Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03949g63259228130.0
YGR197C (SNG1)54742411281e-148
CAGL0G09273g54542010781e-140
Scas_617.354145110211e-132
Kwal_55.2210649543710141e-131
Sklu_2316.34874289961e-129
YJR015W5104259891e-127
Scas_647.94494179391e-121
KLLA0E02134g5394269461e-120
CAGL0B03971g5434299301e-118
ADL193C4654256612e-79
Scas_434.13572814644e-52
Scas_617.0d46431395e-11
CAGL0F00495g245640684.4
YJR066W (TOR1)247040676.6
CAGL0I10340g101246659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03949g
         (622 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03949g complement(387861..389759) similar to sp|P46950 Sac...  1088   0.0  
YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable t...   439   e-148
CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces c...   419   e-140
Scas_617.3                                                            397   e-132
Kwal_55.22106                                                         395   e-131
Sklu_2316.3 , Contig c2316 10494-11957 reverse complement             388   e-129
YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with sim...   385   e-127
Scas_647.9                                                            366   e-121
KLLA0E02134g complement(200436..202055) similar to sp|P46950 Sac...   369   e-120
CAGL0B03971g complement(390700..392331) similar to sp|P47090 Sac...   362   e-118
ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH] (357909..3...   259   2e-79
Scas_434.1                                                            183   4e-52
Scas_617.0d                                                            58   5e-11
CAGL0F00495g complement(45806..53176) similar to sp|P35169 Sacch...    31   4.4  
YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase invo...    30   6.6  
CAGL0I10340g 1004058..1007096 some similarities with sp|P39712 S...    30   9.5  

>CAGL0B03949g complement(387861..389759) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 or sp|P47090
           Saccharomyces cerevisiae YJR015w, hypothetical start
          Length = 632

 Score = 1088 bits (2813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/592 (90%), Positives = 537/592 (90%)

Query: 1   MFEKKLEKKYRKFNSKCWKDPADALAETIEGGLKAANXXXXXXXXXXXXDLEXXXXXXXX 60
           MFEKKLEKKYRKFNSKCWKDPADALAETIEGGLKAAN            DLE        
Sbjct: 1   MFEKKLEKKYRKFNSKCWKDPADALAETIEGGLKAANKKEEKERRMRRKDLENMSFTSSS 60

Query: 61  XXXXXXXXXXDTAKSGAGGRHKSKSPKQMYSSDDISYKSPSPGQAKPKRRKSTRTSLXXX 120
                     DTAKSGAGGRHKSKSPKQMYSSDDISYKSPSPGQAKPKRRKSTRTSL   
Sbjct: 61  DSSYSVEPKSDTAKSGAGGRHKSKSPKQMYSSDDISYKSPSPGQAKPKRRKSTRTSLSDD 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXVPAVMADDEGDVISRVSSTASQWKKKTSLFSKRMKDHR 180
                                 VPAVMADDEGDVISRVSSTASQWKKKTSLFSKRMKDHR
Sbjct: 121 SDSDSDSDDGDSSSDSDDDDDGVPAVMADDEGDVISRVSSTASQWKKKTSLFSKRMKDHR 180

Query: 181 RRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPA 240
           RRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPA
Sbjct: 181 RRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPA 240

Query: 241 LTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLAVNVREGAT 300
           LTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLAVNVREGAT
Sbjct: 241 LTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLAVNVREGAT 300

Query: 301 EAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPE 360
           EAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPE
Sbjct: 301 EAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPE 360

Query: 361 FIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSIS 420
           FIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSIS
Sbjct: 361 FIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSIS 420

Query: 421 IFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIY 480
           IFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIY
Sbjct: 421 IFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIY 480

Query: 481 WMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGY 540
           WMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGY
Sbjct: 481 WMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGY 540

Query: 541 AMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVV 592
           AMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVV
Sbjct: 541 AMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVV 592

>YGR197C (SNG1) [2147] chr7 complement(892500..894143) Probable
           transport protein, confers resistance to MNNG and
           nitrosoguanidine [1644 bp, 547 aa]
          Length = 547

 Score =  439 bits (1128), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 195/424 (45%), Positives = 297/424 (70%), Gaps = 5/424 (1%)

Query: 168 KTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQD 227
           +T LFS R+++HR++IL+KF+  +  +A   +  +S+YWGA Y      ++V +I V+QD
Sbjct: 90  QTGLFSPRLRNHRKKILSKFVLNNFFIACVCVSLISIYWGACYGTDRYFFKVKNIVVLQD 149

