Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03905g43142420880.0
YJR013W40341210881e-147
Kwal_33.1544939639110791e-145
Scas_647.642341310771e-145
ACR034W3973959851e-131
KLLA0D09647g4023859811e-130
KLLA0A06534g43564730.54
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03905g
         (424 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces c...   808   0.0  
YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with mod...   423   e-147
Kwal_33.15449                                                         420   e-145
Scas_647.6                                                            419   e-145
ACR034W [1082] [Homologous to ScYJR013W - SH] complement(420791....   384   e-131
KLLA0D09647g complement(814829..816037) some similarities with s...   382   e-130
KLLA0A06534g complement(591225..592532) similar to sp|P06783 Sac...    33   0.54 

>CAGL0B03905g 385192..386487 similar to sp|P47088 Saccharomyces
           cerevisiae YJR013w, hypothetical start
          Length = 431

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/424 (95%), Positives = 407/424 (95%)

Query: 1   MFKLGTIGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRD 60
           MFKLGTIGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRD
Sbjct: 1   MFKLGTIGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRD 60

Query: 61  TYRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIM 120
           TYRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIM
Sbjct: 61  TYRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIM 120

Query: 121 AAIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXX 180
           AAIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFK       
Sbjct: 121 AAIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKIYPIIYA 180

Query: 181 XXXXXXXXXXHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHI 240
                     HYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHI
Sbjct: 181 LPIAIYVAAAHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHI 240

Query: 241 YRTDHRHNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNV 300
           YRTDHRHNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNV
Sbjct: 241 YRTDHRHNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNV 300

Query: 301 LFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGY 360
           LFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGY
Sbjct: 301 LFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGY 360

Query: 361 LLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQNDYVYRIEPSESRSKDSAVID 420
           LLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQNDYVYRIEPSESRSKDSAVID
Sbjct: 361 LLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQNDYVYRIEPSESRSKDSAVID 420

Query: 421 KPAI 424
           KPAI
Sbjct: 421 KPAI 424

>YJR013W (YJR013W) [2916] chr10 (460296..461507) Protein with
           moderate similarity to mannosyltransferase I
           (glycosylphosphatidylinositol mannosyltransferase I, rat
           Pigm), which transfers the first mannose to
           glycosylphosphatidylinositol (GPI) during the
           biosynthesis of GPI membrane anchors [1212 bp, 403 aa]
          Length = 403

 Score =  423 bits (1088), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 222/412 (53%), Positives = 283/412 (68%), Gaps = 18/412 (4%)

Query: 8   GLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPL 67
           GL  L+ L+R+ FFLFG+YQD +F V+YTDIDY VF+DAA +V   KSPY RDTYRYTPL
Sbjct: 7   GLTVLSFLVRVGFFLFGIYQDANFKVRYTDIDYFVFHDAAKYVYEGKSPYARDTYRYTPL 66

Query: 68  LSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIWLLN 127
           LSWLL+PNH   WFH GK+IFV+ DL TG++I+++L +  S+      R  I+ +IWLLN
Sbjct: 67  LSWLLVPNHYFGWFHLGKVIFVIFDLVTGLIIMKLLNQAISR-----KRALILESIWLLN 121

Query: 128 PMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXXXXXXXXX 187
           PMVITISTRGNAESVLC LI+  L+     +Y L G+L+GLSIHFK              
Sbjct: 122 PMVITISTRGNAESVLCCLIMFTLFFLQKSRYTLAGILYGLSIHFKIYPIIYCIPIAIFI 181

Query: 188 XXXHYNKTQSVFKSSFKLFL-VGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHR 246
              +YNK     ++     L +G STL  L+     MY +YG +F+DQ YLYH+YRTDHR
Sbjct: 182 ---YYNKRNQGPRTQLTSLLNIGLSTLTTLLGCGWAMYKIYGYEFLDQAYLYHLYRTDHR 238

Query: 247 HNFSVWNMLLYFNSALPKTSE--LSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLE 304
           HNFSVWNMLLY +SA  +  E  LS++ F+PQ+++VL     +   P+ F  L  VLF++
Sbjct: 239 HNFSVWNMLLYLDSANKENGESNLSRYAFVPQLLLVLVTGCLEWWNPT-FDNLLRVLFVQ 297

