Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03883g30630115480.0
KLLA0E09680g30730112121e-169
Kwal_33.1544630530111791e-164
Sklu_2075.334529811821e-164
CAGL0K12210g3113043296e-36
CAGL0D01606g3052993131e-33
Kwal_33.129883032932982e-31
Scas_718.53243042941e-30
YPR058W (YMC1)3072982903e-30
Sklu_2398.43093022903e-30
CAGL0K10362g3013012869e-30
Sklu_1926.23052942842e-29
KLLA0B08503g3033072833e-29
Scas_667.223063032781e-28
YOR130C (ORT1)2922982743e-28
YBR104W (YMC2)3293182756e-28
KLLA0F17864g3072952721e-27
Kwal_27.125993042922675e-27
Kwal_56.230113032922666e-27
Scas_632.92922942641e-26
Sklu_2127.52782842587e-26
KLLA0E02772g2842892543e-25
ACR109W2992832544e-25
Kwal_26.86692962822535e-25
Sklu_1275.13113072511e-24
AFR146W2812992342e-22
CAGL0J04114g3032982342e-22
YOR222W (ODC2)3072872309e-22
KLLA0D07073g2972902272e-21
Scas_640.253062852211e-20
Scas_714.183052982193e-20
Kwal_55.213353172842184e-20
Kwal_23.29133203072169e-20
CAGL0J02002g3613102171e-19
YPL134C (ODC1)3102942142e-19
ADL264C3292992133e-19
YOR100C (CRC1)3273032124e-19
KLLA0C13431g3282972115e-19
Scas_697.473282902081e-18
Scas_589.103162922072e-18
Scas_709.93653102064e-18
Kwal_47.173218812952032e-17
CAGL0K02365g9193072014e-17
CAGL0B04543g3173011965e-17
KLLA0E13453g9063041997e-17
Kwal_55.208683803091951e-16
YPR021C (AGC1)9022931971e-16
Sklu_2359.69022941952e-16
ADL049W9122891901e-15
YEL006W3352971824e-15
YIL006W3733111801e-14
Sklu_2431.53703271702e-13
KLLA0B12826g3193051673e-13
AGL311C3623121684e-13
Sklu_2334.23193041665e-13
Kwal_27.120813693111675e-13
Sklu_1149.22962961631e-12
ADL009W3793161641e-12
Scas_721.273743301632e-12
Scas_602.88852951632e-12
YKL120W (OAC1)3242941603e-12
CAGL0G01166g2952911551e-11
Sklu_2430.103241901542e-11
YBR291C (CTP1)2992951532e-11
KLLA0D14036g4313271533e-11
YJR095W (SFC1)3223101523e-11
KLLA0E23705g3683281515e-11
Kwal_26.76533253011506e-11
Scas_667.43082951499e-11
Sklu_2432.52882811471e-10
Scas_691.43343241472e-10
ACR260W3113051472e-10
Kwal_26.79672972791462e-10
Scas_489.42972791452e-10
CAGL0K11616g3202941453e-10
CAGL0M09020g3483381453e-10
KLLA0D15015g3173161427e-10
KLLA0E18810g3772791427e-10
KLLA0F03212g3053121401e-09
CAGL0L02079g2972861401e-09
YMR056C (AAC1)3091861391e-09
AEL253W3653041392e-09
AER184W3052931372e-09
Scas_721.1293232971373e-09
CAGL0K08250g2972931363e-09
AFR147C3152561364e-09
Kwal_47.182163333261355e-09
CAGL0G03135g3073221356e-09
YGR096W (TPC1)3142971346e-09
CAGL0K02915g3423251347e-09
Kwal_23.39653073051321e-08
YLR348C (DIC1)2982871312e-08
CAGL0F04213g3062751283e-08
YHR002W (LEU5)3573231285e-08
Scas_716.293163131275e-08
Scas_718.243371651276e-08
Kwal_27.124813041651267e-08
Scas_379.23012941268e-08
YBR085W (AAC3)3071651259e-08
YBL030C (PET9)3182861241e-07
Scas_328.12271791221e-07
YIL134W (FLX1)3111941222e-07
KLLA0F04697g3071861204e-07
Sklu_2127.43232681195e-07
KLLA0B11319g3552491196e-07
Kwal_55.211063283031196e-07
CAGL0D04774g3222871171e-06
YGR257C (MTM1)3662661161e-06
YBR192W (RIM2)3773301162e-06
Kwal_23.47313141921152e-06
YPR011C3263071142e-06
Sklu_2363.23233061133e-06
CAGL0M05225g3813291133e-06
Kwal_33.140503143091124e-06
KLLA0E12353g3051651124e-06
Sklu_2037.23103241124e-06
YPR128C (ANT1)3282941125e-06
AGL047C3163081115e-06
AFR131C3443161115e-06
Scas_662.123081851081e-05
YJL133W (MRS3)3142911081e-05
CAGL0G08910g2893011081e-05
Scas_705.93232981081e-05
Scas_645.93912751082e-05
CAGL0J01661g3273011072e-05
AGL064W2962931062e-05
CAGL0J05522g5193221073e-05
Scas_578.3*5243061063e-05
KLLA0C11363g5173281064e-05
Scas_717.203563271054e-05
Scas_582.73292981044e-05
YKR052C (MRS4)3042151036e-05
CAGL0L05742g3053061036e-05
YNL083W5451891037e-05
Scas_702.103022921028e-05
CAGL0F08305g3742761011e-04
Sklu_2374.75133171011e-04
KLLA0A00979g343711001e-04
AAR036W3171411001e-04
YMR166C368311992e-04
Kwal_26.7972358313992e-04
Sklu_2435.2344321992e-04
CAGL0F07711g368245992e-04
Kwal_23.3529395283992e-04
AFR253W34467992e-04
AER419W493188993e-04
ABL023W309295973e-04
Kwal_23.3042542187984e-04
Kwal_14.2210315301974e-04
Scas_687.15*32871956e-04
Scas_613.24177179890.002
CAGL0H10538g29782910.002
KLLA0D04312g10378850.002
Scas_715.45305198900.002
Scas_669.6373169900.002
Kwal_23.435434370890.003
Sklu_2433.842066890.004
YER053C300263870.005
KLLA0D09889g364126880.005
AGR383W293271870.006
KLLA0E02750g304284870.006
Kwal_55.21338323157870.006
KLLA0E15532g326137870.006
CAGL0H03839g282285860.007
AGL065C335318860.008
Scas_558.2289286850.010
AGR191W29866840.012
KLLA0D04290g188186820.013
KLLA0E08877g29475840.014
AAL014C271279830.015
AER366W293299820.023
Kwal_47.1922828167810.027
YDL198C (YHM1)30079810.029
YNL003C (PET8)284287810.030
Kwal_27.1162629969800.035
YFR045W285189800.037
KLLA0A09383g366282800.039
Sklu_2117.229879780.066
Kwal_27.11419298176770.10
CAGL0J09790g30079770.10
Scas_562.1230080760.11
KLLA0E18788g38162760.16
Sklu_2115.4299177750.18
CAGL0C02013g32925750.19
Sklu_2442.8275284740.24
KLLA0F13464g30069740.25
Sklu_1982.347635740.28
Scas_667.29*18992710.38
AFL196W361192720.39
ADR036C340194710.59
YJR077C (MIR1)311117681.2
Sklu_2260.5302198681.3
Scas_673.17314110671.5
CAGL0F00231g30798671.8
AFR542W310264662.4
AER450C30882626.3
Sklu_2194.3312271619.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03883g
         (301 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...   600   0.0  
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...   471   e-169
Kwal_33.15446                                                         458   e-164
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement               459   e-164
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...   131   6e-36
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...   125   1e-33
Kwal_33.12988                                                         119   2e-31
Scas_718.5                                                            117   1e-30
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...   116   3e-30
Sklu_2398.4 , Contig c2398 9476-10405                                 116   3e-30
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...   114   9e-30
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement         114   2e-29
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...   113   3e-29
Scas_667.22                                                           111   1e-28
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...   110   3e-28
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...   110   6e-28
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...   109   1e-27
Kwal_27.12599                                                         107   5e-27
Kwal_56.23011                                                         107   6e-27
Scas_632.9                                                            106   1e-26
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement        103   7e-26
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...   102   3e-25
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...   102   4e-25
Kwal_26.8669                                                          102   5e-25
Sklu_1275.1 , Contig c1275 314-1249                                   101   1e-24
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    95   2e-22
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    95   2e-22
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    93   9e-22
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    92   2e-21
Scas_640.25                                                            90   1e-20
Scas_714.18                                                            89   3e-20
Kwal_55.21335                                                          89   4e-20
Kwal_23.2913                                                           88   9e-20
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    88   1e-19
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    87   2e-19
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    87   3e-19
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    86   4e-19
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    86   5e-19
Scas_697.47                                                            85   1e-18
Scas_589.10                                                            84   2e-18
Scas_709.9                                                             84   4e-18
Kwal_47.17321                                                          83   2e-17
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    82   4e-17
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    80   5e-17
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    81   7e-17
Kwal_55.20868                                                          80   1e-16
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    80   1e-16
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          80   2e-16
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    78   1e-15
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    75   4e-15
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    74   1e-14
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            70   2e-13
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    69   3e-13
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    69   4e-13
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         69   5e-13
Kwal_27.12081                                                          69   5e-13
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         67   1e-12
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    68   1e-12
Scas_721.27                                                            67   2e-12
Scas_602.8                                                             67   2e-12
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    66   3e-12
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    64   1e-11
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         64   2e-11
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    64   2e-11
KLLA0D14036g complement(1203522..1204817) some similarities with...    64   3e-11
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    63   3e-11
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    63   5e-11
Kwal_26.7653                                                           62   6e-11
Scas_667.4                                                             62   9e-11
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       61   1e-10
Scas_691.4                                                             61   2e-10
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    61   2e-10
Kwal_26.7967                                                           61   2e-10
Scas_489.4                                                             60   2e-10
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    60   3e-10
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    60   3e-10
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    59   7e-10
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    59   7e-10
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    59   1e-09
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    59   1e-09
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    58   1e-09
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    58   2e-09
AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W (...    57   2e-09
Scas_721.129                                                           57   3e-09
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    57   3e-09
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    57   4e-09
Kwal_47.18216                                                          57   5e-09
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    57   6e-09
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    56   6e-09
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    56   7e-09
Kwal_23.3965                                                           55   1e-08
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    55   2e-08
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    54   3e-08
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    54   5e-08
Scas_716.29                                                            54   5e-08
Scas_718.24                                                            54   6e-08
Kwal_27.12481                                                          53   7e-08
Scas_379.2                                                             53   8e-08
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    53   9e-08
YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP car...    52   1e-07
Scas_328.1                                                             52   1e-07
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    52   2e-07
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    51   4e-07
Sklu_2127.4 , Contig c2127 6322-7293                                   50   5e-07
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    50   6e-07
Kwal_55.21106                                                          50   6e-07
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    50   1e-06
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    49   1e-06
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    49   2e-06
Kwal_23.4731                                                           49   2e-06
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    49   2e-06
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          48   3e-06
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    48   3e-06
Kwal_33.14050                                                          48   4e-06
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    48   4e-06
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         48   4e-06
YPR128C (ANT1) [5547] chr16 complement(791212..792198) Peroxisom...    48   5e-06
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    47   5e-06
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    47   5e-06
Scas_662.12                                                            46   1e-05
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    46   1e-05
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    46   1e-05
Scas_705.9                                                             46   1e-05
Scas_645.9                                                             46   2e-05
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    46   2e-05
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    45   2e-05
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    46   3e-05
Scas_578.3*                                                            45   3e-05
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    45   4e-05
Scas_717.20                                                            45   4e-05
Scas_582.7                                                             45   4e-05
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    44   6e-05
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    44   6e-05
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    44   7e-05
Scas_702.10                                                            44   8e-05
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    44   1e-04
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       44   1e-04
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    43   1e-04
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    43   1e-04
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    43   2e-04
Kwal_26.7972                                                           43   2e-04
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         43   2e-04
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    43   2e-04
Kwal_23.3529                                                           43   2e-04
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    43   2e-04
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    43   3e-04
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    42   3e-04
Kwal_23.3042                                                           42   4e-04
Kwal_14.2210                                                           42   4e-04
Scas_687.15*                                                           41   6e-04
Scas_613.24                                                            39   0.002
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    40   0.002
KLLA0D04312g 367160..367471 highly similar to sgd|S0006215 Sacch...    37   0.002
Scas_715.45                                                            39   0.002
Scas_669.6                                                             39   0.002
Kwal_23.4354                                                           39   0.003
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       39   0.004
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...    38   0.005
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    39   0.005
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    38   0.006
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    38   0.006
Kwal_55.21338                                                          38   0.006
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    38   0.006
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    38   0.007
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    38   0.008
Scas_558.2                                                             37   0.010
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    37   0.012
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    36   0.013
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    37   0.014
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    37   0.015
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    36   0.023
Kwal_47.19228                                                          36   0.027
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    36   0.029
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    36   0.030
Kwal_27.11626                                                          35   0.035
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    35   0.037
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    35   0.039
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            35   0.066
Kwal_27.11419                                                          34   0.10 
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    34   0.10 
Scas_562.12                                                            34   0.11 
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    34   0.16 
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            33   0.18 
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    33   0.19 
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          33   0.24 
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    33   0.25 
Sklu_1982.3 YDL238C, Contig c1982 3793-5223                            33   0.28 
Scas_667.29*                                                           32   0.38 
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    32   0.39 
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    32   0.59 
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...    31   1.2  
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement         31   1.3  
Scas_673.17                                                            30   1.5  
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...    30   1.8  
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    30   2.4  
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...    28   6.3  
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            28   9.5  

