Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03971g54353527410.0
YJR015W51052610881e-143
YGR197C (SNG1)54747310701e-140
Scas_617.354146910131e-132
Scas_647.944942110001e-131
CAGL0G09273g5454299661e-125
CAGL0B03949g6324279331e-119
Sklu_2316.34874269211e-119
Kwal_55.221064955018961e-115
KLLA0E02134g5394288091e-101
ADL193C4654205629e-66
Scas_434.13572594369e-49
Scas_617.0d46451307e-10
Scas_634.1039299674.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03971g
         (535 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...  1060   0.0  
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   423   e-143
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   416   e-140
Scas_617.3                                                            394   e-132
Scas_647.9                                                            389   e-131
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   376   e-125
CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...   363   e-119
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             359   e-119
Kwal_55.22106                                                         349   e-115
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   316   e-101
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   221   9e-66
Scas_434.1                                                            172   9e-49
Scas_617.0d                                                            55   7e-10
Scas_634.10                                                            30   4.2  

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/535 (96%), Positives = 516/535 (96%)

Query: 1   MSNANRDRRGSVRAGLSQVHSTLNDGIYDGALPELNYADREELNDEHYGGAPSIPLEDEE 60
           MSNANRDRRGSVRAGLSQVHSTLNDGIYDGALPELNYADREELNDEHYGGAPSIPLEDEE
Sbjct: 1   MSNANRDRRGSVRAGLSQVHSTLNDGIYDGALPELNYADREELNDEHYGGAPSIPLEDEE 60

Query: 61  SIRTSNEDYSEEAKDPQAYAPGPEGDEKGXXXXXXXXXXXXXXXXXXXRFFSPNFKDQRK 120
           SIRTSNEDYSEEAKDPQAYAPGPEGDEKG                   RFFSPNFKDQRK
Sbjct: 61  SIRTSNEDYSEEAKDPQAYAPGPEGDEKGKPTQNNNPEPTNTLTKTKTRFFSPNFKDQRK 120

Query: 121 RVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPS 180
           RVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPS
Sbjct: 121 RVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPS 180

Query: 181 VSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVT 240
           VSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVT
Sbjct: 181 VSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVT 240

Query: 241 DTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLP 300
           DTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLP
Sbjct: 241 DTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLP 300

Query: 301 QLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVF 360
           QLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVF
Sbjct: 301 QLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVF 360

Query: 361 GPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWM 420
           GPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWM
Sbjct: 361 GPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWM 420

Query: 421 STYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAM 480
           STYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAM
Sbjct: 421 STYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAM 480

Query: 481 PLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKRAR 535
           PLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKRAR
Sbjct: 481 PLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKRAR 535

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 239/526 (45%), Positives = 333/526 (63%), Gaps = 37/526 (7%)

Query: 21  STLND---GIYDGALPELNYADREELND--EHYGGAPSIPLEDEESIRT-SNEDYSEEAK 74
           S+L+D     Y+    +  Y  R +++D     G A S  + D +   T S++D    ++
Sbjct: 3   SSLDDIEPTAYNNMEADEEYCRRNDIHDLSSVVGDAVSQGVPDMDGQTTDSSKDPEPNSE 62

Query: 75  DPQAYAPGPEGDEKGXXXXXXXXXXXXXXXXXXXRFFSPNFKDQRKRVAYRWLLAVFLLM 134
           D +A+ P                            FFSPN + QRK+V  +++    LL 
Sbjct: 63  DKKAFPPS------------------------SGSFFSPNLQGQRKKVLLKFVFTNCLLA 98

Query: 135 CFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRF--NDTVQFPSVSSPLYDIIAEV 192
             CFT+ VL WG LY T  Y+ + K+L VIQE  V     N ++  PS+S  L   I ++
Sbjct: 99  IICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPPVVILDNNSSMVVPSISYALPTFINKI 158