Query: 305 TFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEF 364
           TFAFVT+NKVCTSQYF+WYLIFLPF L  T I  ++G++M  +WV TQ +WL QGY LEF
Sbjct: 298 TFAFVTYNKVCTSQYFVWYLIFLPFYLSRTHIGWKKGLLMATLWVGTQGIWLSQGYYLEF 357

Query: 365 EGQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQNDYVYRIEPSESRSKDS 416
           EG+NVFYPGLF ASV FFV+N W+LGQFI D  I        +P+ S  K++
Sbjct: 358 EGKNVFYPGLFIASVLFFVTNVWLLGQFITDIKIPT------QPTVSNKKNN 403

>Kwal_33.15449
          Length = 396

 Score =  420 bits (1079), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 217/391 (55%), Positives = 272/391 (69%), Gaps = 14/391 (3%)

Query: 5   GTIGLLSLAVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRY 64
             +GL S++++LR+ FFL+G+YQD+HF VKYTDIDY VFNDAA FV +  SPY RDTYRY
Sbjct: 6   AMVGLFSMSLVLRVGFFLYGMYQDQHFDVKYTDIDYFVFNDAARFVFNGMSPYLRDTYRY 65

Query: 65  TPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIW 124
           TPLLSWLL+PNH + W HFGK++FV+ DL TGV+IL +L+    +      R  I+A++W
Sbjct: 66  TPLLSWLLVPNHYLNWIHFGKMVFVVMDLLTGVMILALLEIPNKR------RRLILASLW 119

Query: 125 LLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXXXXXX 184
           LLN MVITISTRGNAESV+CFL+L  LY      Y+L G + GL+IHFK           
Sbjct: 120 LLNIMVITISTRGNAESVICFLVLLSLYFLRFGNYVLAGAVLGLAIHFKIYPIIYTLPIA 179

Query: 185 XXXXXXHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTD 244
                   +   SV K       +G S +  L   +  MY  YG ++++  YLYH+ RTD
Sbjct: 180 VYIYFQKKDGLVSVVK-------IGLSVIAALTFSSYLMYHKYGTEYLEHAYLYHVLRTD 232

Query: 245 HRHNFSVWNMLLYFNSALPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLE 304
           HRHNFSV++MLLYF SALP  S  +K  FLPQ +I L + +    R SSF  L +VLF++
Sbjct: 233 HRHNFSVFHMLLYFESALPAESYWAKLAFLPQAMITLGV-VPLCFRSSSFNNLLSVLFIQ 291

Query: 305 TFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEF 364
           T+AFVT+NKVCTSQYFIWYLIFLPF L +T I+ RRGI M  +W+ATQA WL  GYLLEF
Sbjct: 292 TYAFVTYNKVCTSQYFIWYLIFLPFFLAHTTITARRGIAMGALWIATQAFWLLFGYLLEF 351

Query: 365 EGQNVFYPGLFCASVGFFVSNAWILGQFIED 395
           +GQNVFYPGLF AS+ FF+SN WI+GQFI D
Sbjct: 352 KGQNVFYPGLFLASLSFFLSNVWIIGQFIND 382

>Scas_647.6
          Length = 423

 Score =  419 bits (1077), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 216/413 (52%), Positives = 286/413 (69%), Gaps = 20/413 (4%)

Query: 13  AVLLRIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHR-----------KSPYNRDT 61
            +L+R+ F+LFG+YQD HF V+YTDIDY VF+DAA +V  +            SPY RDT
Sbjct: 14  GLLIRVVFYLFGIYQDAHFKVRYTDIDYFVFHDAAGYVYEKLINLNSNFPVNGSPYQRDT 73

Query: 62  YRYTPLLSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMA 121
           YRYTPLLSWLL+P+H    FH GK +F++ DL TG++I++MLK +  K    + ++ +++
Sbjct: 74  YRYTPLLSWLLVPDHYFDLFHLGKFLFMIFDLFTGIVIMKMLKNISPKIS--SLKLGLLS 131

Query: 122 AIWLLNPMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXXX 181
           +IWLLNPMVITISTRGNAES+LCFL++  LY     +Y L G+++GLSIHFK        
Sbjct: 132 SIWLLNPMVITISTRGNAESILCFLVMLSLYFLQKRRYWLAGIIYGLSIHFKIYPIIYCL 191