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/301 (97%), Positives = 293/301 (97%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT
Sbjct: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
           LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM
Sbjct: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG
Sbjct: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180

Query: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
           LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK
Sbjct: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240

Query: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLRT 300
           QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP        FEFVLRT
Sbjct: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPANAAALAAFEFVLRT 300

Query: 301 S 301
           S
Sbjct: 301 S 301

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score =  471 bits (1212), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 221/301 (73%), Positives = 256/301 (85%), Gaps = 12/301 (3%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           ++S ETYSR+MGFVAG+FSGVAKN VGHPFDT+KVRLQTSQ  +    +FKGPLDCVYKT
Sbjct: 15  LISNETYSRIMGFVAGVFSGVAKNAVGHPFDTIKVRLQTSQNET----RFKGPLDCVYKT 70

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
            +NQGIRG YLGFTPPL GWI+MDS +LG LHNYRML+HKYVYP  +KLPLSGCIISGV+
Sbjct: 71  FRNQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLMHKYVYPNDEKLPLSGCIISGVL 130

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           AGW+VSFIA P+ELAKAKLQVQYD  TT+Y GP+DV++K++           G+R LYKG
Sbjct: 131 AGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQ--------GIRGLYKG 182

Query: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
           LISTLIFR++FV+WWGSYEL+T+WF++NT +S  AINFWAGG SASFGFWT+AYPSDVVK
Sbjct: 183 LISTLIFRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDVVK 242

Query: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLRT 300
           QVVLCNDKYDGSFKSWRTAV DIY+ +GI+GFFKGF+PSFLRSFP        FEFVLRT
Sbjct: 243 QVVLCNDKYDGSFKSWRTAVKDIYQSKGINGFFKGFVPSFLRSFPANAAALAAFEFVLRT 302

Query: 301 S 301
           S
Sbjct: 303 S 303

>Kwal_33.15446
          Length = 305

 Score =  458 bits (1179), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 214/301 (71%), Positives = 250/301 (83%), Gaps = 12/301 (3%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           +V  E YSR+MGFV+GMFSG+AKN VGHPFDT+KVRLQTSQ       +FKGPLDCVY+T
Sbjct: 10  VVPNEAYSRMMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDTG----RFKGPLDCVYQT 65

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
           ++ QGIRG YLGFTPPL GWI+MDS +LG LHNYRMLL KYVY   +KLPLSGCI+SGV+
Sbjct: 66  MRQQGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYQHEEKLPLSGCILSGVL 125

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           AGW+VSFIAAPVELAKAKLQVQYDA+TT+Y GP+DV++KV+           G+R +YKG
Sbjct: 126 AGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAAD--------GIRGMYKG 177

Query: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
           L+STLIFR++FV+WWGSYEL+T+WF+ NTNLS  AINFWAGG SASFGFWT+AYPSDV+K
Sbjct: 178 LVSTLIFRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDVIK 237

Query: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLRT 300
           QV+LCNDKYDGS +SWR A SDI+R RGI GFFKGF+PSFLRSFP        FEFVLR 
Sbjct: 238 QVILCNDKYDGSLRSWRNAASDIWRTRGIRGFFKGFVPSFLRSFPANAAALASFEFVLRV 297

Query: 301 S 301
           S
Sbjct: 298 S 298

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score =  459 bits (1182), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 219/298 (73%), Positives = 248/298 (83%), Gaps = 12/298 (4%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
            E YSR+MGFV+GMFSG+AKN VGHPFDT+KVRLQTSQ  +    +FKGPLDCVYKT   
Sbjct: 55  SEAYSRIMGFVSGMFSGIAKNAVGHPFDTIKVRLQTSQDST----RFKGPLDCVYKTFTQ 110

Query: 64  QGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGW 123
           QGIRG YLGFTPPL GWI+MDS +LG LHNYRMLL KYVY   +KLPLSGCIISGVMAGW
Sbjct: 111 QGIRGFYLGFTPPLVGWILMDSVMLGCLHNYRMLLKKYVYYNEEKLPLSGCIISGVMAGW 170

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
           +VSFIAAPVELAKAKLQVQYDAKTTKYTGP+DV++KV+           GVR LYKGL S
Sbjct: 171 SVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSN--------GVRGLYKGLTS 222

Query: 184 TLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVV 243
           TLIFR+NFVFWWGSYEL+T+WF+++TN+S  AINFW+GG SASFGFWT+AYPSDV+KQVV
Sbjct: 223 TLIFRTNFVFWWGSYELLTRWFKEHTNMSDTAINFWSGGFSASFGFWTTAYPSDVIKQVV 282

Query: 244 LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLRTS 301
           LCNDKYDG+F+SW+ A  DI+R RG  GFFKGF+PSFLRSFP        FEFVLRTS
Sbjct: 283 LCNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFPANAAALAAFEFVLRTS 340

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score =  131 bits (329), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/304 (31%), Positives = 147/304 (48%), Gaps = 29/304 (9%)

Query: 7   YSRVMGFV-AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65
           Y RV+  + AG   GVA+  VG PFDT KVRLQTS+   G        ++ V   L+N+G
Sbjct: 23  YGRVVKDIFAGTMGGVAQVLVGQPFDTTKVRLQTSKTKIGV-------IEVVQNLLRNEG 75

Query: 66  IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKY----VYPE-HDKLPLSGCIISGVM 120
               Y G   PL G  +  S   G   + +     Y    V P+ H  LPL    + G+ 
Sbjct: 76  ALAFYKGMLTPLLGVGICVSVQFGVNESMKRFFAAYNADRVDPQKHVPLPLHQYYLCGLT 135

Query: 121 AGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
            G   SF+AAP+E  + +LQ Q       ++ GP D ++K+ K            ++L +
Sbjct: 136 GGVVNSFLAAPIEHVRIRLQTQTSQGNERQFKGPFDCIKKLAK-----------AKALMR 184

Query: 180 GLISTLIFRSNFV-FWWGSYE-LITQWFQKNTNLSA-PAINFWAGGLSASFGFWTSAYPS 236
           GL+ T+I   + +  ++ +YE L+ + F+K T  +  PA    + G  +    W + YP 
Sbjct: 185 GLLPTMIRAGHGLGTYFAAYEALVVKEFEKGTPRNQIPAWKLCSFGALSGTILWLTVYPV 244

Query: 237 DVVKQVVLCNDKYDGSFK-SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           DVVK V+  +   +  +K S   A   +Y+Q GI  FFKGF+P+ +R+ P        FE
Sbjct: 245 DVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVSFE 304

Query: 296 FVLR 299
             +R
Sbjct: 305 MTMR 308

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score =  125 bits (313), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/299 (30%), Positives = 136/299 (45%), Gaps = 31/299 (10%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69
           V   +AG   G+A+  +G PFDT KVRLQTS+V + A        + V   LKN+G +G 
Sbjct: 26  VKDLLAGTAGGIAQVLIGQPFDTTKVRLQTSKVPTSAA-------EVVKNLLKNEGPKGF 78

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           Y G   PL G     S   G     +   H      +  L LS   + G+  G T SF+A
Sbjct: 79  YKGTLTPLVGVGACVSIQFGVNEAMKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLA 138

Query: 130 APVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188
           +P+E  + +LQ Q       ++ GPID ++K+  Q           + L +GLI T++  
Sbjct: 139 SPIEHVRIRLQTQTGSGAQAEFKGPIDCIKKLRSQ-----------KGLMRGLIPTMLRE 187

Query: 189 SNFVFWWGSYELITQWF---QKNTNLSAPAINFWA----GGLSASFGFWTSAYPSDVVKQ 241
            +     G+Y L+ +     Q N  L    I  W     G LS +   W   YP DVVK 
Sbjct: 188 GH---GCGTYFLVYEALVSKQINQGLKRTEIPPWKLCLYGALSGT-ALWLMVYPIDVVKS 243

Query: 242 VVLCND-KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           V+  ++     + K+      ++Y + G+  FFKGF P+ LR+ P        FE  +R
Sbjct: 244 VMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTFATFELAMR 302

