLI 452
           PF   ST    E +       T   P+ N+    IS  A + I R +
Sbjct: 255 PFIAESTEGFLEEVFSGSDPVTFHSPYWNN----ISKEAKQFILRAL 297

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 74/184 (40%), Gaps = 59/184 (32%)

Query: 244 LYLAMEFVPGGDFRTLLINTRT---LRSPHARFYISEMFCAVNALHELGYTHRDLKPENF 300
           LYL ME   G    + ++N R+   L     RFY  EM   +  +H+ G  H DLKP NF
Sbjct: 512 LYLIMEC--GDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANF 569

Query: 301 LIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ 360
           ++  +G +K+ DFG+A                E   N+                      
Sbjct: 570 VL-VKGILKIIDFGIANAVP------------EHTVNI---------------------- 594

Query: 361 NDINYANSMVGSPDYMALEVL-------------EGKKYDY--TVDYWSLGCMLFEALIG 405
               Y  + +G+P+YMA E L             EG K+      D WS GC++++ + G
Sbjct: 595 ----YRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYG 650

Query: 406 YTPF 409
             P+
Sbjct: 651 KPPY 654

>CAGL0G02035g 179911..180930 highly similar to sp|P19454
           Saccharomyces cerevisiae YOR061w CKA2 casein kinase II
           alpha chain, start by similarity
          Length = 339

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 89/208 (42%), Gaps = 55/208 (26%)

Query: 216 ILTERDILTT-TRSEWLVKLLYAFQDPESLYLAMEF--VPGGDFRTLLINTRTLRSPHAR 272
           I  E  ILT  T    ++ LL   QD  S   A+ F  V   DFRTL   + TL+    +
Sbjct: 89  IYRELKILTNLTGGPNVIGLLDIVQDQASKIPALIFEEVKNADFRTLY-PSFTLQD--LQ 145

Query: 273 FYISEMFCAVNALHELGYTHRDLKPENFLID-AEGHIKLTDFGLA----AGTVSNERIES 327
           +Y +++  A++  H +G  HRD+KP+N +ID A+  ++L D+GLA     G   N R+ S
Sbjct: 146 YYFTQLLIALDYCHSMGIMHRDVKPQNVMIDPAQKKLRLIDWGLAEFYHPGVDYNVRVAS 205

Query: 328 MKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD 387
              +  E                   +  NL Q                         YD
Sbjct: 206 RYHKGPE-------------------LLVNLNQ-------------------------YD 221

Query: 388 YTVDYWSLGCMLFEALIGYTPFSGSSTN 415
           Y++D WS+GCML   +    PF   S+N
Sbjct: 222 YSLDLWSVGCMLAAIIFKKEPFFKGSSN 249

>Scas_640.14*
          Length = 728

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (39%), Gaps = 42/193 (21%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +V+L    Q+ + + + +E+  GG+F   +   R L+   A    +++   V+ +H  G 
Sbjct: 108 IVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGI 167

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D   ++ +TDFG                        EF A        
Sbjct: 168 VHRDLKLENLLLDKHENLIITDFGFVN---------------------EFYA-------- 198

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDY-TVDYWSLGCMLFEALIGYTP 408
                      D     +  GSP Y A E V+  + Y     D WS G +L+  L GY P
Sbjct: 199 -----------DNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLP 247

Query: 409 FSGSSTNETYENL 421
           +     N   E++
Sbjct: 248 WDDDKQNPNGEDI 260

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 105/266 (39%), Gaps = 49/266 (18%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF----- 273
           E  IL   +   +V L+   +     YL M++   GD   L+   + L + H        
Sbjct: 60  EIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFN 119

Query: 274 -------------------YISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG 314
                              Y+ ++  A+  L      HRD+KP+N L+       LT++ 
Sbjct: 120 KYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLAT----PLTNYR 175

Query: 315 LAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPD 374
            +        +    + + ++ +  F  F   +                + A ++ GSP 
Sbjct: 176 DSKTFHELGYVGIYNLPILKIADFGFARFLPST----------------SLAETLCGSPL 219