Query: 182 XXXXXXXXXHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIY 241
                     +N   +V      L +VG +TL  ++ L   MY +YG +F+DQ Y YH+Y
Sbjct: 192 AISIYLVCASHNNA-TVSSKLKNLIIVGATTLFTIVGLGTLMYSIYGFEFLDQAYFYHLY 250

Query: 242 RTDHRHNFSVWNMLLYFNSALPKTSE--LSKFVFLPQMIIVLAISLTQLRRPSSFPLLCN 299
           RTDHRHNFS+WN+LLYF+SA    S   LSKF F PQM+I + ++  +  +P+ F  L N
Sbjct: 251 RTDHRHNFSLWNILLYFDSASDPNSVSLLSKFSFAPQMLITIVLTYLEYLQPT-FANLLN 309

Query: 300 VLFLETFAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQG 359
           VLFL+TFAFVT+NKVCTSQYF+WYLIFLPF L NT ISM+RG+ ML+VWV TQALWL QG
Sbjct: 310 VLFLQTFAFVTYNKVCTSQYFVWYLIFLPFSLINTTISMKRGVAMLLVWVGTQALWLSQG 369

Query: 360 YLLEFEGQNVFYPGLFCASVGFFVSNAWILGQFIED---TIIQNDYVYRIEPS 409
           Y LEFEG+NVFYPG+F  +V FF  N W LGQFI+D   TI+++    +++ +
Sbjct: 370 YYLEFEGRNVFYPGIFFGAVAFFAGNVWTLGQFIDDITSTILKSSIAVKVKKN 422

>ACR034W [1082] [Homologous to ScYJR013W - SH]
           complement(420791..421984) [1194 bp, 397 aa]
          Length = 397

 Score =  384 bits (985), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 202/395 (51%), Positives = 266/395 (67%), Gaps = 16/395 (4%)

Query: 9   LLSLAVLL-RIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPL 67
           LL LA LL R+ FF +G+YQD HF VKYTDIDY VF+DAA +VA   SPY RDTYRYTPL
Sbjct: 7   LLVLAGLLARVGFFSYGIYQDAHFAVKYTDIDYHVFHDAARYVAQGNSPYLRDTYRYTPL 66

Query: 68  LSWLLLPNHMIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMTIMAAIWLLN 127
           LSW+L+PNH + W HFGK IFVL DL  GV+++ +L K       G  R  I+A++WLLN
Sbjct: 67  LSWMLVPNHWLQWVHFGKFIFVLFDLLAGVMVMNLLGKC------GRRRKLILASLWLLN 120

Query: 128 PMVITISTRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXXXXXXXXX 187
           P+VIT+STRGNAESV+ FLI+ FL      Q+ L G ++G++IHFK              
Sbjct: 121 PVVITVSTRGNAESVMAFLIMWFLVHLRNRQFALSGFVYGVAIHFKIYPIIYALPISI-- 178

Query: 188 XXXHYNKTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHRH 247
               Y ++    +   +L  +G +TL  L+   + MY +YG +F++  Y+YH  RTDHRH
Sbjct: 179 ----YIRSSEGSRWFLRLLTMGIATLATLVGCGIGMYYIYGWEFLEHAYIYHFTRTDHRH 234

Query: 248 NFSVWNMLLYFNSA--LPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLET 305
           NFS+WNMLLY +S+  +P T   ++F FLPQ+ I  A++      P+   + C VLFL+T
Sbjct: 235 NFSLWNMLLYLDSSGVVPTTINWAEFAFLPQLFICAAVTYVLWEAPTFQNMQC-VLFLQT 293

Query: 306 FAFVTFNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFE 365
           FAFVT+NKVCTSQYFIWYL+FLP  L +T +S  +GI ++ +WV TQA WL  GYLLEFE
Sbjct: 294 FAFVTYNKVCTSQYFIWYLLFLPSFLLDTTLSGAKGIFLIFLWVGTQAWWLYNGYLLEFE 353

Query: 366 GQNVFYPGLFCASVGFFVSNAWILGQFIEDTIIQN 400
           G+N+FYP LF A V FF++N ++L QFI D   +N
Sbjct: 354 GKNMFYPRLFSACVTFFLANVYLLAQFILDCRRRN 388