Query: 228 EPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDE 287
               AP  T + +++  + +++ S+PG W I N+T F   +  TN+ EID K+ +LI+DE
Sbjct: 150 ----APSNTSVQSISAIIPSLLASVPGTWHIYNATSFHRKFGTTNSTEIDRKIVDLIYDE 205

Query: 288 KFWLAVNVREGATEAFYKS-VTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFE 346
           ++WLA+NV+  AT+  Y S ++++    FNS+ +F+S++ESGRDP+++KS+I P++ + E
Sbjct: 206 RYWLALNVKPNATDTLYNSLISQDANSEFNSSIFFESVFESGRDPSSVKSTILPLMQQLE 265

Query: 347 SVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSM 406
              +  Y+K Y+P  + NITS D +  +N  N    G       D RPF DR+L+ PL +
Sbjct: 266 VRLQKYYVKEYLPSLMSNITSNDRDLNINMENWAIAGQLLFTYNDYRPFADRILMAPLQV 325

Query: 407 GLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQI 466
           GL Y I+ +V  +S++G ++ EMA+ LKP+ +  YR+LISW+ +F LS+  CTVSAIF+I
Sbjct: 326 GLIYCILLTVLQLSLYGKLHGEMARVLKPKHILIYRLLISWATYFLLSIGFCTVSAIFRI 385

Query: 467 DFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSL 526
           DFTP FG+ GFV+YWM++WLVM AVG ANEN+LS+++ +CP Y+S W++ W ILNI+ S 
Sbjct: 386 DFTPAFGRGGFVVYWMSTWLVMMAVGGANENVLSLVIAYCPPYLSIWLMTWIILNISASF 445

Query: 527 YPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNK 586
           YP+VL + FYR+GY MPIHN V IY+VIFL++++ +M RNYGIL AWVA+NT++ PF  K
Sbjct: 446 YPMVLNNEFYRYGYIMPIHNAVDIYKVIFLNLTKRKMGRNYGILVAWVALNTSLMPFCMK 505

Query: 587 FISK 590
           F  K
Sbjct: 506 FAGK 509

>CAGL0G09273g 885374..887011 similar to sp|P46950 Saccharomyces
           cerevisiae YGR197c SNG1 or sp|P47090 Saccharomyces
           cerevisiae YJR015w, hypothetical start
          Length = 545

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 194/420 (46%), Positives = 286/420 (68%), Gaps = 9/420 (2%)

Query: 170 SLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEP 229
           ++ + +++ H+  +  +F  T++LLA   +  + +YWGA Y     L++V+ ++VIQD+ 
Sbjct: 104 NILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQDQD 163

Query: 230 YTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQE-IDEKVAELIFDEK 288
           Y       I ++   +  +I+  PG W + N + F   Y + N  E +D+K+ +LIF+EK
Sbjct: 164 YNN-----IQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEK 218

Query: 289 FWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESV 348
           +W+++NV+ GATEA Y S+T+  AP FNS+ YF+ ++ESGRDPTNLKS+I PI+ + ++ 
Sbjct: 219 YWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQAA 278

Query: 349 FRSQYLKIYVPEFIKNITSPDFNET--VNTANLYGLGNFATNSYDLRPFTDRVLLGPLSM 406
           +   Y   Y+P  ++N+ S   N    VN  +L   GNF  N  D RPF DRVLL PL +
Sbjct: 279 YVQYYTSTYLPSMLRNV-SATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAPLQV 337

Query: 407 GLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQI 466
           GL + ++ +V  +S++GP++ +M +  KP+    YR  +SWS +F LSLF CTVSAI+QI
Sbjct: 338 GLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVSAIYQI 397

Query: 467 DFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSL 526
           DFT  FG+ GFVIYW+T++ VM A+G  NEN++S+I+ +CPQYM  W+I W ILNI+PS 
Sbjct: 398 DFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWIILNISPSF 457

Query: 527 YPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNK 586
           YP+VL ++FYR+GYAMP+HN V IYRVIFLD+SR+++ RNYGIL AWVAV   I PFV K
Sbjct: 458 YPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVTHIIFPFVMK 517

>Scas_617.3
          Length = 541

 Score =  397 bits (1021), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 191/451 (42%), Positives = 290/451 (64%), Gaps = 9/451 (1%)