Query: 193 PLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVTDTLVRSLISADS 252
           P  W+IYN+ +FQ K++V   + +N KV+DLVY E++W A+N++ N T+TL  SLI+ D+
Sbjct: 159 PCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYDEKYWFAINIKPNATETLFESLIN-DT 217

Query: 253 DVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLPQLLGNITNGDNF 312
              FNST   +VVYE+GRD TNL S +LPV Q IE  +   YT  YLP LL NIT    +
Sbjct: 218 APLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIEEYYHTFYTLNYLPPLLTNITQVYRY 277

Query: 313 ---NPAR-VAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVFGPLHGEMS 368
              N AR +AAAG+  + Y D+RP TDR+ L  TQIG VYCLLLT FQFL++GPLH EM+
Sbjct: 278 ALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQIGVVYCLLLTFFQFLLYGPLHVEMA 337

Query: 369 RMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWMSTYLYMLA 428
           ++++ +N  IYR+ + W   FF S+F+CT +A++QVDFTK+FGR GFVVYWMST+L+MLA
Sbjct: 338 KVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIFQVDFTKSFGRGGFVVYWMSTWLFMLA 397

Query: 429 VGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAMPLHCIVGI 488
            GG NEN +ML+I + P Y+GFWILSFVILN+AP+FF +   N  YRYGY MP+H ++ I
Sbjct: 398 AGGANENAVMLVITLGPQYLGFWILSFVILNIAPSFFPLALNNNVYRYGYMMPVHNVIDI 457

Query: 489 NRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKRA 534
            RVIFFD+++ ++GRNYGIL A + LNT  +PFV K+  + L ++A
Sbjct: 458 YRVIFFDVTRRKMGRNYGILVALIALNTALLPFVGKYASRKLKQKA 503

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 206/473 (43%), Positives = 302/473 (63%), Gaps = 19/473 (4%)

Query: 67  EDYSEEAKDPQAYAPGPEG----DEKGXXXXXXXXXXXXXXXXXXXRFFSPNFKDQRKRV 122
           EDY    + P + +   EG    +EKG                     FSP  ++ RK++
Sbjct: 53  EDYRPPDEKPSSLSSVGEGGANEEEKGGNDGGPLARIQTG-------LFSPRLRNHRKKI 105

Query: 123 AYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPSVS 182
             +++L  F + C C +++ + WG  Y T  Y  + K + V+Q+      N +VQ  S+S
Sbjct: 106 LSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQDAPS---NTSVQ--SIS 160

Query: 183 SPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVTDT 242
           + +  ++A VP +W IYNATSF  K+       +++K++DL+Y E +WLALNV+ N TDT
Sbjct: 161 AIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDERYWLALNVKPNATDT 220

Query: 243 LVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLPQL 302
           L  SLIS D++ +FNS+  FE V+ESGRD +++ S +LP+ Q +E   QK Y  +YLP L
Sbjct: 221 LYNSLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLEVRLQKYYVKEYLPSL 280

Query: 303 LGNITNGD---NFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLV 359
           + NIT+ D   N N    A AG++ F YNDYRP  DR+ +   Q+G +YC+LLTV Q  +
Sbjct: 281 MSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQVGLIYCILLTVLQLSL 340

Query: 360 FGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYW 419
           +G LHGEM+R++K  ++ IYRL++ W+  F +SI +CTVSA++++DFT AFGR GFVVYW
Sbjct: 341 YGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRIDFTPAFGRGGFVVYW 400

Query: 420 MSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYA 479
           MST+L M+AVGG NENV+ L+I   P Y+  W+++++ILN++ +F+ +   N FYRYGY 
Sbjct: 401 MSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASFYPMVLNNEFYRYGYI 460

Query: 480 MPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHK 532
           MP+H  V I +VIF +++K ++GRNYGIL AWV LNT  MPF  KF  K + K
Sbjct: 461 MPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMKFAGKKMQK 513