>Kwal_33.12988
          Length = 303

 Score =  119 bits (298), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/293 (30%), Positives = 135/293 (46%), Gaps = 25/293 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
             AG   G+A+  VG PFD  KVRLQTS   + A       L  V   +KN+G+RG Y G
Sbjct: 27  ITAGTTGGIAQVLVGQPFDITKVRLQTSSTPTTA-------LRVVQDLVKNEGLRGFYKG 79

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132
            T PL G  +  S+  G+    +   HK    +   L L      G ++G   +F+A P+
Sbjct: 80  TTLPLIGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYYACGFVSGCANAFLATPI 139

Query: 133 ELAKAKLQVQYDAKT-TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN- 190
           E  +  LQVQ  ++   +Y G +D ++K+ K+G            L +G   T++  S+ 
Sbjct: 140 EHVRILLQVQTKSRADAEYQGAMDCIKKLLKEG-----------KLMRGFTPTILRTSHG 188

Query: 191 FVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFG---FWTSAYPSDVVKQVVLCND 247
           F  ++ SYE +    Q+   ++   I  W   L  +F     W   YP DV+K V+  + 
Sbjct: 189 FGVYFTSYEAMICSEQRK-GIARKDIPAWKLCLYGAFSGSLLWAMVYPFDVIKSVMQSDK 247

Query: 248 KYDGSFKSWRTAVS-DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
                + +    V+ +IY +RG   F KGF P+ LRS P        FE  +R
Sbjct: 248 LRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGATFTAFEMAMR 300

>Scas_718.5
          Length = 324

 Score =  117 bits (294), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 144/304 (47%), Gaps = 31/304 (10%)

Query: 8   SRVM-GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +RV+   +AG   G+++  VG PFDT KVR+QTS    GA       LD + K +KN+G+
Sbjct: 37  TRVLKDILAGTCGGISQVIVGQPFDTTKVRMQTSAKSVGA-------LDIIRKLVKNEGV 89

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKY-----VYPEHDKLPLSGCIISGVMA 121
              Y G   P+ G     S   G     +    ++            L L    I G+  
Sbjct: 90  WAFYKGSLIPIVGVGACVSVQFGVNEAMKRFFREWNTSRGTQHRDGTLQLGQYYICGLTG 149

Query: 122 GWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           G   SF+A+P+E  + +LQ Q  +    ++ GP+D ++K+ K+           +SL +G
Sbjct: 150 GVVNSFLASPIEHVRIRLQTQTGNGNEREFKGPLDCIRKLVKE-----------KSLMRG 198

Query: 181 LISTLIFRSNFVF--WWGSYE-LITQWFQKNTNLSAPAI-NFWAGGLSASFGFWTSAYPS 236
           L   ++ R+      ++ +YE LI    +K  + S  A     + G  +    W + YP 
Sbjct: 199 L-RPMMLRAGHGLGCYFLTYEALIANEIKKGKDRSEIASWKLCSYGSLSGVVLWLAIYPL 257

Query: 237 DVVKQVVLCNDKYDGSFK-SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           DVVK ++  +   +  FK S +  ++ +YR++GI  FFKGF P+ LR+ P        FE
Sbjct: 258 DVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVTFE 317

Query: 296 FVLR 299
            V+R
Sbjct: 318 LVMR 321

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score =  116 bits (290), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 129/298 (43%), Gaps = 27/298 (9%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69
           V   +AG   G+A+  VG PFDT KVRLQTS   + A       ++ V K L N+G RG 
Sbjct: 26  VKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVVRKLLANEGPRGF 78

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           Y G   PL G     S   G     +   H         L L      GV  G   SF+A
Sbjct: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLA 138

Query: 130 APVELAKAKLQVQYDAKTT-KYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188
           +P+E  + +LQ Q  + T  ++ GP++ ++K+              ++L +GL  T++  
Sbjct: 139 SPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN-----------KALLRGLTPTILRE 187

Query: 189 SNFV-FWWGSYE-LITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSAYPSDVVKQV 242
            +    ++  YE LI     K   L    I  W     G LS +   W   YP DV+K V
Sbjct: 188 GHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGT-ALWLMVYPLDVIKSV 246

Query: 243 VLCNDKYDGSF-KSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           +  ++     F  S  +    +Y   GI  FFKGF P+ LR+ P        FE  +R
Sbjct: 247 MQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMR 304

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 18/185 (9%)

Query: 103 YPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFK 162
           +P+HD   +   +++G   G     +  P +  K +LQ      ++  T  ++VV+K+  
Sbjct: 17  HPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQT-----SSTPTTAMEVVRKLLA 71

Query: 163 QGMATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWF-QKNTNLSA--PAINF 218
                     G R  YKG ++ LI     V   +G  E + ++F  +N ++S+      +
Sbjct: 72  N--------EGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQY 123

Query: 219 WAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
           +A G++        A P + V+ + L      G+   ++  +  I + R      +G  P
Sbjct: 124 YACGVTGGIVNSFLASPIEHVR-IRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTP 182

Query: 279 SFLRS 283
           + LR 
Sbjct: 183 TILRE 187

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score =  116 bits (290), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 136/302 (45%), Gaps = 30/302 (9%)

Query: 7   YSR-VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65
           Y R +   ++G   G+A+  VG PFD  KVR+QTS  GS   +      D V   +KN+G
Sbjct: 20  YKRAIKDILSGTAGGIAQVLVGQPFDITKVRMQTS-AGSATAV------DVVTSLIKNEG 72

Query: 66  IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTV 125
           I G Y G   PL G     S   G     +    +        L L    + GV +G   
Sbjct: 73  ILGFYKGTLAPLVGVGACVSCQFGVNEAMKRRFRRMNGDPSKPLSLKQYYVCGVASGCAN 132

Query: 126 SFIAAPVELAKAKLQVQYDA-KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIST 184
           +F+A P+E  + +LQ+Q  +    +Y G +D ++K+ KQG           +L +G  +T
Sbjct: 133 AFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQG-----------ALMRGFTAT 181

Query: 185 LIFRSN-FVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFG---FWTSAYPSDVVK 240
           L+   + F  ++ +YE +    Q    +    I  W   +  +F    +W  AYP DVVK
Sbjct: 182 LMRTCHGFGIYFSTYEALIAN-QHKKGIPRKDIAPWKVCIFGAFSGACYWAMAYPIDVVK 240

Query: 241 QVVLCNDKYDGSFKS---WRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFV 297
            + + +D+          W+ A S IY  RG   F KGF+P+ LRS P        FE  
Sbjct: 241 SI-MQSDRLVSPVHGTNVWQVAKS-IYTTRGKRAFIKGFMPAMLRSLPVNGATFATFEMT 298

Query: 298 LR 299
           +R
Sbjct: 299 MR 300

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score =  114 bits (286), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 138/301 (45%), Gaps = 45/301 (14%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYLGFT 74
           G  +G     + +PFDTVKVRLQT     G  + F     C+  T KN+GI +G + G  
Sbjct: 20  GSIAGALGKVIEYPFDTVKVRLQTQ----GRHV-FPDTWSCITYTYKNEGIIKGFFQGIA 74

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
            PL G  + ++AL  S +     L  Y     +   L+  +ISG  AG   SF+  PVEL
Sbjct: 75  SPLAGAAIENAALFLSYNQCSKFLQHYT----NVSDLTNILISGAFAGSCASFVLTPVEL 130

Query: 135 AKAKLQVQY-----------DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
            K KLQV             +  T ++T  I  +Q V K      G +G    L++G   
Sbjct: 131 IKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN----RGFIG----LWQGQSG 182

Query: 184 TLIFRSNF--VFWWGSYELITQWFQKNTNLSAPAI-------NFWAGGLSASFGFWTSAY 234
           T I R +F  V W+ +YEL+ ++ +   N+  P++          A G SA   F  S +
Sbjct: 183 TFI-RESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIF 241

Query: 235 PSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXF 294
           P+D VK ++             +TA+  I+ ++G+ GF++G   + +R+ P        +
Sbjct: 242 PADTVKSMM------QTEHLGLKTAIKKIFVEKGLRGFYRGLGITLIRAIPANATVFYVY 295

Query: 295 E 295
           E
Sbjct: 296 E 296

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 77/195 (39%), Gaps = 44/195 (22%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQV---------GSGAGIQFKGPLDCVYKTLKN 63
            ++G F+G   + V  P + +K +LQ S +         G+    +    +  +   +KN
Sbjct: 111 LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKN 170

Query: 64  QGIRGLYLG----FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD----KLPLSG-- 113
           +G  GL+ G    F    FG +            Y  L+ KY+   H+     LP     
Sbjct: 171 RGFIGLWQGQSGTFIRESFGGVAW-------FATYE-LMKKYLKSRHNIEDPSLPNDNKT 222

Query: 114 --CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
              + SG  AG   +    P +  K+ +Q       T++ G    ++K+F        + 
Sbjct: 223 WELLASGASAGLAFNASIFPADTVKSMMQ-------TEHLGLKTAIKKIF--------VE 267

Query: 172 GGVRSLYKGLISTLI 186
            G+R  Y+GL  TLI
Sbjct: 268 KGLRGFYRGLGITLI 282

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score =  114 bits (284), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 131/294 (44%), Gaps = 25/294 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG   GV++  +G PFDT KVRLQTS V + A       LD V K +KN+G RG Y G
Sbjct: 27  LLAGTAGGVSQVLIGQPFDTTKVRLQTSSVPTTA-------LDVVKKLVKNEGFRGFYKG 79

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKY--VYPEHDKLPLSGCIISGVMAGWTVSFIAA 130
              PL G     S   G     +   H        ++ L L    + G   G   SF+A+
Sbjct: 80  TLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYYLCGFAGGTANSFLAS 139

Query: 131 PVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS 189
           P+E  + +LQ Q       ++ GP+D ++K+     A N       SL +GL  T++  S
Sbjct: 140 PIEHVRIRLQTQTGTGAAAQFHGPLDCIKKL----TANN-------SLMRGLTPTMLRES 188

Query: 190 NFV-FWWGSYE-LITQWFQKNTNLSA-PAINFWAGGLSASFGFWTSAYPSDVVKQVVLCN 246
           +    ++ +YE LI     K  + S  P       G ++    W   YP DV+K V+  +
Sbjct: 189 HGCGVYFLTYEALIANELHKGVSRSEIPTWKLCLFGATSGTTLWLMIYPLDVIKSVMQTD 248

Query: 247 DKYD-GSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
                   K+       IY  RG+  FFKGF P+ LR+ P        FE  +R
Sbjct: 249 SLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFATFELAMR 302

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 73/188 (38%), Gaps = 28/188 (14%)

Query: 106 HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGM 165
           HD   +   +++G   G +   I  P +  K +LQ      ++  T  +DVV+K+ K   
Sbjct: 18  HDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQT-----SSVPTTALDVVKKLVKN-- 70