Query: 144 PAVMADDEGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALS 203
           PAV   +E +    +S T      KT L+S ++   R++I  KFI +++LLA   +  LS
Sbjct: 89  PAVTQPEENEENVPISPT------KTRLYSPKLASQRKKITVKFIISNLLLAGVCLSILS 142

Query: 204 LYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTE 263
           LYWG++Y  + +L R+  IA+IQD+ Y  P+   + ++   V + I    G W + N + 
Sbjct: 143 LYWGSLYQTTKHLERISIIAIIQDD-YIPPNDLNLTSVVAPVPSFIEQSTGKWHVYNQSY 201

Query: 264 FKVIYNVTNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQS 323
           F+  +NV +   I+E++  LI DEK+W+A+N+    T     S+T    P FNST + + 
Sbjct: 202 FQEKFNVQDPTMINERLNALIHDEKYWIALNIGANLTMRIVNSLTTPNEPFFNSTQHIRV 261

Query: 324 IYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNT--ANLYG 381
           +YE+ R+PT L++ + PI+ + E  ++  Y   Y+PE +  + +       NT  ANL  
Sbjct: 262 VYETSREPTTLEAYMLPIIQEIELAYQDFYHTEYLPELLSKLQNSTTTPLSNTGAANLAN 321

Query: 382 LGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFY 441
           +G F  +  D+  F DR+L+ PL +GL Y ++ +VF +S+FGP++ EMAKYLKP+ +  Y
Sbjct: 322 IGKFQFDYDDILVFPDRILIAPLQVGLIYCLILTVFQLSLFGPLHAEMAKYLKPKHIIIY 381

Query: 442 RILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSI 501
           R+ +SW+ +FFLSLF CTVSAIFQIDFT  FGK GFVIYWMT++LVM A+G ANEN+LS+
Sbjct: 382 RLSVSWATYFFLSLFFCTVSAIFQIDFTVTFGKGGFVIYWMTTYLVMLALGGANENVLSL 441

Query: 502 ILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRH 561
           I+ F P+Y+  W++ W I+NI+P+  P+VL + FYR+GY MP+H  + I++V+FL++S+ 
Sbjct: 442 IILFIPEYLPLWLLSWIIMNISPTFNPMVLDNVFYRYGYMMPLHQALDIFKVVFLNVSKR 501

Query: 562 QMSRNYGILAAWVAVNTAINPFVNKFISKVV 592
            M RNYGIL AW+ VNT + P V K + K V
Sbjct: 502 HMGRNYGILVAWIVVNTCLFPLVMKIVGKTV 532

>Kwal_55.22106
          Length = 495

 Score =  395 bits (1014), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/437 (44%), Positives = 280/437 (64%), Gaps = 13/437 (2%)

Query: 151 EGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIY 210
           EG+ + RV S  S  +  T  FS R+K  RR+++ +F+  H LLA+ ++   SLYWGA Y
Sbjct: 53  EGE-LRRVESKLS--RVVTGFFSDRVKGERRKLIMRFLLNHFLLAMLIMSVFSLYWGATY 109

Query: 211 NYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNV 270
             S ++++V  +AV+QDEP T   GT I +   ++  +    PG W + N++ F+  Y V
Sbjct: 110 QRSKHMHKVKILAVVQDEPGT---GTGIAS---SIPTLAEQAPGTWHVYNTSSFQQKYGV 163

Query: 271 TNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRD 330
               E+D K+ +L+ D+K+W+++NV+  AT    +S+    A  FNS+ +F+  YESGRD
Sbjct: 164 AQ-DEVDAKIQQLVHDQKYWVSLNVKPNATSTLIESLQNSRASPFNSSAFFELFYESGRD 222

Query: 331 PTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSY 390
           PTNLKSSI PI    ES +++ Y    +P  + NIT    + + N A     GN      
Sbjct: 223 PTNLKSSILPIALSLESRYQNIYASTILPGILSNITQRVGDVSRNVAMA---GNMVFAQV 279

Query: 391 DLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMF 450
           D RPF D VLLGPL +GL Y I+ + F +++FGP++  + + LKP  +  YR +I++  +
Sbjct: 280 DNRPFNDYVLLGPLQVGLIYCILLTFFQLALFGPIHALLGQKLKPVHMLLYRYVIAFVNY 339