>Scas_617.3
          Length = 541

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 193/469 (41%), Positives = 287/469 (61%), Gaps = 8/469 (1%)

Query: 70  SEEAKDPQAYAPGPEGDEKGXXXXXXXXXXXXXXXXXXXRFFSPNFKDQRKRVAYRWLLA 129
           S     PQAY P  +   K                    R +SP    QRK++  +++++
Sbjct: 70  SAAGSQPQAYNPDGQNTAKPAVTQPEENEENVPISPTKTRLYSPKLASQRKKITVKFIIS 129

Query: 130 VFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDTVQFPSVSSPLYDII 189
             LL   C +IL L WG LY+T  ++ R  ++A+IQ+D  Y   + +   SV +P+   I
Sbjct: 130 NLLLAGVCLSILSLYWGSLYQTTKHLERISIIAIIQDD--YIPPNDLNLTSVVAPVPSFI 187

Query: 190 AEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNVQGNVTDTLVRSLIS 249
            +    W +YN + FQ K+NV+    +N+++  L++ E++W+ALN+  N+T  +V SL +
Sbjct: 188 EQSTGKWHVYNQSYFQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTT 247

Query: 250 ADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLPQLLGNITNG 309
            +    FNST    VVYE+ R+ T L + +LP+ Q IE  +Q  Y  +YLP+LL  + N 
Sbjct: 248 PNEPF-FNSTQHIRVVYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNS 306

Query: 310 -----DNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLLTVFQFLVFGPLH 364
                 N   A +A  G+ +F+Y+D     DR+ +   Q+G +YCL+LTVFQ  +FGPLH
Sbjct: 307 TTTPLSNTGAANLANIGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLH 366

Query: 365 GEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGRAGFVVYWMSTYL 424
            EM++ +K  ++ IYRL V W+  FF+S+F+CTVSA++Q+DFT  FG+ GFV+YWM+TYL
Sbjct: 367 AEMAKYLKPKHIIIYRLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYL 426

Query: 425 YMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANVFYRYGYAMPLHC 484
            MLA+GG NENV+ LIIL  P Y+  W+LS++I+N++P F  +   NVFYRYGY MPLH 
Sbjct: 427 VMLALGGANENVLSLIILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQ 486

Query: 485 IVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHKR 533
            + I +V+F ++SK  +GRNYGIL AW+ +NT   P V K V KT+ KR
Sbjct: 487 ALDIFKVVFLNVSKRHMGRNYGILVAWIVVNTCLFPLVMKIVGKTVQKR 535

>Scas_647.9
          Length = 449

 Score =  389 bits (1000), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/421 (44%), Positives = 272/421 (64%), Gaps = 8/421 (1%)

Query: 116 KDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVYRFNDT 175
           K +RK V   +     +L  FCFTI VL WG+ YR      R ++LAVIQ++ +   N++
Sbjct: 2   KGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGI---NNS 58

Query: 176 VQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEFWLALNV 235
              P ++S L  ++ E P +W +YN TSF  K+     EA++++VI  V+ E +W+ALNV
Sbjct: 59  TVLP-MASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNV 117

Query: 236 QGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYT 295
           + N T  L  + I+ +    FNST  F+ V+ S RD +N    LLP+ + +E  ++  Y 
Sbjct: 118 KPNATQALFETFINPNGP-PFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYI 176

Query: 296 YQYLPQLLGNITNGDNF---NPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYCLLL 352
             Y PQ + N++  +N    N   +A AG M F+Y DYRP T+R  +    IG  YCLLL
Sbjct: 177 NTYFPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLL 236

Query: 353 TVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKAFGR 412
           T FQFLV+  LH E SR++K + +  YR+I+LW  +F  S+F+CT SA++QVDFT+AFG+
Sbjct: 237 TFFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGK 296

Query: 413 AGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGYANV 472
            GFVVYWM+T+L+M+A GG NEN + L+ L+ P ++G WILSF+ILN+ P F+ +  AN 
Sbjct: 297 GGFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANP 356