Query: 166 ATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINF------ 218
                  G R  YKG ++ L+     V   +G  E + ++F      S P          
Sbjct: 71  ------EGFRGFYKGTLTPLVGVGACVSVQFGVNEAMKRFFHSRNGNSGPNETLGLLQYY 124

Query: 219 ---WAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
              +AGG + SF     A P + V+ + L      G+   +   +  I +    +   +G
Sbjct: 125 LCGFAGGTANSF----LASPIEHVR-IRLQTQTGTGAAAQFHGPLDCIKKLTANNSLMRG 179

Query: 276 FLPSFLRS 283
             P+ LR 
Sbjct: 180 LTPTMLRE 187

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score =  113 bits (283), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 139/307 (45%), Gaps = 28/307 (9%)

Query: 1   MVSEETYSRVM-GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYK 59
           + S    +RV+   +AG   G+A+  VG PFDT KVRLQTS+  + A       +  +  
Sbjct: 14  LESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSETSTNA-------VKVIKD 66

Query: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119
            +KN+G  G Y G   PL G     S   G     +   H +       L L    I GV
Sbjct: 67  LIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYYICGV 126

Query: 120 MAGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
             G+T SF+A+P+E  + +LQ Q     T ++ GPID ++K+   G            L 
Sbjct: 127 AGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNG-----------QLM 175

Query: 179 KGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSA 233
           +GL  T++  S+    ++ +YE +    Q  + +    I  W     G  S +   WT  
Sbjct: 176 RGLTPTMLRESHGCGVYFLTYEALI-GHQVKSGIQRKDIPAWKLCLFGAASGTL-LWTMV 233

Query: 234 YPSDVVKQVVLCND-KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXX 292
           YP DV+K V+  ++ K   +  +  T    I  ++G+ G FKGF P+ LR+ P       
Sbjct: 234 YPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFA 293

Query: 293 XFEFVLR 299
            FE  +R
Sbjct: 294 TFETAMR 300

>Scas_667.22
          Length = 306

 Score =  111 bits (278), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/303 (29%), Positives = 130/303 (42%), Gaps = 38/303 (12%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69
           +   +AG   G+A+  VG PFDT KVRLQTS   + A       ++ + K LKN+G +G 
Sbjct: 26  IKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-------MEVIRKLLKNEGPKGF 78

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK--LPLSGCIISGVMAGWTVSF 127
           Y G   PL G     S   G     +   H    P+     L L    I G+  G T SF
Sbjct: 79  YKGTLTPLIGVGACVSLQFGVNEAMKRFFHSR-NPDSTSQILSLPQYYICGLTGGITNSF 137

Query: 128 IAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
           +A+P+E  + +LQ Q       ++ GP+D ++K+  QG              +GL  T++
Sbjct: 138 LASPIEHVRIRLQTQTGSGPNVEFKGPLDCIRKLRAQG-----------GFMRGLTPTML 186

Query: 187 FRSNFVFWWGSYELITQWFQKNT------NLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
              +     G+Y L+ +    N           PA      G  +    W   YP DV+K
Sbjct: 187 REGH---GCGTYFLVYEAMVANEINKGFKRTEVPAWKLCLFGALSGTTLWMMVYPLDVIK 243

Query: 241 QVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEF 296
            V+  ++    KY  S  S       +Y + G+  FFKGF P+ LR+ P        FE 
Sbjct: 244 SVMQTDNLKSPKYGNSISS---VAKTLYAKGGLGAFFKGFGPTMLRAAPANGATFATFEL 300

Query: 297 VLR 299
            +R
Sbjct: 301 AMR 303

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 79/190 (41%), Gaps = 27/190 (14%)

Query: 103 YPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFK 162
           +P+HD   +   +++G   G     +  P +  K +LQ      T      ++V++K+ K
Sbjct: 17  HPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTA-----MEVIRKLLK 71

Query: 163 QGMATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWFQ-KNTN-----LSAPA 215
                     G +  YKG ++ LI     V   +G  E + ++F  +N +     LS P 
Sbjct: 72  N--------EGPKGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLPQ 123

Query: 216 --INFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFF 273
             I    GG++ SF     A P + V+ + L      G    ++  +  I + R   GF 
Sbjct: 124 YYICGLTGGITNSF----LASPIEHVR-IRLQTQTGSGPNVEFKGPLDCIRKLRAQGGFM 178

Query: 274 KGFLPSFLRS 283
           +G  P+ LR 
Sbjct: 179 RGLTPTMLRE 188

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score =  110 bits (274), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 134/298 (44%), Gaps = 36/298 (12%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RG 68
           ++  + G  +G     +  PFDTVKVRLQT      A   F     C+  T +N+GI RG
Sbjct: 14  ILDIINGSIAGACGKVIEFPFDTVKVRLQTQ-----ASNVFPTTWSCIKFTYQNEGIARG 68

Query: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
            + G   PL G  + ++ L  S +     L K+     +  PL   +ISG +AG   S +
Sbjct: 69  FFQGIASPLVGACLENATLFVSYNQCSKFLEKHT----NVFPLGQILISGGVAGSCASLV 124

Query: 129 AAPVELAKAKLQV---QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTL 185
             PVEL K KLQV   Q  +  TK+T  +  ++ +  +         G+  L++G   T 
Sbjct: 125 LTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITE--------RGLAGLWQGQSGTF 176

Query: 186 IFRSNF--VFWWGSYELITQWFQKNTNLSAPAIN---FWA---GGLSASFGFWTSAYPSD 237
           I R +F  V W+ +YE++ +  +   +L  P  +    W     G SA   F  S +P+D
Sbjct: 177 I-RESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLAFNASIFPAD 235

Query: 238 VVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
            VK V+           S   AV  I+ + G+ GF++G   +  R+ P        FE
Sbjct: 236 TVKSVM------QTEHISLTNAVKKIFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score =  110 bits (275), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/318 (28%), Positives = 144/318 (45%), Gaps = 43/318 (13%)

Query: 4   EETYSRVMGFV-AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           E + +RV+  + AG   G+A+  VG PFDT KVRLQT+   +         L+ +   +K
Sbjct: 28  ELSSNRVLKDIFAGTIGGIAQVLVGQPFDTTKVRLQTATTRTTT-------LEVLRNLVK 80

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEH-------------DKL 109
           N+G+   Y G   PL G  +  S   G     +     Y   ++             + L
Sbjct: 81  NEGVFAFYKGALTPLLGVGICVSVQFGVNEAMKRFFQNYNASKNPNMSSQDVDLSRSNTL 140

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATN 168
           PLS   + G+  G   SF+A+P+E  + +LQ Q  +    ++ GP D ++K+  QG    
Sbjct: 141 PLSQYYVCGLTGGVVNSFLASPIEQIRIRLQTQTSNGGDREFKGPWDCIKKLKAQG---- 196

Query: 169 GILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWF---QKNTNLSAPAINFWAGGLSA 225
                   L +GL  T+I   +     G+Y L+ +     +  T L+   I  W   L  
Sbjct: 197 -------GLMRGLFPTMIRAGH---GLGTYFLVYEALVAREIGTGLTRNEIPPWKLCLFG 246

Query: 226 SFG---FWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSD-IYRQRGIHGFFKGFLPSFL 281
           +F     W + YP DVVK ++  +D     +K+  + V+  IY + GI  FFKGF P+ +
Sbjct: 247 AFSGTMLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMV 306

Query: 282 RSFPXXXXXXXXFEFVLR 299
           RS P        FE V+R
Sbjct: 307 RSAPVNGATFLTFELVMR 324

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score =  109 bits (272), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 137/295 (46%), Gaps = 30/295 (10%)

Query: 15  AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFT 74
           +G   GVA+  VG PFD +KVRLQT     G    ++   D V    K +G  G Y G  
Sbjct: 30  SGTVGGVAQVLVGQPFDIIKVRLQTM---PGNATAWEAITDLV----KYEGFMGFYKGTM 82

Query: 75  PPLFGWIMMDSALLG---SLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAP 131
            PL G     S   G   ++  Y   L++      + L L      G ++G   + +A P
Sbjct: 83  APLVGVGACVSCQFGINEAMKRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANALLATP 142

Query: 132 VELAKAKLQVQYDA-KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190
           +E  + +LQ+Q +A    +Y   +D  +K+ KQG           SL +G  +TL+  S+
Sbjct: 143 IEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQG-----------SLMRGFTATLMRTSH 191

Query: 191 -FVFWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSAYPSDVVKQVVLC 245
            F  ++ +YE +    Q         I+ W     G LS +F FW   YP DVVK V+  
Sbjct: 192 GFGIYFLTYETLIAS-QLAHGFRREDISAWKACMFGALSGAF-FWAMTYPFDVVKSVMQA 249

Query: 246 NDKYDGSFKSWRTAVS-DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           +   + ++ +    V+ +IYR+RG+  F KGF+P+ LRS P        FE  ++
Sbjct: 250 DKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPTMLRSLPVNGATFAAFEVTMQ 304

>Kwal_27.12599
          Length = 304

 Score =  107 bits (267), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/292 (29%), Positives = 129/292 (44%), Gaps = 23/292 (7%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG   G+A+  VG PFDT KVRLQTS   + A       ++ V K +KN+G+RG Y G
Sbjct: 28  LLAGTAGGMAQVLVGQPFDTTKVRLQTSTTPTTA-------VEVVKKLVKNEGLRGFYKG 80

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132
              PL G     S   G     +          H  L L    I G + G   SF+A+P+
Sbjct: 81  TLTPLVGVGACVSCQFGVNEAMKRFFRGSSADPHKTLTLPQYYICGFVGGVANSFLASPI 140

Query: 133 ELAKAKLQVQYDAKT-TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN- 190
           E  + +LQ Q  + T  ++ GP+D + K+   G           +L +GL  T++  +  
Sbjct: 141 EHVRIRLQTQTASGTVAEFKGPLDCINKLRANG-----------ALMRGLSPTILREAQG 189

Query: 191 FVFWWGSYE-LITQWFQKNTNLS-APAINFWAGGLSASFGFWTSAYPSDVVKQVVLCND- 247
              ++ +YE L+     K    S  PA      G  +    W + YP DV+K ++  ++ 
Sbjct: 190 CATYFLTYEALVANQIGKGIARSDVPAWKLCLFGAVSGVTLWLTVYPLDVIKSLMQTDNL 249

Query: 248 KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           K     K+       +  + G   FFKGF P+ LR+ P        FE  +R
Sbjct: 250 KNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFATFELAMR 301

>Kwal_56.23011
          Length = 303

 Score =  107 bits (266), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 88/292 (30%), Positives = 128/292 (43%), Gaps = 27/292 (9%)

Query: 15  AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFT 74
            G   GVA+  VG PFD  KVRLQTS V + A          +   +KN+G+   Y G  
Sbjct: 29  CGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAA-------QVIKSLVKNEGLLAFYKGTL 81

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
            PL G     S   G     +    K        L L      G ++G   +F+A P+E 
Sbjct: 82  APLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALRQYYACGFVSGTANAFLATPIEH 141