Query: 375 YMALEVLEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLN 434
           YMA E+L  +KY+   D WS+G +LFE   G  PF+ S+  E ++ ++     +  P + 
Sbjct: 220 YMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEVC 279

Query: 435 DGRSAISDRAWELITRLIA-DPINRL 459
           +    + D   ELI  L+  DP  R+
Sbjct: 280 E----VEDGLKELICSLLTFDPAKRI 301

>Scas_718.90
          Length = 647

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 43/190 (22%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           I  E  I +T   + +++     ++ E+  + ME+ P   F  ++ +  T +      Y 
Sbjct: 360 ITVEFCIGSTLHHQNIIETFDMLREGETFLVVMEYAPYDFFNLVMADLMTTKE--VSCYF 417

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            ++   VN LH++G  HRDLK +N ++   G +KL DFG A                   
Sbjct: 418 KQLCNGVNYLHDMGIAHRDLKLDNCVVSHNGILKLIDFGSAV------------------ 459

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWS 394
                             I+Q   +N I  A  +VGS  Y+A E+L    YD   VD WS
Sbjct: 460 ------------------IFQYPYENKIVKAQGIVGSDPYLAPELLNTSTYDPRPVDVWS 501

Query: 395 LG----CMLF 400
           +     CM+ 
Sbjct: 502 IAIIYYCMIL 511

>KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062
           Saccharomyces cerevisiae YPL141c, start by similarity
          Length = 909

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 74/178 (41%), Gaps = 42/178 (23%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGY 290
           +V L    Q+ + + + + +  GG+F   +   R L+ P A    +++   V+ +H  G 
Sbjct: 120 IVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFAQLISGVHYMHHKGL 179

Query: 291 THRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIED 350
            HRDLK EN L+D   ++ +TDFG                        EF +        
Sbjct: 180 AHRDLKLENLLLDEHENLIITDFGFVN---------------------EFSS-------- 210

Query: 351 RRKIYQNLRQNDINYANSMVGSPDYMALE-VLEGKKYDY-TVDYWSLGCMLFEALIGY 406
                    +ND+    +  GSP Y A E V+  K Y+    D WS G +L+  L GY
Sbjct: 211 ---------RNDL--MKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGY 257

>Scas_602.11
          Length = 1186

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 93/225 (41%), Gaps = 37/225 (16%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPES--LYLAMEFVPGGDFRTL---LINTRTLRSP- 269
           I  E  I+     + +VKL+    D +S  +YL +E+   G+ +      + T     P 
Sbjct: 228 IKREIAIMKKLHHKHVVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPL 287

Query: 270 ----HARFYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFG--LAAGTVSNE 323
                AR  I  +   +  LH  G  HRD+KP N L+D EG +K++DFG  LA+ +  N 
Sbjct: 288 LSFQSAREIIRGVILGLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNS 347

Query: 324 RIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQ--NDINYANSMVGSPDYMALEV- 380
              S  +     +NL     +  S E       N  +  +++  A +  G+P + A E+ 
Sbjct: 348 TANSSSVLGGTPRNL-----SRSSTESMNTTNNNDDESIDEVELAKT-AGTPAFFAPEIC 401

Query: 381 ----------------LEGKKYDYTVDYWSLGCMLFEALIGYTPF 409
                            +G    + +D W+LG   +  L G  PF
Sbjct: 402 LGEEAFDKFSLRKNEMFKGSCISFMIDIWALGITFYCLLFGMLPF 446

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 76/185 (41%), Gaps = 46/185 (24%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +LR  HAR +   +  A+  LH     HRDLK EN +I 
Sbjct: 155 FYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMIS 214

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
           + G I++ DFGL+                                     +Y   +Q   
Sbjct: 215 SSGEIRIIDFGLS------------------------------------NMYDPKKQ--- 235

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYT---VDYWSLGCMLFEALIGYTPFSGSSTNETYEN 420
              ++  GS  + A E+L  K + YT   VD WS G +L+  + G  PF   + +  +E 
Sbjct: 236 --LHTFCGSLYFAAPELL--KAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASVLHEK 291