Query: 451 FFLSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYM 510
           FFLSLF C VS  FQ+DFT  FG+AGF++ WM+SWL+M AVG ANEN+L+II+ F PQY+
Sbjct: 340 FFLSLFFCLVSLAFQVDFTKAFGRAGFMVAWMSSWLLMAAVGGANENMLTIIMAFGPQYL 399

Query: 511 SYWMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGIL 570
            +W+I W +LNI+P+ YP+ L   FYR+GY  PI+NGV I+RV FLD+ R  + RNYGIL
Sbjct: 400 GFWLIFWVVLNISPAFYPMELTHNFYRYGYMTPIYNGVGIFRVTFLDLYRGHLGRNYGIL 459

Query: 571 AAWVAVNTAINPFVNKF 587
            AW+ +N AI PFV K 
Sbjct: 460 CAWIVLNMAIFPFVMKL 476

>Sklu_2316.3 , Contig c2316 10494-11957 reverse complement
          Length = 487

 Score =  388 bits (996), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 187/428 (43%), Positives = 281/428 (65%), Gaps = 17/428 (3%)

Query: 155 ISRVSST--ASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNY 212
           +S V+S    S  +  TS FS R++  R+ +  +F+   + LA   I   SLYWGA+YN 
Sbjct: 47  LSEVASNDGGSLQRMATSFFSPRLQAQRKHVWFQFLFNILALAALTISVFSLYWGALYNR 106

Query: 213 SGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTN 272
           + +L +V  +AVIQD      DG++  AL      II++ PG W +  S +F+  Y++ N
Sbjct: 107 NSHLGKVRILAVIQD------DGSLPGALPA----IIDANPGGWHVYTSEQFQSKYHI-N 155

Query: 273 AQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPT 332
             +ID K+  L+  +KFW+++NV+  AT A ++S+    A  F ++NYF++IYESGRDPT
Sbjct: 156 ETQIDSKIEHLVHTQKFWMSLNVKPNATNALHESLQNPSADPFVASNYFEAIYESGRDPT 215

Query: 333 NLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDL 392
           N +SSI P+L + E  F+  Y   Y+PE + +    +     + ANL   GN    S D+
Sbjct: 216 NFRSSILPLLQEVELSFQKNYTSSYLPELLSHTNLSN----ASPANLAAAGNLEFCSEDM 271

Query: 393 RPFTDRVLLGPLSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFF 452
           RPF++ VLLGPL +GL + ++ + F +++FGP++  ++  LKP  +  YR  IS + +FF
Sbjct: 272 RPFSNYVLLGPLQVGLIFCVLLTFFQLAMFGPLHGMVSPKLKPAHILIYRYCISMTAYFF 331

Query: 453 LSLFTCTVSAIFQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSY 512
           LSLF CTVSAIFQ+DFTP FG+AGF++YWM++WL+M AVG ANEN+LS+IL +  QY+ +
Sbjct: 332 LSLFFCTVSAIFQVDFTPTFGRAGFMVYWMSTWLIMAAVGGANENVLSLILPYGAQYLGF 391

Query: 513 WMIIWTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAA 572
           W++ W + NI+PS +PL L++ FYR+GY MPIHN + IY+VIFL+  +  + RNYGIL A
Sbjct: 392 WLVFWIVSNISPSFFPLALMNNFYRYGYMMPIHNAMDIYKVIFLNTYKGTLGRNYGILCA 451

Query: 573 WVAVNTAI 580
           WV +N+ +
Sbjct: 452 WVVINSIL 459

>YJR015W (YJR015W) [2918] chr10 (462635..464167) Protein with
           similarity to Sng1p and multidrug resistance proteins
           [1533 bp, 510 aa]
          Length = 510

 Score =  385 bits (989), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/425 (44%), Positives = 280/425 (65%), Gaps = 4/425 (0%)

Query: 170 SLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEP 229
           S FS  ++  R+++L KF+ T+ LLAI       L+WGA+Y+ S  L++V  + VIQ+ P
Sbjct: 73  SFFSPNLQGQRKKVLLKFVFTNCLLAIICFTMFVLFWGALYDTSKYLHKVKLLVVIQEPP 132

Query: 230 YTAPDGT---VIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFD 286
               D     V+P+++  +   IN IP +W I NS  F+  ++V   Q++++KV +L++D
Sbjct: 133 VVILDNNSSMVVPSISYALPTFINKIPCDWDIYNSPTFQAKFDVNTPQQVNDKVVDLVYD 192