Query: 135 AKAKLQVQY-DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN-FV 192
            + +LQ+Q   +   +Y G +D  +K+ KQG           +L +G  +T +  S+ F 
Sbjct: 142 VRIRLQLQTASSSAAEYHGSLDCARKLLKQG-----------ALMRGFTATTLRTSHGFG 190

Query: 193 FWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSAYPSDVVKQVVLCNDK 248
            ++ +YE +    Q +  +    I  W     G  S +F FW   YP DVVK V+  +  
Sbjct: 191 IYFLTYETLIAN-QAHHGVLRENIPAWKVCVYGAFSGAF-FWAMTYPFDVVKSVMQADKL 248

Query: 249 YDGSFKSWRTAVSD-IYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
            +  +     AV+  IYR+RG   F KGF P+ LRS P        FE  +R
Sbjct: 249 KNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTMLRSLPVNGATFAAFEITMR 300

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           V G FSG     + +PFD VK  +Q  ++ +   +  + PL       + +G R    GF
Sbjct: 220 VYGAFSGAFFWAMTYPFDVVKSVMQADKLKN--PVYGRNPLAVAKAIYRERGPRAFTKGF 277

Query: 74  TPPLFGWIMMDSALLGSLH 92
           TP +   + ++ A   +  
Sbjct: 278 TPTMLRSLPVNGATFAAFE 296

>Scas_632.9
          Length = 292

 Score =  106 bits (264), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 137/294 (46%), Gaps = 36/294 (12%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RG 68
           V G +AG F  +    + +PFDTVKVRLQT     G+ I F     C+  T  N+G+ RG
Sbjct: 22  VNGSIAGAFGKI----IEYPFDTVKVRLQTQ----GSHI-FPTTWSCIKYTYHNEGVWRG 72

Query: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
            + G   PLFG  + ++ L  S +    +L K+     +  PLS  ++SG  AG   SF+
Sbjct: 73  FFQGIGSPLFGAALENATLFVSYNQCSNVLEKFT----NVSPLSNILLSGAFAGSCASFV 128

Query: 129 AAPVELAKAKLQVQYDAKTT-----KYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
             PVEL K KLQV  + +T      K+T  I  +  V ++     GILG    L++G  S
Sbjct: 129 LTPVELIKCKLQVS-NLQTAVEGQIKHTKIIPTLMYVLRE----KGILG----LWQGQSS 179

Query: 184 TLIFRS-NFVFWWGSYELITQWFQ-KNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQ 241
           T I  S   V W+ +YE++ Q  + +  +           G SA   F  S +P+D VK 
Sbjct: 180 TFIRESLGGVAWFATYEVMKQGLKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKS 239

Query: 242 VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           ++           +   AV  +    GI GF++G   + +R+ P        +E
Sbjct: 240 MM------QTEHITLINAVKKVLTTYGITGFYRGLGITLIRAVPANATVFYMYE 287

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score =  103 bits (258), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 125/284 (44%), Gaps = 27/284 (9%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYLGFT 74
           G  +G     + +PFDTVKVRLQT          F     C+  T  N+G+ RG Y G  
Sbjct: 13  GSIAGAVGKVIEYPFDTVKVRLQTQPAH-----MFPTTWSCIKFTYDNEGLWRGFYQGIG 67

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
            PL G  + ++ L  S +  + LL      E    PLS  + +G  AG   SF+  PVEL
Sbjct: 68  SPLAGAALENAVLFVSFNQAKRLLD----VESLLSPLSKTVWAGAFAGACASFVLTPVEL 123

Query: 135 AKAKLQVQYDAKT-TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS-NFV 192
            K KLQV   + T T +T  +  ++ V  +     G LG    L++G   T I  S    
Sbjct: 124 IKCKLQVSNLSTTKTSHTKILPTIKSVLSE----RGFLG----LWQGQSGTFIRESGGGA 175

Query: 193 FWWGSYELITQWFQKNTNLSAPAI-NFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDG 251
            W+ +YE++  +                A G SA   F  S +P+D +K   +  D  D 
Sbjct: 176 AWFTTYEVVKNYLASRRQAEQNTTWELLASGASAGLAFNASIFPADTIKS-TMQTDHIDL 234

Query: 252 SFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           S     +A   IY ++GI GF++G   + +R+ P        +E
Sbjct: 235 S-----SATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYE 273

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score =  102 bits (254), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 133/289 (46%), Gaps = 33/289 (11%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYLGFT 74
           G  +G     + +PFDTVKVRLQT          +     C+  T  ++GI +G Y G  
Sbjct: 14  GSVAGAIGKVIEYPFDTVKVRLQTQPAH-----LYPTTWSCIRSTYTDEGIWKGFYQGIA 68

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
            PLFG  + ++ L  S +     L ++   +    PL+  I SG  AG   SFI  PVEL
Sbjct: 69  SPLFGAALENAVLFVSFNQCTNFLDEFTQLK----PLTKTIYSGAFAGACASFILTPVEL 124

Query: 135 AKAKLQVQYD----AKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS- 189
            K KLQV       ++TT++T     ++ V K+     G+LG    L++G +ST +    
Sbjct: 125 VKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKE----KGLLG----LWQGQLSTFVRECL 176

Query: 190 NFVFWWGSYELITQWFQKNTNLSAPAINFW---AGGLSASFGFWTSAYPSDVVKQVVLCN 246
               W+ +YE++   F  + + +    + W     G SA   F  S +P+D VK V  C 
Sbjct: 177 GGAVWFTTYEIMKMKF-ASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSV--CQ 233

Query: 247 DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
            ++     S   A+  + R  GI GF++G   + +R+ P        +E
Sbjct: 234 TEH----VSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYE 278

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 76/178 (42%), Gaps = 26/178 (14%)

Query: 15  AGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAG--IQFKGPLDCVYKTLKNQGIRGLYLG 72
           +G F+G   + +  P + VK +LQ S + +      +       +   +K +G+ GL+ G
Sbjct: 107 SGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQG 166

Query: 73  FTPPLFGWIMMDSALLGSL--HNYRMLLHKY--VYPEHDKLPLSGCIISGVMAGWTVSFI 128
                     +   L G++    Y ++  K+  ++P   +      ++SG  AG   +  
Sbjct: 167 QLSTF-----VRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNAS 221

Query: 129 AAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
             P +  K+  Q       T++   ++ ++KV +    T+GI G     Y+GL  TLI
Sbjct: 222 VFPADTVKSVCQ-------TEHVSIVNALKKVLR----THGITG----FYRGLGITLI 264

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 9/61 (14%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            V+G  +GV  N    P DTVK   QT  V           ++ + K L+  GI G Y G
Sbjct: 208 LVSGASAGVLFNASVFPADTVKSVCQTEHV---------SIVNALKKVLRTHGITGFYRG 258

Query: 73  F 73
            
Sbjct: 259 L 259

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score =  102 bits (254), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/283 (30%), Positives = 130/283 (45%), Gaps = 31/283 (10%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F AG  +GV++  V +P D VK R+Q  QV  GAG  + G +DC+ K +  +G+  LY G
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQL-QVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKG 73

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132
            + P+       +        ++ L  +    E    PLS  +++G  AG   +F+  P 
Sbjct: 74  ISSPILMEAPKRATKFACNDEFQKLYKQAFGVEKLSQPLS--MLAGASAGCVEAFVVVPF 131

Query: 133 ELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFV 192
           EL K +LQ   DA ++ Y GP+DVV+K+    +A  G+L    ++Y GL STL       
Sbjct: 132 ELVKIRLQ---DA-SSSYKGPVDVVRKI----VAREGVL----AMYNGLESTLW---RHA 176

Query: 193 FWWGSYELITQWFQKNTNLSAP-------AINFWAGGLSASFGFWTSAYPSDVVKQVVLC 245
            W G Y  I   FQ    L A          +  +  +  S G   S  P DVVK  +  
Sbjct: 177 LWNGGYFGII--FQARALLPAAHNKTQCITNDLISDSIGCSIGCMLST-PFDVVKSRIQN 233

Query: 246 NDKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
                G  + +     ++  IYR+ G    +KGF+P  LR  P
Sbjct: 234 TAVIPGVVRKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 86/188 (45%), Gaps = 27/188 (14%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           E  S+ +  +AG  +G  +  V  PF+ VK+RLQ       A   +KGP+D V K +  +
Sbjct: 106 EKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQD------ASSSYKGPVDVVRKIVARE 159

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMA--- 121
           G+  +Y G    L+   + +    G +   R LL       H+K   + CI + +++   
Sbjct: 160 GVLAMYNGLESTLWRHALWNGGYFGIIFQARALLPA----AHNK---TQCITNDLISDSI 212

Query: 122 GWTV-SFIAAPVELAKAKLQ--VQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
           G ++   ++ P ++ K+++Q          KY   +  +  ++++         G R+LY
Sbjct: 213 GCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLPSLLTIYRE--------EGFRALY 264

Query: 179 KGLISTLI 186
           KG +  ++
Sbjct: 265 KGFVPKVL 272

>Kwal_26.8669
          Length = 296

 Score =  102 bits (253), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 85/282 (30%), Positives = 132/282 (46%), Gaps = 29/282 (10%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F AG  +G+++  V +P D VK R+Q  QV  G G Q+KG +DC+ + +  +G   LY G
Sbjct: 13  FAAGAVAGISEILVMYPLDVVKTRMQL-QVSGGLGPQYKGVVDCIKQIVAKEGASRLYKG 71

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEH--DKLPLSGCIISGVMAGWTVSFIAA 130
            + P    ++M++    +         K    E   +KL  S  I+SG  AG   +F+  
Sbjct: 72  ISSP----VLMEAPKRATKFACNDEFQKIYKREFGVEKLTQSLSILSGASAGCCEAFVVV 127

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190
           P EL K +LQ      ++ Y GPIDVV+K+  Q         GV ++Y GL STL +R  
Sbjct: 128 PFELVKIRLQ----DVSSSYKGPIDVVRKIIAQ--------EGVLAMYNGLESTL-WRHG 174

Query: 191 FVFWWGSYELITQ----WFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCN 246
            V+  G + +I Q      +  +       +  AG +  + G   S  P DVVK  +   
Sbjct: 175 -VWNAGYFGIIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMST-PFDVVKSRIQNT 232

Query: 247 DKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
               G  + +     ++  IY++ G    +KGF+P  LR  P
Sbjct: 233 AVVAGGARKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 87/186 (46%), Gaps = 23/186 (12%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           E  ++ +  ++G  +G  +  V  PF+ VK+RLQ   V S     +KGP+D V K +  +
Sbjct: 104 EKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQ--DVSS----SYKGPIDVVRKIIAQE 157

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124
           G+  +Y G    L+   + ++   G +   R LL +    +         +I+G + G  
Sbjct: 158 GVLAMYNGLESTLWRHGVWNAGYFGIIFQVRALLPE---AKSKSQQTRNDLIAGSIGGTI 214