Query: 473 FYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHK 532
            YRYGY MP+H  + I RVIF D+SKH++GRN+G+L AW+ +NT ++PFV KFV K L  
Sbjct: 357 VYRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKILTN 416

Query: 533 R 533
           R
Sbjct: 417 R 417

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  376 bits (966), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/429 (43%), Positives = 280/429 (65%), Gaps = 12/429 (2%)

Query: 111 FSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQVY 170
            +P  +  +  +A+++     LL   C +I+ + WG  YRT HY+ +  +L+VIQ DQ Y
Sbjct: 106 LNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQ-DQDY 164

Query: 171 RFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGI-EAMNQKVIDLVYKEEF 229
              + +Q  S++S L  +I + P +W +YN +SF  KY +E   EA+++K+ DL+++E++
Sbjct: 165 ---NNIQ--SMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEKY 219

Query: 230 WLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGV 289
           W++LNV+   T+ L  SL + ++   FNS++ FE ++ESGRD TNL S +LP+ Q ++  
Sbjct: 220 WMSLNVKTGATEALYNSL-TDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAA 278

Query: 290 FQKVYTYQYLPQLLGNITNGDN----FNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIG 345
           + + YT  YLP +L N++   N     NP  +A +G  +FNY DYRP  DRV L   Q+G
Sbjct: 279 YVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQVG 338

Query: 346 AVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVD 405
            ++ L+LTV Q  ++GP+H +M R+ K  +  +YR  + WS  F +S+F+CTVSA+YQ+D
Sbjct: 339 LIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQID 398

Query: 406 FTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFF 465
           FT AFGR GFV+YW++T+  MLA+G  NENVI LI+   P Y+  W++S++ILN++P+F+
Sbjct: 399 FTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSFY 458

Query: 466 AIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKF 525
            +   N FYRYGYAMPLH  V I RVIF D+S+++LGRNYGIL AWV +  I  PFV K 
Sbjct: 459 PMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMKI 518

Query: 526 VLKTLHKRA 534
               +   A
Sbjct: 519 AGTKMKSNA 527

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score =  363 bits (933), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 178/427 (41%), Positives = 270/427 (63%), Gaps = 5/427 (1%)

Query: 110 FFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQV 169
            FS   KD R+R+  +++    LL  F    L L WG +Y     + R   +AVIQ D+ 
Sbjct: 171 LFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQ-DEP 229

Query: 170 YRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEF 229
           Y   D    P+++  + +II  +P +W I N+T F++ YNV   + +++KV +L++ E+F
Sbjct: 230 YTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKF 289

Query: 230 WLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGV 289
           WLA+NV+   T+   +S+    + V FNST+ F+ +YESGRD TNL S + P+    E V
Sbjct: 290 WLAVNVREGATEAFYKSVTEEGAPV-FNSTNYFQSIYESGRDPTNLKSSIYPILAKFESV 348

Query: 290 FQKVYTYQYLPQLLGNITNGD---NFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGA 346
           F+  Y   Y+P+ + NIT+ D     N A +   G    N  D RP TDRV L    +G 
Sbjct: 349 FRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGL 408

Query: 347 VYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDF 406
            Y ++ +VF   +FGP++ EM++ +K  +L+ YR+++ WS+ FF+S+F CTVSA++Q+DF
Sbjct: 409 NYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDF 468

Query: 407 TKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFA 466
           T  FG+AGFV+YWM+++L M AVG  NEN++ +I+   P Y+ +W++ + ILN+AP+ + 
Sbjct: 469 TPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYP 528

Query: 467 IGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFV 526
           +   + FYR+GYAMP+H  V I RVIF DIS+HQ+ RNYGIL AWV +NT   PFV+KF+
Sbjct: 529 LVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFI 588