Query: 287 EKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFE 346
           EK+W A+N++  ATE  ++S+  + AP+FNST + Q +YE+GRDPTNLKS+I P+    E
Sbjct: 193 EKYWFAINIKPNATETLFESLINDTAPLFNSTLFNQVVYETGRDPTNLKSTILPVAQTIE 252

Query: 347 SVFRSQYLKIYVPEFIKNITSP-DFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLS 405
             + + Y   Y+P  + NIT    +  T N   +   G +    YD RPFTDR+LL P  
Sbjct: 253 EYYHTFYTLNYLPPLLTNITQVYRYALTNNARYIAAAGKYNYEYYDHRPFTDRILLAPTQ 312

Query: 406 MGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQ 465
           +G+ Y ++ + F   ++GP++ EMAK L+P +   YRI +SW  FFF SLF CT +AIFQ
Sbjct: 313 IGVVYCLLLTFFQFLLYGPLHVEMAKVLRPANGLIYRIAMSWFTFFFASLFFCTTTAIFQ 372

Query: 466 IDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPS 525
           +DFT  FG+ GFV+YWM++WL M A G ANEN + +++T  PQY+ +W++ + ILNIAPS
Sbjct: 373 VDFTKSFGRGGFVVYWMSTWLFMLAAGGANENAVMLVITLGPQYLGFWILSFVILNIAPS 432

Query: 526 LYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVN 585
            +PL L +  YR+GY MP+HN + IYRVIF D++R +M RNYGIL A +A+NTA+ PFV 
Sbjct: 433 FFPLALNNNVYRYGYMMPVHNVIDIYRVIFFDVTRRKMGRNYGILVALIALNTALLPFVG 492

Query: 586 KFISK 590
           K+ S+
Sbjct: 493 KYASR 497

>Scas_647.9
          Length = 449

 Score =  366 bits (939), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 166/417 (39%), Positives = 264/417 (63%), Gaps = 3/417 (0%)

Query: 176 MKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVIQDEPYTAPDG 235
           MK  R+ +L  F  T+ +LA+F      L+WG  Y  +   +RV  +AVIQDE     + 
Sbjct: 1   MKGERKNVLINFAFTNGVLAVFCFTIFVLFWGINYRITDKYHRVQILAVIQDEGIN--NS 58

Query: 236 TVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIFDEKFWLAVNV 295
           TV+P +   +  ++   P  W + N+T F   +   + + ID++V   +F E +W+A+NV
Sbjct: 59  TVLP-MASILPTLMQENPATWHLYNTTSFNEKFGTNSTEAIDKEVIHEVFSEHYWMALNV 117

Query: 296 REGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKFESVFRSQYLK 355
           +  AT+A +++      P FNST YFQ+++ S RDP+N + ++ P++   E+ +R+ Y+ 
Sbjct: 118 KPNATQALFETFINPNGPPFNSTEYFQAVFLSARDPSNFRVTLLPLIEFLETAYRNYYIN 177

Query: 356 IYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPLSMGLNYNIMFS 415
            Y P+F+ N++  +   TVN  N+   G    + +D RPFT+R L+ P+ +G+ Y ++ +
Sbjct: 178 TYFPQFMSNVSIANNLTTVNVTNIALAGAMNFDYFDYRPFTERELIAPVMIGVAYCLLLT 237

Query: 416 VFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIFQIDFTPGFGKA 475
            F   ++  ++ E ++ LKP  + +YRI++ W   F  SLF CT SAIFQ+DFT  FGK 
Sbjct: 238 FFQFLVYSGLHAETSRLLKPNQVIYYRIIMLWCTMFIASLFFCTTSAIFQVDFTRAFGKG 297

Query: 476 GFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAPSLYPLVLISRF 535
           GFV+YWMT+WL M A G  NEN +S++    P+++  W++ + ILNI P+ YPL+L +  
Sbjct: 298 GFVVYWMTTWLFMVACGGTNENAVSLLFLMGPRFLGIWILSFIILNITPTFYPLILANPV 357

Query: 536 YRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVV 592
           YR+GY MP+HN + IYRVIFLD+S+H+M RN+G+L AW+A+NTA  PFV KF+SK++
Sbjct: 358 YRYGYMMPVHNAIDIYRVIFLDLSKHKMGRNFGLLIAWIAMNTAALPFVYKFVSKIL 414

>KLLA0E02134g complement(200436..202055) similar to sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1 involved in
           nitroguanidine resistance, start by similarity
          Length = 539