Query: 125 VSFIAAPVELAKAKLQ----VQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
            S ++ P ++ K+++Q    V   A+   ++ P   +  ++K+         G R+LYKG
Sbjct: 215 GSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP--SIFTIYKE--------EGFRALYKG 264

Query: 181 LISTLI 186
            +  ++
Sbjct: 265 FVPKVL 270

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score =  101 bits (251), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/307 (28%), Positives = 138/307 (44%), Gaps = 33/307 (10%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           + E    +   ++G   G+A+  VG PFD  KVR+QTS  GS   I+       +   +K
Sbjct: 17  APEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTSS-GSPTAIEV------IKNLVK 69

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLG---SLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119
           N+G+   Y G   PL G     S   G   ++  Y + ++ Y   +   L L      G 
Sbjct: 70  NEGLLAFYKGTLVPLIGVGACVSCQFGVNEAMKRYFLRVNGY---KDQHLSLLQYYTCGF 126

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDA-KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
           ++G   +F+A P+E  + +LQ+Q  A    +Y G +D ++K+ KQ           ++L 
Sbjct: 127 VSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQ-----------KALM 175

Query: 179 KGLISTLIFRSN-FVFWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSA 233
           +G  +TL+  S+ F  ++ +YE +     KN  L    I  W     G  S +F FW   
Sbjct: 176 RGFTATLMRTSHGFGVYFLTYEALIMNQNKNGVLRKD-IPPWKVCVFGAFSGAF-FWAMT 233

Query: 234 YPSDVVKQVVLCNDKYDGSF-KSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXX 292
           YP DVVK ++  +        K+       I+  RG   F KGF+P+ LRS P       
Sbjct: 234 YPFDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFA 293

Query: 293 XFEFVLR 299
            FE  +R
Sbjct: 294 TFEVTMR 300

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 131/299 (43%), Gaps = 28/299 (9%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL 61
           +SE+        + G  +G     V +PFDTVKVRLQT      +   F     CV  T 
Sbjct: 1   MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQ-----SAALFPTTWSCVSHTY 55

Query: 62  KNQGI-RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
           K +G+ RG Y G   P+FG  +  + L  S +  + +L       +   PL   + +G +
Sbjct: 56  KQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENC----YSCGPLEKVVFAGAI 111

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTT--KYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
           AG   S++  PVEL K KLQV      +  +YT  +  ++ + KQ    NG LGG   L+
Sbjct: 112 AGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQ----NG-LGG---LW 163

Query: 179 KGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAI-NFWAGGLSASFGFWTSAYPS 236
           +G   T I  S     W+ +YE++  W  +    +   +    A G  A   F  S +P+
Sbjct: 164 QGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHASIFPA 223

Query: 237 DVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           D VK  +       G       AV  + ++ G  GF++G   + LR+ P        +E
Sbjct: 224 DTVKSTMQTEHLGLGP------AVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE 276

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 94.7 bits (234), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 140/298 (46%), Gaps = 32/298 (10%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG--AGIQFKGPLDCVYK 59
           +SE+    +  FV+G  +GV++  V +P D VK R+Q  QVGSG  +G+ + G +DC+ +
Sbjct: 1   MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQL-QVGSGTGSGVAYNGVIDCLGQ 59

Query: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119
            +K +G   LY G + P+       +       +Y+ +  K +Y   DKL     I+SG 
Sbjct: 60  IVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMF-KDLY-GVDKLTQQISILSGS 117

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
           +AG T + +  P EL K +LQ       +K+ GP++VV K  ++         G+ SLY 
Sbjct: 118 LAGVTEACVIVPFELVKIRLQ----DVNSKFNGPMEVVFKTIRE--------TGILSLYN 165

Query: 180 GLISTLIFRSNFVFWWGSY-----ELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAY 234
           GL ST+ +R+   FW G Y     ++     +  TN      +  AG +     + T   
Sbjct: 166 GLESTM-WRN--AFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT 222

Query: 235 PSDVVKQVV---LCNDKYDGSFK---SWR-TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              VVK  +         DG+     +W   ++  IY + G    +KGF+P  LR  P
Sbjct: 223 ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 93.2 bits (230), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 78/287 (27%), Positives = 126/287 (43%), Gaps = 32/287 (11%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ---TSQVGSGAGIQ---FKGPLDCVYKTLKNQGI 66
           F++G  +G+++ TV +P D VK R Q   T+   +  G Q   + G +DC+ K +K +G 
Sbjct: 16  FISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGF 75

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
             LY G + P+       +        Y+ +             +S  I +G  AG T +
Sbjct: 76  SRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS--IAAGASAGMTEA 133

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
            +  P EL K ++Q   D K++ Y GP+D ++K  K      GI+G    LYKG+ ST+ 
Sbjct: 134 AVIVPFELIKIRMQ---DVKSS-YLGPMDCLKKTIKN----EGIMG----LYKGIESTM- 180

Query: 187 FRSNFVFWWGS-----YELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQ 241
           +R+    W G      Y++        T       +  AG +  + G   +  P DVVK 
Sbjct: 181 WRN--ALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNT-PFDVVKS 237

Query: 242 VVLCNDKYDGSFKSWRTAVSD---IYRQRGIHGFFKGFLPSFLRSFP 285
            +   D    + K +   +     IYR+ G    +KGF+P   R  P
Sbjct: 238 RIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAP 284

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (47%), Gaps = 22/183 (12%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           + ET  ++    AG  +G+ +  V  PF+ +K+R+Q  +        + GP+DC+ KT+K
Sbjct: 113 TNETTQKI-SIAAGASAGMTEAAVIVPFELIKIRMQDVKS------SYLGPMDCLKKTIK 165

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAG 122
           N+GI GLY G    ++   + +    G ++  R   +     +         +I+G + G
Sbjct: 166 NEGIMGLYKGIESTMWRNALWNGGYFGVIYQVR---NSMPVAKTKGQKTRNDLIAGAIGG 222

Query: 123 WTVSFIAAPVELAKAKLQVQYDAKTT---KYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
              + +  P ++ K+++Q   DA ++   KY   +  +  ++++         G R+LYK
Sbjct: 223 TVGTMLNTPFDVVKSRIQ-SVDAVSSAVKKYNWCLPSLLVIYRE--------EGFRALYK 273

Query: 180 GLI 182
           G +
Sbjct: 274 GFV 276

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 80/189 (42%), Gaps = 29/189 (15%)

Query: 109 LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTT--------KYTGPIDVVQKV 160
           LP     ISG +AG +   +  P+++ K + Q++    T         +Y G ID ++K+
Sbjct: 10  LPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKI 69

Query: 161 FKQGMATNGILGGVRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQK--NTNLSAPAIN 217
            K+         G   LY+G+ S ++  +      +   +   + F+   NTN +   I+
Sbjct: 70  VKK--------EGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKIS 121

Query: 218 FWAGGLSASFGFWTSA--YPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFK 274
             AG   AS G   +A   P +++K ++      Y G     +  +    +  GI G +K
Sbjct: 122 IAAG---ASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTI----KNEGIMGLYK 174

Query: 275 GFLPSFLRS 283
           G   +  R+
Sbjct: 175 GIESTMWRN 183

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 92.0 bits (227), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 130/290 (44%), Gaps = 21/290 (7%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           M  ++    V  F+AG  +GV++  V +P D VK  +Q  QV  G+G Q+KG  DC+ + 
Sbjct: 1   MSDQKPLPFVYQFMAGAVAGVSEILVMYPLDMVKTVMQL-QVSGGSGPQYKGVFDCLKQI 59

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
              +G   LY G + P+       +        ++ +       E    PLS  I+SG  
Sbjct: 60  AAKEGPSRLYKGISSPILMEAPKRATKFACNDEFQKIYKDLFGAEKLTQPLS--ILSGAS 117

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           AG   SF+  P EL K +LQ      ++K+T PI VV+ + ++         G+ ++Y G
Sbjct: 118 AGICESFVVVPFELVKIRLQ----DVSSKFTSPIAVVKNIVEK--------EGILAMYNG 165

Query: 181 LISTLIFRS--NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDV 238
           L ST+      N  ++   +++     + +T       +  AG +  +     S  P DV
Sbjct: 166 LESTMWRHGIWNAGYFGIIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLST-PFDV 224

Query: 239 VKQVVLCNDKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           VK  V       G  + +     A++ IY++ G    +KGF+P  LR  P
Sbjct: 225 VKSRVQNTAVIPGVPRKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274

>Scas_640.25
          Length = 306

 Score = 89.7 bits (221), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 138/285 (48%), Gaps = 30/285 (10%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA----GIQFKGPLDCVYKTLKNQGIRG 68
           F+AG  +G+++  V +P D VK R+Q  QV +GA       +KG +DC+ + +K +G   
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQL-QVSTGAAGASATHYKGVIDCLSQIVKKEGPMH 75

Query: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
           +Y G + P+       +    S   + + L K V+    +L     ++SG  AG T + +
Sbjct: 76  MYKGISSPMLMEAPKRAVKFASNDEF-IKLWKSVFGT-KQLTQQISVLSGASAGITEALV 133

Query: 129 AAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188
             P EL K +LQ       +K+ GP++V++ + KQ         G++ LY G+ ST ++R
Sbjct: 134 IVPFELVKIRLQ----DVNSKFKGPVEVLKHIIKQ--------DGLKGLYSGVEST-VWR 180

Query: 189 SNFVFWWGSYELITQWFQ----KNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244
            N V+  G + +I Q  +      +       +  AG +  +FG   +  P DVVK  + 
Sbjct: 181 -NAVWNAGYFGVIFQVRELLPVAKSKQEKTRNDLCAGFVGGTFGVMFNT-PFDVVKSRIQ 238

Query: 245 C--NDKYDGSFK-SWR-TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              N+  +G  K +W   +V  IY + G    +KGF+P  LR  P
Sbjct: 239 SDGNEIINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 38/192 (19%)

Query: 109 LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYD-----AKTTKYTGPIDVVQKVFKQ 163
           LP     ++G +AG +   +  P+++ K ++Q+Q       A  T Y G ID + ++ K+
Sbjct: 11  LPFRYQFMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKK 70

Query: 164 GMATNGILGGVRSLYKGLISTLI---------FRSN--FVFWWGSYELITQWFQKNTNLS 212
                    G   +YKG+ S ++         F SN  F+  W S     Q  Q+ + LS
Sbjct: 71  --------EGPMHMYKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQLTQQISVLS 122

Query: 213 APAINFWAGGLSASFGFWTSAYPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHG 271
                    G SA         P ++VK ++   N K+ G  +     +  I +Q G+ G
Sbjct: 123 ---------GASAGITEALVIVPFELVKIRLQDVNSKFKGPVE----VLKHIIKQDGLKG 169

