Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03927g1961937172e-97
Scas_647.81971726243e-83
YJR014W1981756183e-82
Sklu_1575.21911735932e-78
Kwal_33.154611961725714e-75
ACL112C1991735462e-71
KLLA0F21934g2001725421e-70
Kwal_26.9460100253651.8
Sklu_2263.7101643615.0
CAGL0G06226g131837615.6
CAGL0B01837g56946608.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03927g
         (193 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03927g 386875..387465 highly similar to sp|P47089 Saccharo...   280   2e-97
Scas_647.8                                                            244   3e-83
YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with sim...   242   3e-82
Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement        233   2e-78
Kwal_33.15461                                                         224   4e-75
ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [6...   214   2e-71
KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces...   213   1e-70
Kwal_26.9460                                                           30   1.8  
Sklu_2263.7 YGR274C, Contig c2263 8141-11191 reverse complement        28   5.0  
CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces c...    28   5.6  
CAGL0B01837g complement(166953..168662) similar to tr|Q04600 Sac...    28   8.0  

>CAGL0B03927g 386875..387465 highly similar to sp|P47089
           Saccharomyces cerevisiae YJR014w, start by similarity
          Length = 196

 Score =  280 bits (717), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 146/193 (75%), Positives = 146/193 (75%)

Query: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXX 60
           MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLY                 
Sbjct: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYSEDDAAAASLSAKLAES 60

Query: 61  XIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE 120
            IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE
Sbjct: 61  SIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE 120

Query: 121 IDMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGMXXXXXXX 180
           IDMKKLAKTFASKFATGCSVSKNAEKK              AYIHSLLEEKGM       
Sbjct: 121 IDMKKLAKTFASKFATGCSVSKNAEKKEEVVVQGDVLDEVVAYIHSLLEEKGMKDVKVET 180

Query: 181 XXXXXXXXPEATP 193
                   PEATP
Sbjct: 181 IDTKKKKKPEATP 193

>Scas_647.8
          Length = 197

 Score =  244 bits (624), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 135/172 (78%)

Query: 2   LKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXXX 61
           L+EVVYCGVC+YP +YCEF+GKLKRCKVWLKENH DL+ KLY                  
Sbjct: 3   LQEVVYCGVCSYPPEYCEFTGKLKRCKVWLKENHPDLFTKLYGDDNGDVAAVAGKLAESS 62

Query: 62  IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFEI 121
           IGE REEKLEKDL KLQTKQEN+EQRELAKKLSSKVI+KREARTKRK+I+AISGLEVFEI
Sbjct: 63  IGEEREEKLEKDLLKLQTKQENREQRELAKKLSSKVIIKREARTKRKFIIAISGLEVFEI 122

Query: 122 DMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           DMKKLAKTFASKFATGCSVSKNAEKK              AYIHSLL+EKG+
Sbjct: 123 DMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVLEAVEAYIHSLLKEKGL 174

>YJR014W (YJR014W) [2917] chr10 (461743..462339) Protein with
           similarity to human DENR/DRP density-regulated protein
           [597 bp, 198 aa]
          Length = 198

 Score =  242 bits (618), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 135/175 (77%), Gaps = 2/175 (1%)

Query: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXX--X 58
           ML+EV+YCG+C+YP +YCEFSGKLKRCKVWL ENHADLY KLY                 
Sbjct: 1   MLREVIYCGICSYPPEYCEFSGKLKRCKVWLSENHADLYAKLYGTDDNTQEVEAVTNKLA 60

Query: 59  XXXIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEV 118
              IGEAREEKLEKDL K+Q KQEN+EQRELAKKLSSKVI+KREARTKRK+IVAISGLEV
Sbjct: 61  ESSIGEAREEKLEKDLLKIQKKQENREQRELAKKLSSKVIIKREARTKRKFIVAISGLEV 120

Query: 119 FEIDMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           F+IDMKKLAKTFAS+FATGCSVSKNAEKK               YIHSLLEEKG+
Sbjct: 121 FDIDMKKLAKTFASRFATGCSVSKNAEKKEEVVIQGDVMDEVETYIHSLLEEKGL 175

>Sklu_1575.2 YJR014W, Contig c1575 2478-3053 reverse complement
          Length = 191

 Score =  233 bits (593), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 134/173 (77%), Gaps = 1/173 (0%)

Query: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXX 60
           MLK VVYCGVC+ P +YCEF+GKLKRCKVWLKENHADL+++LY                 
Sbjct: 1   MLKTVVYCGVCSLPPEYCEFTGKLKRCKVWLKENHADLFNQLYPADCEVDDVATKLGNSS 60

Query: 61  XIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE 120
            IG AREEKLEKDL +LQ KQE++EQRELAKKLSSKV++KREARTKRK ++AISGLEVFE
Sbjct: 61  -IGGAREEKLEKDLLRLQAKQESREQRELAKKLSSKVVIKREARTKRKCMIAISGLEVFE 119

Query: 121 IDMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           IDMKKLAKTFASKFATGCSVSKNAEKK              AYIHSLLEEKG+
Sbjct: 120 IDMKKLAKTFASKFATGCSVSKNAEKKEEIVVQGDVADEVEAYIHSLLEEKGL 172

>Kwal_33.15461
          Length = 196

 Score =  224 bits (571), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 115/172 (66%), Positives = 129/172 (75%), Gaps = 2/172 (1%)