Query: 421 LRHWK 425
           ++  K
Sbjct: 292 IKQGK 296

>KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_1
           Kluyveromyces lactis MAP kinase, start by similarity
          Length = 495

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 72/170 (42%), Gaps = 38/170 (22%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
            LYL  E +   D   ++ + + L   H + +I ++ C +  +H     HRDLKP N L+
Sbjct: 105 GLYLYEELMEC-DMHQIVKSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLV 163

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           +A+  +K+ DFGLA G                        ++E  +E+ +          
Sbjct: 164 NADCQLKICDFGLARG------------------------YSENPVENNQ---------- 189

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSG 411
             +    V +  Y A E+ L  + Y   +D WS GC+L E L G   F G
Sbjct: 190 --FLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKG 237

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 88/205 (42%), Gaps = 49/205 (23%)

Query: 231 LVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARF--YISEMFCAVNALHEL 288
           + +LL  ++D ++    +E+   GD    +   R   +    F  ++ ++  A++  H  
Sbjct: 71  ICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYCHSK 130

Query: 289 GYTHRDLKPENFLIDAEGHIKLTDFGLA-AGTVSNERIESMKIRLEEVKNLEFPAFTEKS 347
             +HRD+KPEN L+D  G +KLTDFGL+  G+VS +                        
Sbjct: 131 DVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---------------------- 168

Query: 348 IEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYD-YTVDYWSLGCMLFEALIGY 406
                                 +G+  Y+A E    + ++ +  DYWSLG  +F  + G 
Sbjct: 169 ----------------------IGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMFGS 206

Query: 407 TPFSGSSTNETYENLRHWKRTLRRP 431
            PF  +S++    +  +++R +R P
Sbjct: 207 CPFESASSDAPKRS-ANFQRFIRDP 230

>YDR283C (GCN2) [1112] chr4 complement(1025062..1030041)
           Serine/threonine protein kinase that regulates
           initiation of translation by phosphorylation of
           eIF2alpha (Sui2p), involved in general amino acid
           control response and salt tolerance [4980 bp, 1659 aa]
          Length = 1659

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 37/196 (18%)

Query: 220 RDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTL--LINTRTLRSPHARFY--I 275
           + I    R    VK + A +   +L++ ME+      RTL  LI++  L      ++   
Sbjct: 760 KSIQNVPRRRNFVKPMTAVKKKSTLFIQMEYCEN---RTLYDLIHSENLNQQRDEYWRLF 816

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            ++  A++ +H  G  HRDLKP N  ID   ++K+ DFGLA                   
Sbjct: 817 RQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLA------------------- 857

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGK-KYDYTVDYWS 394
           KN+       +S++  +   QNL  +  N   S +G+  Y+A EVL+G   Y+  +D +S
Sbjct: 858 KNV------HRSLDILKLDSQNLPGSSDNLT-SAIGTAMYVATEVLDGTGHYNEKIDMYS 910

Query: 395 LGCMLFEALIGYTPFS 410
           LG + FE +    PFS
Sbjct: 911 LGIIFFEMIY---PFS 923

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 82/206 (39%), Gaps = 30/206 (14%)

Query: 219 ERDILTTTRSEWLVKLLYAFQD-PESLYLAMEFVPGGDFRTLLINTRTL---RSPHARFY 274
           E  IL       ++K+     D   +LY+  E +PGGD  + L     L       A  +
Sbjct: 205 EAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVF 264

Query: 275 ISEMFCAVNALHELGYTHRDLKPENFLI---DAEGHIKLTDFGLAAGTVSNERIESMKIR 331
           + ++  A+  LH  G  HRDLK +N L+   +    I L DFG+A        + +MK R
Sbjct: 265 VYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA------RTVTTMKSR 318

Query: 332 LEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVD 391
           +  V         E   +  RK Y +                 +     LE + YD   D
Sbjct: 319 MFTVVGTPEYCAPEVGFKANRKAYHS-----------------FFRAATLEQQGYDSKCD 361