Query: 272 FFKGFLPSFLRS 283
            + G   +  R+
Sbjct: 170 LYSGVESTVWRN 181

>Scas_714.18
          Length = 305

 Score = 89.0 bits (219), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 123/298 (41%), Gaps = 31/298 (10%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYLG 72
           +AG  +G     + +PFDTVKVRLQT +        F     C+  T +N+GI  G Y G
Sbjct: 17  LAGSIAGAIGKFIEYPFDTVKVRLQTQE-----AYMFPSTWSCIKYTYENEGILEGFYQG 71

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132
              PL G  + ++ L  + +     L+ +   E     +   +IS   AG   SF+  PV
Sbjct: 72  IESPLIGAALENAILFLAYNQCSSFLNAFT--EFSAFLI--ILISAGFAGSCASFVLTPV 127

Query: 133 ELAKAKLQVQ------YDAKTTKYTGPIDVVQKVFKQGMATNGI--------LGGVRSLY 178
           EL K KLQ+       +D    +     +    V  +G  T  I          G+  L+
Sbjct: 128 ELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGLFGLW 187

Query: 179 KGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSD 237
           +G  ST I  S   V W+ +YEL+ Q  +   +           G +A   F  S +P+D
Sbjct: 188 QGQSSTFIRESIGSVVWFATYELMKQTLRDPKSEVNTTWQLLISGATAGLAFNGSVFPAD 247

Query: 238 VVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
            VK ++           +    V  I  + G+ GF++G   + LR+ P        +E
Sbjct: 248 TVKSIM------QTEHLALMETVRSILERDGVAGFYRGLGITLLRAVPSNAAVFYTYE 299

>Kwal_55.21335
          Length = 317

 Score = 88.6 bits (218), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 121/284 (42%), Gaps = 27/284 (9%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG-IRGLYLGFT 74
           G  +G A   + +P DT+KVRLQT          F     C+  T + +G ++G Y G  
Sbjct: 52  GSIAGAAGKVIEYPLDTIKVRLQTQPAHV-----FPTSWSCIKYTYQKEGFVKGFYQGVA 106

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
            PL G  + ++ L  + +  +  L +Y        PLS  ++SG  AG   S++  PVEL
Sbjct: 107 SPLVGAALENAVLFVTFNRAQNFLQQY----ESVSPLSQTVLSGAFAGACTSYVLTPVEL 162

Query: 135 AKAKLQV-QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR-SNFV 192
            K  LQV   +  TT+++     V+ + +          G+  L++G  ST I   +   
Sbjct: 163 IKCTLQVSNLEGATTRHSKIWPTVKHIVQH--------KGIGGLWQGQSSTFIRECAGGA 214

Query: 193 FWWGSYELITQWFQKNTNLSAPAI-NFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDG 251
            W+ +YE +  +  +  N +        A G SA   F  S +P+D +K       ++ G
Sbjct: 215 VWFTTYESLKSYLARRRNDTENHTWELLASGASAGVAFNASIFPADTIKST--AQTQHLG 272

Query: 252 SFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
                  A   I  + G  G ++G   + +R+ P        +E
Sbjct: 273 IVD----ATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYE 312

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 25/61 (40%), Gaps = 9/61 (14%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
             +G  +GVA N    P DT+K   QT         Q  G +D   + L   G  GLY G
Sbjct: 242 LASGASAGVAFNASIFPADTIKSTAQT---------QHLGIVDATKRILARSGPAGLYRG 292

Query: 73  F 73
            
Sbjct: 293 L 293

>Kwal_23.2913
          Length = 320

 Score = 87.8 bits (216), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 123/307 (40%), Gaps = 49/307 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK---------- 62
             AG   GV     GHPFD +KVR Q++Q          G LD + + L           
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLLKVRCQSNQA--------SGTLDAISRVLHEAKSKSGPLP 83

Query: 63  -NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD---------KLPLS 112
            NQ I+G Y G  PPL G   + +         + L+     P  D          L  S
Sbjct: 84  LNQ-IKGFYRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTS 142

Query: 113 GCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILG 172
              ++G  +    + I AP E  K  LQ      T++    +   + + ++G        
Sbjct: 143 QLALAGFFSAIPTTLITAPTERVKVVLQ------TSESGSFLGAARTLIREG-------- 188

Query: 173 GVRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSA-PAINFWAGGLSASFGFW 230
           GVRSL++G ++TL         ++ SYE+  ++  +N +  A   ++    G  A    W
Sbjct: 189 GVRSLFQGTLATLARDGPGSALYFASYEVSKRFLSRNQDTDALSVVSICVAGGVAGMSMW 248

Query: 231 TSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXX 290
              +P D +K  +  + +     +S   A  +IY + G+ GFF G  P+ +RSFP     
Sbjct: 249 IGVFPIDTIKTKLQSSSRS----QSMVQAAREIYTRAGLRGFFPGLGPALMRSFPANAAT 304

Query: 291 XXXFEFV 297
               EF 
Sbjct: 305 FLGVEFT 311

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 81/197 (41%), Gaps = 26/197 (13%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           +AG FS +    +  P + VKV LQTS+ GS  G             ++  G+R L+ G 
Sbjct: 146 LAGFFSAIPTTLITAPTERVKVVLQTSESGSFLG--------AARTLIREGGVRSLFQGT 197

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVE 133
              L       +    S    +  L +    + D L +    ++G +AG ++     P++
Sbjct: 198 LATLARDGPGSALYFASYEVSKRFLSR--NQDTDALSVVSICVAGGVAGMSMWIGVFPID 255

Query: 134 LAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI--FRSNF 191
             K KLQ      +++    +   ++++ +         G+R  + GL   L+  F +N 
Sbjct: 256 TIKTKLQ-----SSSRSQSMVQAAREIYTR--------AGLRGFFPGLGPALMRSFPANA 302

Query: 192 VFWWGSYELITQWFQKN 208
             + G  E   Q F++N
Sbjct: 303 ATFLG-VEFTHQLFKQN 318

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 133/310 (42%), Gaps = 34/310 (10%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS--QVGSGAGIQFKGPLDCVYK 59
           +++   + + G +AG+ SG+    V  P D  K RLQ    Q  +   + ++G +  +  
Sbjct: 65  LNDNRINAISGALAGLLSGI----VVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTT 120

Query: 60  TLKNQGIRGLYLGFTPPLFG----WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCI 115
            ++++G+RGLY G  P + G    W++  S       N R     + +  H         
Sbjct: 121 IVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHS-------- 172

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYD--AKTTKYTGPIDVVQKVFKQGMATNGILGG 173
            S + AG   + +  P+ + K +L +Q    + TT Y G  D  +K+  Q         G
Sbjct: 173 FSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQ--------EG 224

Query: 174 VRSLYKGLISTLIFRSNFVFWWGSYELIT---QWFQKNTNLSAPAINFWAGGLSASFGFW 230
           V++LY GL+ +L+   +    +  YE +    + +Q++ + +   IN     L++S    
Sbjct: 225 VKALYAGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKM 284

Query: 231 TS---AYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXX 287
            +   +YP ++++  +          +     +   Y Q GI GF+ GF  +  R+ P  
Sbjct: 285 VASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPAS 344

Query: 288 XXXXXXFEFV 297
                 FE+V
Sbjct: 345 AITLVSFEYV 354

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 132/294 (44%), Gaps = 44/294 (14%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---------QFKGPLDCVYKTLKN 63
           F AG  +GV++  V +P D VK R+Q      G             + G +DC+ K +K 
Sbjct: 15  FTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKK 74

Query: 64  QGIRGLYLGFTPPLFGWIMMDS---ALLGSLHNYRMLLHKYVYPEHD-KLPLSGCIISGV 119
           +G   LY G T P    I+M++   A+  S ++     +K ++P  + ++     I SG 
Sbjct: 75  EGFSHLYKGITSP----ILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGA 130

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
            AG   +F+ AP EL K +LQ       +++  PI+VV+         + + GGV SL+ 
Sbjct: 131 SAGAVEAFVVAPFELVKIRLQ----DVNSQFKTPIEVVK--------NSVVKGGVLSLFN 178

Query: 180 GLISTLIFRSNFVFWWGSYELITQWFQK-----NTNLSAPAINFWAGGLSASFGFWTSAY 234
           GL +T I+R   V W   Y  I    +K      T+      +  AG +  + G   +  
Sbjct: 179 GLEAT-IWRH--VLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNT- 234

Query: 235 PSDVVKQVVLCNDKYDGSFKSWR---TAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           P DVVK  +    +  G  + +     +V  +YR+ G    +KGF P  +R  P
Sbjct: 235 PFDVVKSRI---QRSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAP 285

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 19/96 (19%)

Query: 105 EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAK-----------TTKYTGP 153
           ++  LP      +G +AG +   +  P+++ K ++Q+Q   K              YTG 
Sbjct: 5   DNRPLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGV 64

Query: 154 IDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS 189
           +D + K+ K+         G   LYKG+ S ++  +
Sbjct: 65  MDCLTKIVKK--------EGFSHLYKGITSPILMEA 92

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 86.7 bits (213), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 119/299 (39%), Gaps = 47/299 (15%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL- 61
           S   Y       AG   GV     GHPFD +KVR Q++Q          G +D V K L 
Sbjct: 41  SNALYENAKSLAAGAVGGVCAVLTGHPFDLLKVRCQSNQA--------SGTVDAVRKILV 92

Query: 62  --KNQG-------IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD-KLPL 111
             + Q        +RG Y G  PPL G   + +    S   Y +      + ++  KL  
Sbjct: 93  EARAQSGLSAVNMMRGFYKGVIPPLLGVTPIFAV---SFWGYDVGKKLVTWNDNSGKLTT 149

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           +    +G ++    + + AP E  K  LQ Q +                   G A   IL
Sbjct: 150 AQLATAGFISAIPTTLVMAPTERVKVVLQTQSN----------------HSLGSAAKHIL 193

Query: 172 --GGVRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAI-NFWAGGLSASF 227
             GGVRSL++G ++TL         ++ SYE    +    +  +  +I N    G  A  
Sbjct: 194 ATGGVRSLFRGSLATLARDGPGSALYFASYEATKAYLNARSGTNELSIKNVCLAGGMAGV 253

Query: 228 GFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQR-GIHGFFKGFLPSFLRSFP 285
             W   +P D +K  +  ++      ++ R     IY  R GI GFF G  P+ LRSFP
Sbjct: 254 SMWVGVFPIDTIKTELQSSNTRQTMMEATR----KIYNTRGGIKGFFPGIGPALLRSFP 308

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 86.3 bits (212), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 123/303 (40%), Gaps = 45/303 (14%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG----------AGIQFKG 52
           S      +  FVAG   GV     GHPFD +KVR Q  Q  S           A  Q KG
Sbjct: 29  SNPVRENIKSFVAGGVGGVCAVFTGHPFDLIKVRCQNGQANSTVHAITNIIKEAKTQVKG 88