 Score =  369 bits (946), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 183/426 (42%), Positives = 265/426 (62%), Gaps = 19/426 (4%)

Query: 166 KKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVI 225
           + KT  FS ++  HR     +F     LL    I   SLYWGA+YN+S + + V  IAV+
Sbjct: 119 RVKTRFFSSKLSTHRNIFARRFALNCFLLGSLAIAMFSLYWGALYNHSSDYHNVKFIAVV 178

Query: 226 QDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIF 285
           +D+        VIP        I++S    + + N++ F+  Y       I EKV  L+ 
Sbjct: 179 EDDGDMG--AGVIP--------IMDSAIPQFFVYNTSSFRDKYG--QDVNISEKVHHLVH 226

Query: 286 DEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKF 345
            +KFW ++ V  G T+AF  S+T + AP FNST+YF+  Y++ RD +N+++SI P+L   
Sbjct: 227 TKKFWGSLIVYPGTTDAFVDSLTTDDAPAFNSTDYFEFFYKTARDLSNMRASIVPLLTSI 286

Query: 346 ESVFRSQYL-KIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPL 404
           E+ ++  +    Y P  I NIT+      ++  NL   G+      D RPFTD  LLGP+
Sbjct: 287 ETTYKKTFFYNDYFPSVIANITN------ISGPNLSAAGDMNWKQIDNRPFTDYTLLGPM 340

Query: 405 SMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIF 464
            +GL Y I+ + F +++FGP +  ++  LKP+ +  YR++ SW+ +FFLSLF CTVSAIF
Sbjct: 341 QVGLIYCILLTFFQLALFGPFHAMLSPLLKPKHIILYRLVTSWATYFFLSLFFCTVSAIF 400

Query: 465 QIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAP 524
            +DFT  FG+ GFV+YWMT+W++M AVG ANEN+LSI+L +CPQY+ +W+I W I+NI+ 
Sbjct: 401 HVDFTLAFGRGGFVVYWMTTWILMGAVGGANENVLSILLAYCPQYLGFWLISWIIINISA 460

Query: 525 SLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFV 584
           S  PLVL +RFYR+GY  PI+N ++IYRVIF D  +  M RNYGILAAW  +NT + PFV
Sbjct: 461 SFVPLVLANRFYRYGYMTPIYNAMEIYRVIFTDTYKGDMGRNYGILAAWCVLNTLLFPFV 520

Query: 585 NKFISK 590
            K + +
Sbjct: 521 MKIVGQ 526

>CAGL0B03971g complement(390700..392331) similar to sp|P47090
           Saccharomyces cerevisiae YJR015w or sp|P46950
           Saccharomyces cerevisiae YGR197c SNG1, hypothetical
           start
          Length = 543

 Score =  362 bits (930), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 179/429 (41%), Positives = 271/429 (63%), Gaps = 5/429 (1%)

Query: 166 KKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVI 225
           K KT  FS   KD R+R+  +++    LL  F    L L WG +Y     + R   +AVI
Sbjct: 105 KTKTRFFSPNFKDQRKRVAYRWLLAVFLLMCFCFTILVLMWGVLYRTPHYVRRAKVLAVI 164

Query: 226 Q-DEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELI 284
           Q D+ Y   D    P+++  + +II  +P +W I N+T F++ YNV   + +++KV +L+
Sbjct: 165 QEDQVYRFNDTVQFPSVSSPLYDIIAEVPLSWEIYNATSFQIKYNVEGIEAMNQKVIDLV 224

Query: 285 FDEKFWLAVNVREGATEAFYKSVTEEGAPV-FNSTNYFQSIYESGRDPTNLKSSIYPILA 343
           + E+FWLA+NV+   T+   +S+    + V FNST+ F+ +YESGRD TNL S + P+  
Sbjct: 225 YKEEFWLALNVQGNVTDTLVRSLISADSDVQFNSTSLFEVVYESGRDITNLPSVLLPVFQ 284

Query: 344 KFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGP 403
             E VF+  Y   Y+P+ + NIT+ D     N A +   G    N  D RP TDRV L  
Sbjct: 285 GIEGVFQKVYTYQYLPQLLGNITNGD---NFNPARVAAAGRMKFNYNDYRPVTDRVTLLS 341