Query: 392 YWSLGCMLFEALIGYTPFSGSSTNET 417
            WSLG +    L G +PF G  T ++
Sbjct: 362 LWSLGVITHIMLTGISPFYGDGTEQS 387

>Kwal_56.23717
          Length = 858

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 73/183 (39%), Gaps = 42/183 (22%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
            Y+  E+V GG     +I   +LR   AR +   +  A+  LH     HRDLK EN +I 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
             G IK+ DFGL+                                     +Y   +Q   
Sbjct: 68  TSGEIKIIDFGLS------------------------------------NMYNPKKQ--- 88

Query: 364 NYANSMVGSPDYMALEVLEGKKYDYT-VDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
              ++  GS  + A E+L+   Y    VD WS G +LF  + G  PF   +++  +E ++
Sbjct: 89  --LHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIK 146

Query: 423 HWK 425
             K
Sbjct: 147 QGK 149

>Scas_688.14
          Length = 479

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 73/170 (42%), Gaps = 38/170 (22%)

Query: 243 SLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLI 302
            LYL  E +   D   ++ +++ L   H + +I ++ C +  +H     HRDLKP N L+
Sbjct: 103 GLYLYEELMEC-DMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLV 161

Query: 303 DAEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQND 362
           +A+  +K+ DFGLA G                        ++E  +E+ +          
Sbjct: 162 NADCQLKICDFGLARG------------------------YSENPVENNQ---------- 187

Query: 363 INYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSG 411
             +    V +  Y A E+ L  + Y   +D WS GC+L E L G   F G
Sbjct: 188 --FLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGKPIFKG 235

>YDL025C (YDL025C) [836] chr4 complement(405341..407203)
           Serine/threonine protein kinase with similarity to
           members of the NPR1 subfamily [1863 bp, 620 aa]
          Length = 620

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 39/195 (20%)

Query: 216 ILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYI 275
           + TE  I +T   E +V+ L    + ++  L ME+ P   F  ++ N  T        Y 
Sbjct: 354 VTTEFCIGSTLHHENIVETLDMLTEGDTYLLVMEYAPYDFFNLVMSNLMT--QDEVNCYF 411

Query: 276 SEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
            ++   VN LH +G  HRDLK +N ++  +G +KL DFG A                   
Sbjct: 412 KQLCHGVNYLHSMGLAHRDLKLDNCVVTKDGILKLIDFGSAV------------------ 453

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTV-DYWS 394
                             ++Q   ++ I  ++ +VGS  Y+A E+L+   YD  V D WS
Sbjct: 454 ------------------VFQYPYEDTIVKSHGIVGSDPYLAPELLKQTSYDPRVADVWS 495

Query: 395 LGCMLFEALIGYTPF 409
           +  + +  ++   P+
Sbjct: 496 IAIIFYCMVLKRFPW 510

>Kwal_0.96
          Length = 427

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 94/253 (37%), Gaps = 50/253 (19%)

Query: 212 ETNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHA 271
           E   +  E  IL       +VK    F+  +  Y+  +   GG+    ++         A
Sbjct: 88  ELQMLYDELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDA 147

Query: 272 RFYISEMFCAVNALHELGYTHRDLKPENFLI---DAEGHIKLTDFGLAAGTVSNERIESM 328
              + ++  AV  LH     HRDLKPEN L     A+  + L DFG+A            
Sbjct: 148 VRIVYQILKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIA------------ 195

Query: 329 KIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDY 388
               +E+K                        ND    +   GS  Y+A EV+    +  
Sbjct: 196 ----KELK------------------------NDDELIHKAAGSMGYVAPEVVTTSGHGK 227

Query: 389 TVDYWSLGCMLFEALIGYTPFSGSSTNETYE--NLRHWKRTLRRPFLNDGRSAISDRAWE 446
             D WSLG + +  L GY+PF   S     E   +     T  +P+     S IS+ A +
Sbjct: 228 PCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYW----SNISNEAKD 283

Query: 447 LITR-LIADPINR 458
            I R L  +P +R
Sbjct: 284 FILRALTVNPHDR 296

>CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces
           cerevisiae YGR040w KSS1, start by similarity
          Length = 398

 Score = 64.3 bits (155), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 85/209 (40%), Gaps = 35/209 (16%)

Query: 244 LYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLID 303
           +YL  E +   D   +L ++ TL   H ++++ ++  A+ A+H     HRDLKP N L++
Sbjct: 112 IYLVQELM-ETDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHRDLKPSNILLN 170

Query: 304 AEGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDI 363
           +   +K+ DFGLA     ++   +M                                N++
Sbjct: 171 SNCDLKICDFGLARTYDPDDDASTMN------------------------------GNNV 200

Query: 364 NYANSMVGSPDYMALEV-LEGKKYDYTVDYWSLGCMLFEALIGYTPFSGSSTNETYENLR 422
            +    V +  Y A E+ L  + Y   +D WS GC+L E L     F G    + +  L 
Sbjct: 201 GFLTEYVATRWYRAPEIMLNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGK---DYHHQLL 257

Query: 423 HWKRTLRRPFLNDGRSAISDRAWELITRL 451
               TL  P   D  +    RA E I  L
Sbjct: 258 LILDTLGTPSPEDIEAINYGRAKEYILSL 286

>CAGL0L03520g complement(401103..405446) similar to sp|Q01389
            Saccharomyces cerevisiae YJL095w BCK1, start by
            similarity
          Length = 1447

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 74/166 (44%), Gaps = 40/166 (24%)

Query: 246  LAMEFVPGGDFRTLLINTRTLRSPHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAE 305
            L +E+V GG   +L+           R   +++   +  LH  G  HRD+K +N L+D +
Sbjct: 1231 LFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQVLSGLKYLHSKGILHRDMKADNLLLDED 1290

Query: 306  GHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINY 365
            G  K++DFG++  +                                + IY N   +D+  
Sbjct: 1291 GICKISDFGISKKS--------------------------------KNIYSN---SDM-- 1313

Query: 366  ANSMVGSPDYMALEVLEGKK-YDYTVDYWSLGCMLFEALIGYTPFS 410
              +M G+  +MA E+++ K+ Y   VD WSLGC++ E   G  P+S
Sbjct: 1314 --TMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWS 1357

>CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces
           cerevisiae YOL016c CMK2 Ca2+/calmodulin-dependent
           ser/thr protein kinase, type II, hypothetical start
          Length = 442

 Score = 64.3 bits (155), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/254 (24%), Positives = 99/254 (38%), Gaps = 50/254 (19%)

Query: 219 ERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHARFYISEM 278
           E  IL   +   +V+    F+  +  Y+  +   GG+    ++         A     ++
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQI 153

Query: 279 FCAVNALHELGYTHRDLKPENFL-IDA--EGHIKLTDFGLAAGTVSNERIESMKIRLEEV 335
             AV+ +H     HRDLKPEN L ID   +  + + DFG+A              +L++ 
Sbjct: 154 LSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAK-------------QLQDN 200

Query: 336 KNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDYWSL 395
            +L F A                            GS  Y+A EVL    +    D WS+
Sbjct: 201 DDLIFKA---------------------------AGSLGYVAPEVLTNNGHGKPCDIWSI 233

Query: 396 GCMLFEALIGYTPFSGSSTNETYENLRH--WKRTLRRPFLNDGRSAISDRAWELITR-LI 452
           G +++  L GY+ F   + +   E      +  T  +P+ ++    ISD A   I R L 
Sbjct: 234 GVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDN----ISDEAKNFILRALT 289

Query: 453 ADPINRLRSFEHVK 466
            DP  R  + E +K
Sbjct: 290 LDPAERPTAAELMK 303

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,124,842
Number of extensions: 863526
Number of successful extensions: 4319
Number of sequences better than 10.0: 652
Number of HSP's gapped: 4122
Number of HSP's successfully gapped: 1007
Length of query: 557
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 450
Effective length of database: 12,891,983
Effective search space: 5801392350
Effective search space used: 5801392350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)