Query: 527 LKTLHKR 533
            K + KR
Sbjct: 589 SKVVKKR 595

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  359 bits (921), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/426 (43%), Positives = 271/426 (63%), Gaps = 14/426 (3%)

Query: 110 FFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQV 169
           FFSP  + QRK V +++L  +  L     ++  L WG LY    ++ + ++LAVIQ+D  
Sbjct: 65  FFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNRNSHLGKVRILAVIQDDG- 123

Query: 170 YRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEF 229
                     S+   L  II   P  W +Y +  FQ KY++   + ++ K+  LV+ ++F
Sbjct: 124 ----------SLPGALPAIIDANPGGWHVYTSEQFQSKYHINETQ-IDSKIEHLVHTQKF 172

Query: 230 WLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGV 289
           W++LNV+ N T+ L  SL +  +D  F +++ FE +YESGRD TN  S +LP+ Q +E  
Sbjct: 173 WMSLNVKPNATNALHESLQNPSAD-PFVASNYFEAIYESGRDPTNFRSSILPLLQEVELS 231

Query: 290 FQKVYTYQYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAVYC 349
           FQK YT  YLP+LL + TN  N +PA +AAAG ++F   D RP ++ V L   Q+G ++C
Sbjct: 232 FQKNYTSSYLPELLSH-TNLSNASPANLAAAGNLEFCSEDMRPFSNYVLLGPLQVGLIFC 290

Query: 350 LLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFTKA 409
           +LLT FQ  +FGPLHG +S  +K +++ IYR  +  +  FF+S+F+CTVSA++QVDFT  
Sbjct: 291 VLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFFLSLFFCTVSAIFQVDFTPT 350

Query: 410 FGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAIGY 469
           FGRAGF+VYWMST+L M AVGG NENV+ LI+     Y+GFW++ +++ N++P+FF +  
Sbjct: 351 FGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGFWLVFWIVSNISPSFFPLAL 410

Query: 470 ANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKT 529
            N FYRYGY MP+H  + I +VIF +  K  LGRNYGILCAWV +N+I    V K V   
Sbjct: 411 MNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCAWVVINSILFVPVLKIVGNK 470

Query: 530 LHKRAR 535
           + + A+
Sbjct: 471 MKQNAQ 476

>Kwal_55.22106
          Length = 495

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/501 (38%), Positives = 289/501 (57%), Gaps = 20/501 (3%)

Query: 34  ELNYADREELNDEHYGGAPSIPLEDEESIRTSNEDYSEEAKDPQAYAPGPEGDEKGXXXX 93
            L+ ++    ++EH G A +I  E  E   +    Y E   DP+  A   EG+ +     
Sbjct: 5   RLSQSESRSSDEEHAGFARAIVGEGSEEGSSGERGYKE--LDPENEAGATEGELR----- 57

Query: 94  XXXXXXXXXXXXXXXRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPH 153
                           FFS   K +R+++  R+LL  FLL     ++  L WG  Y+   
Sbjct: 58  ----RVESKLSRVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATYQRSK 113

Query: 154 YVRRAKVLAVIQEDQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGI 213
           ++ + K+LAV+Q++             ++S +  +  + P +W +YN +SFQ KY V   
Sbjct: 114 HMHKVKILAVVQDE-------PGTGTGIASSIPTLAEQAPGTWHVYNTSSFQQKYGVAQD 166

Query: 214 EAMNQKVIDLVYKEEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDIT 273
           E ++ K+  LV+ +++W++LNV+ N T TL+ SL ++ +   FNS++ FE+ YESGRD T
Sbjct: 167 E-VDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRAS-PFNSSAFFELFYESGRDPT 224

Query: 274 NLPSVLLPVFQGIEGVFQKVYTYQYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPV 333
           NL S +LP+   +E  +Q +Y    LP +L NIT         VA AG M F   D RP 
Sbjct: 225 NLKSSILPIALSLESRYQNIYASTILPGILSNITQRVGDVSRNVAMAGNMVFAQVDNRPF 284

Query: 334 TDRVTLLSTQIGAVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSI 393
            D V L   Q+G +YC+LLT FQ  +FGP+H  + + +K  ++ +YR ++ +   FF+S+
Sbjct: 285 NDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNYFFLSL 344

Query: 394 FWCTVSAMYQVDFTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWIL 453
           F+C VS  +QVDFTKAFGRAGF+V WMS++L M AVGG NEN++ +I+   P Y+GFW++
Sbjct: 345 FFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYLGFWLI 404

Query: 454 SFVILNLAPAFFAIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVG 513
            +V+LN++PAF+ +   + FYRYGY  P++  VGI RV F D+ +  LGRNYGILCAW+ 
Sbjct: 405 FWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGILCAWIV 464

Query: 514 LNTISMPFVSKFVLKTLHKRA 534
           LN    PFV K  +    + A
Sbjct: 465 LNMAIFPFVMKLFVYVKKREA 485

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 168/428 (39%), Positives = 251/428 (58%), Gaps = 18/428 (4%)

Query: 109 RFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQ 168
           RFFS      R   A R+ L  FLL      +  L WG LY         K +AV+++D 
Sbjct: 123 RFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVVEDDG 182

Query: 169 VYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEE 228
                       + + +  I+      + +YN +SF+ KY  +    +++KV  LV+ ++
Sbjct: 183 -----------DMGAGVIPIMDSAIPQFFVYNTSSFRDKYGQD--VNISEKVHHLVHTKK 229

Query: 229 FWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEG 288
           FW +L V    TD  V SL + D+   FNST  FE  Y++ RD++N+ + ++P+   IE 
Sbjct: 230 FWGSLIVYPGTTDAFVDSLTTDDAPA-FNSTDYFEFFYKTARDLSNMRASIVPLLTSIET 288

Query: 289 VFQKVYTY-QYLPQLLGNITNGDNFNPARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGAV 347
            ++K + Y  Y P ++ NITN    +   ++AAG M +   D RP TD   L   Q+G +
Sbjct: 289 TYKKTFFYNDYFPSVIANITN---ISGPNLSAAGDMNWKQIDNRPFTDYTLLGPMQVGLI 345

Query: 348 YCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDFT 407
           YC+LLT FQ  +FGP H  +S ++K  ++ +YRL+  W+  FF+S+F+CTVSA++ VDFT
Sbjct: 346 YCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIFHVDFT 405

Query: 408 KAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFAI 467
            AFGR GFVVYWM+T++ M AVGG NENV+ +++   P Y+GFW++S++I+N++ +F  +
Sbjct: 406 LAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISASFVPL 465

Query: 468 GYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVL 527
             AN FYRYGY  P++  + I RVIF D  K  +GRNYGIL AW  LNT+  PFV K V 
Sbjct: 466 VLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFVMKIVG 525

Query: 528 KTLHKRAR 535
           +     A+
Sbjct: 526 QKFMNDAK 533

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  221 bits (562), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/420 (32%), Positives = 218/420 (51%), Gaps = 14/420 (3%)

Query: 109 RFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQ 168
           RF SP     RKR+   +L     L C    +  L  GVL     Y+ R  +L V+Q++ 
Sbjct: 50  RFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVVQDED 109

Query: 169 VYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEE 228
                       +S+ L          W   +  +    + +E    +++ +  L+ K  
Sbjct: 110 A----------GMSAELLRAAEHAAGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIRKHR 159

Query: 229 FWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEG 288
           +W+AL+V+   T+ L RSL    + V FNS+  F+V YE+ RD   + SV   + + +E 
Sbjct: 160 YWMALHVRPGATEALRRSLDDPGAPV-FNSSEFFKVYYETVRDFNAMGSVR-KLMETLEA 217