Query: 404 LSMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAI 463
             +G  Y ++ +VF   +FGP++ EM++ +K  +L+ YR+++ WS+ FF+S+F CTVSA+
Sbjct: 342 TQIGAVYCLLLTVFQFLVFGPLHGEMSRMIKFSNLWIYRLIVLWSVLFFVSIFWCTVSAM 401

Query: 464 FQIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIA 523
           +Q+DFT  FG+AGFV+YWM+++L M AVG  NEN++ +I+   P Y+ +W++ + ILN+A
Sbjct: 402 YQVDFTKAFGRAGFVVYWMSTYLYMLAVGGLNENVIMLIILISPSYIGFWILSFVILNLA 461

Query: 524 PSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPF 583
           P+ + +   + FYR+GYAMP+H  V I RVIF DIS+HQ+ RNYGIL AWV +NT   PF
Sbjct: 462 PAFFAIGYANVFYRYGYAMPLHCIVGINRVIFFDISKHQLGRNYGILCAWVGLNTISMPF 521

Query: 584 VNKFISKVV 592
           V+KF+ K +
Sbjct: 522 VSKFVLKTL 530

>ADL193C [1548] [Homologous to ScYGR197C (SNG1) - NSH]
           (357909..359306) [1398 bp, 465 aa]
          Length = 465

 Score =  259 bits (661), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 137/425 (32%), Positives = 236/425 (55%), Gaps = 13/425 (3%)

Query: 166 KKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWGAIYNYSGNLYRVHSIAVI 225
           + KT   S R+   R+R+L  F+S  + LA  V+   SL+ G + N    L R+  + V+
Sbjct: 46  RLKTRFMSPRVYLARKRLLVLFLSNKLFLACLVLVVFSLHVGVLVNQQQYLGRLPMLMVV 105

Query: 226 QDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVIYNVTNAQEIDEKVAELIF 285
           QDE     D  +   L R   +      G W  ++       + +    ++DE +  LI 
Sbjct: 106 QDE-----DAGMSAELLRAAEHA----AGRWTTVHGAAAWSHFGLEEDADLDEYLQSLIR 156

Query: 286 DEKFWLAVNVREGATEAFYKSVTEEGAPVFNSTNYFQSIYESGRDPTNLKSSIYPILAKF 345
             ++W+A++VR GATEA  +S+ + GAPVFNS+ +F+  YE+ RD  N   S+  ++   
Sbjct: 157 KHRYWMALHVRPGATEALRRSLDDPGAPVFNSSEFFKVYYETVRD-FNAMGSVRKLMETL 215

Query: 346 ESVFRSQYLKIYVP-EFIKNITSPDFNETVNTANLYGLGNFATNSYDLRPFTDRVLLGPL 404
           E+ FR+ YL  ++P E  +   + D + T   +N+   G+   +  DL PF D  L G L
Sbjct: 216 EANFRAYYLDTWLPGELRERANTIDLSST--GSNIVAAGSMRWSYVDLGPFYDPSLYGIL 273

Query: 405 SMGLNYNIMFSVFSISIFGPVNKEMAKYLKPRSLFFYRILISWSMFFFLSLFTCTVSAIF 464
            +G+   ++ + F +++   ++ E++  L+   L  YR ++S++ +  LSLF   V  I+
Sbjct: 274 QVGMIICLLLTFFQLAMISALHTELSLLLRTSHLLLYRYIVSYASYLLLSLFYSIVPIIY 333

Query: 465 QIDFTPGFGKAGFVIYWMTSWLVMTAVGMANENILSIILTFCPQYMSYWMIIWTILNIAP 524
            +D    +G+AGF+++WMT+WL MTA+G ANEN++S+I  +CP+++ +W++ W + NI P
Sbjct: 334 HLDMEKAYGRAGFLVFWMTTWLFMTALGGANENVISVIFEYCPRFVGFWLMFWIVFNITP 393

Query: 525 SLYPLVLISRFYRFGYAMPIHNGVQIYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFV 584
           + Y L L + FY++GY  PI+N  + Y+V+  D  R  +   Y +L AW  +N A+ P  
Sbjct: 394 TFYSLHLANDFYKYGYITPIYNARECYKVLLFDTDRGYLKVAYVVLVAWTVLNAALFPLA 453

Query: 585 NKFIS 589
            K ++
Sbjct: 454 LKIVN 458

>Scas_434.1
          Length = 357

 Score =  183 bits (464), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 162/281 (57%), Gaps = 8/281 (2%)