>KLLA0D09647g complement(814829..816037) some similarities with
           sp|P47088 Saccharomyces cerevisiae YJR013w singleton,
           hypothetical start
          Length = 402

 Score =  382 bits (981), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 269/385 (69%), Gaps = 20/385 (5%)

Query: 17  RIAFFLFGVYQDEHFTVKYTDIDYQVFNDAAWFVAHRKSPYNRDTYRYTPLLSWLLLPNH 76
           RI FF +G++QD HF VKYTDIDY VF+DAA +V + +SPY RDTYRYTPLLS+LLLPN+
Sbjct: 16  RIGFFSYGIFQDSHFDVKYTDIDYFVFHDAAGYVNNGQSPYLRDTYRYTPLLSFLLLPNY 75

Query: 77  MIPWFHFGKLIFVLCDLATGVLILQMLKKLKSKYRYGTDRMT---IMAAIWLLNPMVITI 133
            + W H GK+ FVL DL TGV+I+++L+        G+ ++T   I+A+IWLLNP+VITI
Sbjct: 76  YLKWIHMGKVFFVLFDLITGVMIIKLLQ--------GSCQLTKQLILASIWLLNPIVITI 127

Query: 134 STRGNAESVLCFLILSFLYCFLCEQYLLGGLLFGLSIHFKXXXXXXXXXXXXXXXXXHYN 193
           STRGNAESVLCFLI+  LY    ++ L+ GL +GLSIHFK                  +N
Sbjct: 128 STRGNAESVLCFLIICALYFLKRDRLLISGLFYGLSIHFKIYPIIYALPIGIYLLLSSHN 187

Query: 194 KTQSVFKSSFKLFLVGFSTLIVLILLTVFMYMLYGDKFIDQTYLYHIYRTDHRHNFSVWN 253
           +        ++LF++G STLI +   T FMY LYG +FI+ +Y+YH+ RTDHRHNFS+WN
Sbjct: 188 R-----NCIWRLFMIGISTLIGITAPTYFMYKLYGSEFIEHSYMYHLTRTDHRHNFSIWN 242

Query: 254 MLLYFNSA---LPKTSELSKFVFLPQMIIVLAISLTQLRRPSSFPLLCNVLFLETFAFVT 310
           ++L   SA   L ++ ELSK  F+PQ+ +  A+    L +  +F  L NVLF++T+AFVT
Sbjct: 243 LVLLLESAGIHLSQSIELSKLAFVPQLTLC-AVLPYLLWKSQTFENLMNVLFVQTYAFVT 301

Query: 311 FNKVCTSQYFIWYLIFLPFVLYNTRISMRRGIVMLVVWVATQALWLRQGYLLEFEGQNVF 370
           FNKVCTSQYFIWYL+  PF   NT I+ R+G+V + +W+ +QA+WL Q YLLEF+GQNVF
Sbjct: 302 FNKVCTSQYFIWYLVLSPFYFANTTITWRKGVVCIFLWILSQAVWLSQAYLLEFKGQNVF 361

Query: 371 YPGLFCASVGFFVSNAWILGQFIED 395
           +P LF  ++ FF+ N ++LG FI D
Sbjct: 362 FPNLFFGNIVFFLINVYLLGVFITD 386

>KLLA0A06534g complement(591225..592532) similar to sp|P06783
           Saccharomyces cerevisiae YKL178c STE3 pheromone a-factor
           receptor singleton, start by similarity
          Length = 435

 Score = 32.7 bits (73), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%), Gaps = 4/64 (6%)

Query: 201 SSFKLFLVGFSTLIVLILLTVFMYMLYGD-KFIDQTYLYHIYRTDHRHNFSVWNMLLYFN 259
           S F   L+ F  +I+LI+    MY    D K +  TY ++ ++    HN ++WN++L+F+
Sbjct: 204 SRFSRLLI-FCMVIILIMFPFSMYSFVSDLKNVSPTYRHYSFK--ETHNSALWNVILHFD 260

Query: 260 SALP 263
              P
Sbjct: 261 PGQP 264

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.333    0.145    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 12,931,974
Number of extensions: 530703
Number of successful extensions: 1506
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1504
Number of HSP's successfully gapped: 14
Length of query: 424
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 320
Effective length of database: 12,995,837
Effective search space: 4158667840
Effective search space used: 4158667840
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 63 (28.9 bits)