Query: 2   LKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXXX 61
           L++V+YCGVC++P D+CEF+GKLKRCKVWL ENH++ Y  LY                  
Sbjct: 3   LRKVIYCGVCSFPPDFCEFTGKLKRCKVWLSENHSEKYQALYGDQEVEEAAANLAGSS-- 60

Query: 62  IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFEI 121
           IGE REEKLEKDL KLQ+KQEN+EQRELAKKLSSKVI+KREARTKRK +VAISGLEVFEI
Sbjct: 61  IGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREARTKRKTMVAISGLEVFEI 120

Query: 122 DMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           DMKKLAKTFASKFATGCSVSKN EKK              AYI  LLEEKG+
Sbjct: 121 DMKKLAKTFASKFATGCSVSKNVEKKEEIIIQGDVADEAEAYIQKLLEEKGL 172

>ACL112C [937] [Homologous to ScYJR014W - SH] (148437..149036) [600
           bp, 199 aa]
          Length = 199

 Score =  214 bits (546), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 129/173 (74%)

Query: 1   MLKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXX 60
           MLK+VVYCGVC+ P +YCEF+GK++RCKVWL E+  +L+ +LY                 
Sbjct: 1   MLKKVVYCGVCSLPPEYCEFTGKIRRCKVWLHEHDQELFAQLYGDDKEDVDGVAARLGQS 60

Query: 61  XIGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFE 120
            IGE REE+LEK LQKLQ ++E+KEQRELA+KLSS+V+++REARTKRK +V ++GLEVFE
Sbjct: 61  SIGEEREEQLEKKLQKLQAREESKEQRELARKLSSRVVIRREARTKRKCMVVVAGLEVFE 120

Query: 121 IDMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           IDMKKLAKTFASKFATGCSVSKN EKK              AYIH+LLEEKGM
Sbjct: 121 IDMKKLAKTFASKFATGCSVSKNVEKKEEVVVQGDIADEVEAYIHALLEEKGM 173

>KLLA0F21934g 2039116..2039718 similar to sp|P47089 Saccharomyces
           cerevisiae YJR014w singleton, start by similarity
          Length = 200

 Score =  213 bits (542), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 126/172 (73%), Gaps = 3/172 (1%)

Query: 2   LKEVVYCGVCTYPIDYCEFSGKLKRCKVWLKENHADLYDKLYXXXXXXXXXXXXXXXXXX 61
           L  V+YCGVC +P +YCEFSGK KRCK WL+ENH +LY K Y                  
Sbjct: 3   LTNVIYCGVCDFPAEYCEFSGKFKRCKAWLQENHPELYTKWYGDVTEDVSKQLAESS--- 59

Query: 62  IGEAREEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRKYIVAISGLEVFEI 121
           IG+ REEKLEK L+KL+ KQ+ +E+RELAKKLSSKV+++REARTKRK ++AISGLEVFEI
Sbjct: 60  IGDEREEKLEKALEKLERKQQAREERELAKKLSSKVVIRREARTKRKCMIAISGLEVFEI 119

Query: 122 DMKKLAKTFASKFATGCSVSKNAEKKXXXXXXXXXXXXXXAYIHSLLEEKGM 173
           DMKKL+KTFASKFATGCS+SKNAEKK              AYIHSLLEEKGM
Sbjct: 120 DMKKLSKTFASKFATGCSISKNAEKKEEVIVQGDLADEVEAYIHSLLEEKGM 171

>Kwal_26.9460
          Length = 1002

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 63  GEAREEK-------LEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRK 108
           GE  EEK       LE+ L KLQ  QE ++ R+LAK+ +      +   T R+
Sbjct: 899 GENTEEKQLKQKKLLEEQLAKLQKSQERRQARKLAKEKTKDGKAAKARNTNRR 951

>Sklu_2263.7 YGR274C, Contig c2263 8141-11191 reverse complement
          Length = 1016

 Score = 28.1 bits (61), Expect = 5.0,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 25/43 (58%)

Query: 66  REEKLEKDLQKLQTKQENKEQRELAKKLSSKVIVKREARTKRK 108
           +++ LE+ L +LQ  QE +  R++AK+ S    V +   T R+
Sbjct: 920 QKKLLEEQLARLQKSQERRHARKMAKEKSKDGKVSKAKNTTRR 962

>CAGL0G06226g 592179..596135 similar to sp|P07866 Saccharomyces
           cerevisiae YAL024c LTE1, start by similarity
          Length = 1318

 Score = 28.1 bits (61), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 100 KREARTKR--KYIVAISGLEVFEIDMKKLAKTFASKF 134
           KREA      KY+++IS L   E D+K+L +   SKF
Sbjct: 394 KREAELDNFVKYVISISSLTNKEEDLKRLNENLDSKF 430

>CAGL0B01837g complement(166953..168662) similar to tr|Q04600
           Saccharomyces cerevisiae YDR117c, start by similarity
          Length = 569

 Score = 27.7 bits (60), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%)

Query: 96  KVIVKREARTKRKYIVAISGLEVFEIDMKKLAKTFASKFATGCSVS 141
           K+ +  E +  RK I  +S  EVF+ID     + FA+     CS S
Sbjct: 475 KINIVTEMKIGRKVITKVSNFEVFQID----PEEFAADIRKKCSGS 516

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,356,579
Number of extensions: 141105
Number of successful extensions: 1535
Number of sequences better than 10.0: 79
Number of HSP's gapped: 1502
Number of HSP's successfully gapped: 84
Length of query: 193
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 97
Effective length of database: 13,272,781
Effective search space: 1287459757
Effective search space used: 1287459757
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 58 (26.9 bits)