Query: 148 ADDEGDVISRVSSTASQWKKKTSLFSKRMKDHRRRILAKFISTHILLAIFVIGALSLYWG 207
            +DE   I+ +   A     KT+LFS  +  HR++I  KFIS + ++ +F    L ++WG
Sbjct: 81  GEDEAITIASLPELA---PAKTTLFSPHLTQHRKKIFWKFISINAIIGLFCCTVLPIFWG 137

Query: 208 AIYNYSGNLYRVHSIAVIQDEPYTAPDGTVIPALTRNVTNIINSIPGNWRIMNSTEFKVI 267
            +Y  +   ++VH + V+QDEP     G  +P++   +  I+ S+PG W + N++ F   
Sbjct: 138 CLYGTNQYFHKVHYLMVVQDEPLQL-GGLSVPSMASFLPEIVPSLPGTWHVYNTSTFMDH 196

Query: 268 YNVTNAQEIDEKVAELIFDEKFWLAVNVREGATEAFYKSVTEEGAP----VFNSTNYFQS 323
           Y++TNA +I+ KV +LIF E+FW+AVNV+  AT +  +S+ +  +     +FN+TN+FQ 
Sbjct: 197 YHLTNASDINNKVVDLIFQERFWVAVNVKPNATASLMQSLVQPQSTTPETLFNATNFFQV 256

Query: 324 IYESGRDPTNLKSSIYPILAKFESVFRSQYLKIYVPEFIKNITSPDFNETVNTANLYGLG 383
           IYE+ RD T++++++  ++ + ES +R  Y++ Y+P  +  +   +   ++   +L    
Sbjct: 257 IYETARDVTSVQAAMVLVVQEMESAYREIYMEQYLPTILAQMDPTNQISSLAPTSLSRAT 316

Query: 384 NFATNSYDLRPFTDRVLLGPLSMGLNYNIMFSVFSISIFGP 424
           N     +D R F +R L+GPL  G  Y++  +VF   IF P
Sbjct: 317 NINFQYWDYRSFYNRALMGPLLAGTIYSLTITVFQFLIFTP 357

>Scas_617.0d
          Length = 46

 Score = 58.2 bits (139), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 32/43 (74%)

Query: 550 IYRVIFLDISRHQMSRNYGILAAWVAVNTAINPFVNKFISKVV 592
           +Y+VIF D+ R +M RNYGIL AW+ +NT + PF+ KF+ K +
Sbjct: 2   VYKVIFCDLERSKMGRNYGILVAWIVLNTCLFPFIMKFVGKTL 44

>CAGL0F00495g complement(45806..53176) similar to sp|P35169
            Saccharomyces cerevisiae YJR066w TOR1
            phosphatidylinositol 3-kinase, hypothetical start
          Length = 2456

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%)

Query: 517  WTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFL 556
            W +L +AP    L L+ +   F YA+    G  +Y++++L
Sbjct: 2189 WVMLQMAPDFDNLTLLQKIEVFTYALDSTKGQDLYKILWL 2228

>YJR066W (TOR1) [2960] chr10 (559330..566742) Protein kinase involved
            in regulation of cell growth and sensitivity to the
            immunosuppressant rapamycin, has a region of similarity
            to the catalytic domain of phosphatidylinositol kinases
            [7413 bp, 2470 aa]
          Length = 2470

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%)

Query: 517  WTILNIAPSLYPLVLISRFYRFGYAMPIHNGVQIYRVIFL 556
            W +L +AP    L L+ +   F YA+    G  +Y++++L
Sbjct: 2203 WVMLQMAPDYENLTLLQKIEVFTYALDNTKGQDLYKILWL 2242

>CAGL0I10340g 1004058..1007096 some similarities with sp|P39712
           Saccharomyces cerevisiae YAL063c FLO9, hypothetical
           start
          Length = 1012

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 302 AFYKSVTEEGAPVFNSTNY-FQSIYESGRDPTNLKSSIYPILAKFE 346
           ++Y + T++G+P+  ST    ++IY    +P  +   I P L  +E
Sbjct: 299 SYYSTTTDDGSPIIASTTLTIRTIYSEAPEPITITIEIQPGLTNYE 344

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,460,654
Number of extensions: 707491
Number of successful extensions: 2165
Number of sequences better than 10.0: 23
Number of HSP's gapped: 2202
Number of HSP's successfully gapped: 23
Length of query: 622
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 514
Effective length of database: 12,857,365
Effective search space: 6608685610
Effective search space used: 6608685610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)