Query: 289 VFQKVYTYQYLPQLLGNITNGDNFNP--ARVAAAGRMKFNYNDYRPVTDRVTLLSTQIGA 346
            F+  Y   +LP  L    N  + +   + + AAG M+++Y D  P  D       Q+G 
Sbjct: 218 NFRAYYLDTWLPGELRERANTIDLSSTGSNIVAAGSMRWSYVDLGPFYDPSLYGILQVGM 277

Query: 347 VYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAMYQVDF 406
           + CLLLT FQ  +   LH E+S +++ S+L +YR IV ++    +S+F+  V  +Y +D 
Sbjct: 278 IICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIYHLDM 337

Query: 407 TKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLAPAFFA 466
            KA+GRAGF+V+WM+T+L+M A+GG NENVI +I    P ++GFW++ +++ N+ P F++
Sbjct: 338 EKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITPTFYS 397

Query: 467 IGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFV 526
           +  AN FY+YGY  P++      +V+ FD  +  L   Y +L AW  LN    P   K V
Sbjct: 398 LHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLALKIV 457

>Scas_434.1
          Length = 357

 Score =  172 bits (436), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 154/259 (59%), Gaps = 8/259 (3%)

Query: 110 FFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVIQEDQV 169
            FSP+    RK++ ++++    ++  FC T+L + WG LY T  Y  +   L V+Q++ +
Sbjct: 101 LFSPHLTQHRKKIFWKFISINAIIGLFCCTVLPIFWGCLYGTNQYFHKVHYLMVVQDEPL 160

Query: 170 YRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLVYKEEF 229
                +V  PS++S L +I+  +P +W +YN ++F   Y++     +N KV+DL+++E F
Sbjct: 161 QLGGLSV--PSMASFLPEIVPSLPGTWHVYNTSTFMDHYHLTNASDINNKVVDLIFQERF 218

Query: 230 WLALNVQGNVTDTLVRSLISADS---DVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGI 286
           W+A+NV+ N T +L++SL+   S   +  FN+T+ F+V+YE+ RD+T++ + ++ V Q +
Sbjct: 219 WVAVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQVIYETARDVTSVQAAMVLVVQEM 278

Query: 287 EGVFQKVYTYQYLPQLLGNITNGDNFN---PARVAAAGRMKFNYNDYRPVTDRVTLLSTQ 343
           E  ++++Y  QYLP +L  +   +  +   P  ++ A  + F Y DYR   +R  +    
Sbjct: 279 ESAYREIYMEQYLPTILAQMDPTNQISSLAPTSLSRATNINFQYWDYRSFYNRALMGPLL 338

Query: 344 IGAVYCLLLTVFQFLVFGP 362
            G +Y L +TVFQFL+F P
Sbjct: 339 AGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 54.7 bits (130), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 33/45 (73%)

Query: 488 INRVIFFDISKHQLGRNYGILCAWVGLNTISMPFVSKFVLKTLHK 532
           + +VIF D+ + ++GRNYGIL AW+ LNT   PF+ KFV KTL +
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTLQE 46

>Scas_634.10
          Length = 392

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 247 LISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQGIEGVFQKVYTYQYLPQLLGNI 306
           +++ D+        L    Y +   I  + S+ + V Q I G  +KV+TY+  P  + N+
Sbjct: 170 IVNEDNKATKKGNDLMVATYSTYGIICAIISMFIFVGQNIYG--KKVFTYKSNPTDIDNL 227

Query: 307 TNGDNF---NPARVAAAGR-MKFNYNDYRPVT-DRVTLL 340
            N D+    +P  V A  +  K  Y D  PVT D++TL+
Sbjct: 228 RNYDSQKADSPLPVYADKKEYKEEYRDDEPVTYDKLTLM 266

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.141    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,258,717
Number of extensions: 762359
Number of successful extensions: 2645
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2694
Number of HSP's successfully gapped: 25
Length of query: 535
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 429
Effective length of database: 12,926,601
Effective search space: 5545511829
Effective search space used: 5545511829
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)