Query: 53  PLDCVYKTLKNQGIRGLYLGFTPPLFGWI-MMDSALLGSLHNYRMLLHKYVYPEHDKLPL 111
                  TL    ++G Y G  PPL G   +   +  G     +++         ++L +
Sbjct: 89  -------TLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTM 141

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
                +G ++    + + AP E  K  LQ      T+     I   + + K+        
Sbjct: 142 GQMAAAGFISAIPTTLVTAPTERVKVVLQ------TSSKGSFIQAAKTIVKE-------- 187

Query: 172 GGVRSLYKGLISTLIFRS-NFVFWWGSYELITQWF-----QKNTNLSAPA--INFWAGGL 223
           GG+ SL+KG ++TL         ++ SYE+   +      +++     P   +N    G 
Sbjct: 188 GGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCLAGG 247

Query: 224 SASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQR-GIHGFFKGFLPSFLR 282
            A    W + +P D +K  +    +   + ++  +A  +IY QR GI GFF G  P+ LR
Sbjct: 248 IAGMSMWLAVFPIDTIKTKL----QASSTRQNMLSATKEIYLQRGGIKGFFPGLGPALLR 303

Query: 283 SFP 285
           SFP
Sbjct: 304 SFP 306

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 85.9 bits (211), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 115/297 (38%), Gaps = 51/297 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG---------AGIQFKGPLDCVYKTLKN 63
             AG   GV     GHPFD VKVR Q++Q  S          A  Q  GP          
Sbjct: 32  LAAGGVGGVCAVLTGHPFDLVKVRCQSNQARSAMDAVSHILQAARQAAGPTSL------- 84

Query: 64  QGIRGLYLGFTPPLFGWIMM----------DSALLGSLHNYRMLLHKYVYPEHDKLPLSG 113
             +RG Y G  PPL G   +             L+ S+ +        V PE   L LS 
Sbjct: 85  NAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGAAAVEPE---LTLSQ 141

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
              +G ++    + + AP E  K  LQ      T      +D  +++ +          G
Sbjct: 142 MAAAGFISAIPTTLVTAPTERVKVVLQT-----TQGKASFLDAAKQIVRT--------QG 188

Query: 174 VRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQK---NTNLSAPAINFWAGGLSASFGF 229
            +SL+KG ++TL         ++ SYE+  ++  K   +T+      N    G  A    
Sbjct: 189 FQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELSITNVCISGGMAGVSM 248

Query: 230 WTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQR-GIHGFFKGFLPSFLRSFP 285
           W   +P D VK  +  + K     +  R     IY  R GI GFF G  P+ LRSFP
Sbjct: 249 WVVVFPIDTVKTQLQSSSKRQSMLEVTRM----IYNTRGGIKGFFPGVGPAILRSFP 301

>Scas_697.47
          Length = 328

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 84/290 (28%), Positives = 123/290 (42%), Gaps = 39/290 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGS---GAGIQFKGPLDCVYKTLKNQGIRGL 69
            VAG   GV     GHPFD +KVR Q+ Q  S      I  K         +    ++G 
Sbjct: 40  LVAGGVGGVCAVLTGHPFDLIKVRCQSGQASSTIHAIKIILKDARAIPTSNMLVNSVKGF 99

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD----KLPLSGCIISGVMAGWTV 125
           Y G  PPL G   + +    S   Y   + K +    D    +L +     +G ++    
Sbjct: 100 YKGVIPPLLGVTPIFAV---SFWGYD--VGKKIVTRSDSSSAQLTMGQMAAAGFISAIPT 154

Query: 126 SFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTL 185
           + + AP E  K  LQ       T + G     + + K         GGV+SL+KG ++TL
Sbjct: 155 TLVTAPTERIKVVLQTAGANSKTSFIG---AAKNIVKD--------GGVKSLFKGSLATL 203

Query: 186 IFRS-NFVFWWGSYELITQWFQKNTNLSAPA----INF----WAGGLSASFGFWTSAYPS 236
                    ++ SYE I++ F  + N +A +    +N      AGG+ A    W   +P 
Sbjct: 204 ARDGPGSALYFASYE-ISKKFLNDRNATAESKTGEVNIANVCLAGGI-AGMSMWLVVFPI 261

Query: 237 DVVKQVVLCNDKYDGSFKSWRTAVSDIYRQR-GIHGFFKGFLPSFLRSFP 285
           D +K  +       GS +S   A  +IY +R GI GFF G  P+ LRSFP
Sbjct: 262 DTIKTKL---QSSSGS-QSMVAATREIYVKRGGIKGFFPGLGPALLRSFP 307

>Scas_589.10
          Length = 316

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 128/292 (43%), Gaps = 38/292 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ---------TSQVGSGAGIQFKGPLDCVYKTLKN 63
           F++G  +G+++  + +P D VK R Q         TS V      +    L C+ K LK 
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 64  QGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGW 123
           +G + LY G +PPL   +   +    S   ++ ++ K    +  ++  +  +++G  AG 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKF--KLKEVTSTVTLLAGTFAGI 134

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
           T S I  P EL K +LQ   DA+ + Y  PI   + + +      G+ G    +Y G  S
Sbjct: 135 TESLIVVPFELVKIRLQ---DAQ-SDYRSPIRCTRTIIE----NQGLFG----IYAGFES 182

Query: 184 TLIFRSNFVFWWGSY-ELITQ------WFQKNTNLSAPAINFWAGGLSASFGFWTSAYPS 236
           T I+R+    W  SY  LI Q        +  T       +F  G ++     + S  P 
Sbjct: 183 T-IWRNT--IWNASYFGLIFQVKKFIPRAKSTTKFQGIRNDFLVGAIAGCMSCFLSV-PF 238

Query: 237 DVVKQVVLCNDKYDGSFK---SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           DVVK  +  + K         +W++ V  IYR  GI G +KG LP   R  P
Sbjct: 239 DVVKTRMQGSKKTSSGMCYGWAWQS-VFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 78/194 (40%), Gaps = 34/194 (17%)

Query: 108 KLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKT-----------TKYTGPIDV 156
           KLP     ISG +AG + + +  P+++ K + Q+Q + K             +++  +  
Sbjct: 10  KLPFIYQFISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSC 69

Query: 157 VQKVFKQGMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYELITQWFQKNTNLS--A 213
           + K+ K+         G ++LYKG+   L+         + S E   Q   K   L    
Sbjct: 70  LSKILKE--------EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLKEVT 121

Query: 214 PAINFWAG---GLSASFGFWTSAYPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGI 269
             +   AG   G++ S        P ++VK ++      Y    +  RT + +    +G+
Sbjct: 122 STVTLLAGTFAGITESL----IVVPFELVKIRLQDAQSDYRSPIRCTRTIIEN----QGL 173

Query: 270 HGFFKGFLPSFLRS 283
            G + GF  +  R+
Sbjct: 174 FGIYAGFESTIWRN 187

>Scas_709.9
          Length = 365

 Score = 84.0 bits (206), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 136/310 (43%), Gaps = 35/310 (11%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL 61
           +S+   + + G +AG  SG+    +  P D  K RLQ   + S     ++G L  +   +
Sbjct: 61  LSDPKITALSGALAGFLSGI----IVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIV 116

Query: 62  KNQGIRGLYLGFTPPLFG----WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIIS 117
            ++G+RGLY G  P + G    W+     +  S++ +   L+  V P  D +  S C  S
Sbjct: 117 VDEGVRGLYKGLIPIILGYFPTWM-----IYFSVYEFAKDLYPRVLPNSDFISHS-C--S 168

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQ--YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR 175
            + AG   + +  P+ + K +L +Q       T Y G ID  +K+  Q         GVR
Sbjct: 169 AITAGAASTVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQ--------EGVR 220

Query: 176 SLYKGLISTLIFRSNFVFWWGSYELITQWFQKNT-----NLSAPAINFWAGGLSASFGFW 230
           +LY GL+ ++    +    +  YE +      +T     N    +++     +++S    
Sbjct: 221 TLYTGLVPSMFGLLHVAIHFPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKM 280

Query: 231 TSA---YPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPX 286
            ++   YP ++++ ++ L +DK   S       +   YR  G+ GF+ GF  + LR+ P 
Sbjct: 281 LASILTYPHEILRTRMQLKSDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPA 340

Query: 287 XXXXXXXFEF 296
                  FE+
Sbjct: 341 SAITLVSFEY 350

>Kwal_47.17321
          Length = 881

 Score = 82.8 bits (203), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 136/295 (46%), Gaps = 41/295 (13%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F+ G  +G    T  +P D VK R+Q  +  S    Q+K  +DC  K    +GI
Sbjct: 498 FDSIYNFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFS----QYKNSIDCFVKIFSREGI 553

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RG+Y G  P L G +  + A+  ++++Y   + K +  E+++L L   IISG  AG    
Sbjct: 554 RGIYSGLGPQLVG-VAPEKAIKLTVNDY---VRKLLMDENNRLTLPLEIISGAAAGACQV 609

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILG--GVRSLYKGLIST 184
               P+E+ K +LQV+     ++Y   +       K  +   G++   G+R LYKGL++ 
Sbjct: 610 IFTNPLEIVKIRLQVR-----SEYADSLP------KSQLTALGVVKSLGLRGLYKGLVAC 658

Query: 185 LIFRSNF-VFWWGSY----ELITQWFQKNTNLSAPAINFW----AGGLSASFGFWTSAYP 235
           L+    F   ++ +Y      I  +  ++ N  A  ++ W    AGGL+     + +  P
Sbjct: 659 LMRDVPFSAIYFPTYAHLKRDIFNYDPQDKNKRA-RLHTWELLTAGGLAGMPAAYLTT-P 716

Query: 236 SDVVKQVVLCN-----DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
            DV+K  +  +      +Y G   + RT    I ++     FFKG     LRS P
Sbjct: 717 FDVIKTRLQIDPRKGETRYTGILHAART----ILKEERFKSFFKGGGARVLRSSP 767

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 82.0 bits (201), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 80/307 (26%), Positives = 132/307 (42%), Gaps = 42/307 (13%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G    T+ +P D VK R+Q  +  S    Q+K  +DC  K L  +GI
Sbjct: 541 FDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRSLS----QYKNSIDCFLKILSREGI 596

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RG+Y G  P L G +  + A+  ++++Y   +   +  ++ KL L   IISG  AG    
Sbjct: 597 RGVYSGLGPQLIG-VAPEKAIKLTVNDY---MRNKLKDKNGKLGLLSEIISGASAGACQV 652

Query: 127 FIAAPVELAKAKLQVQ-----YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGL 181
               P+E+ K +LQV+      +A+  K T  + +++++            G+  LYKG 
Sbjct: 653 IFTNPLEIVKIRLQVKGEYVAENAENAKLTA-LQIIKRL------------GLPGLYKGA 699

Query: 182 ISTLIFRSNF-VFWWGSYELITQ---WFQKNTNLSAPAINFWAGGLSASFGFWTSAY--- 234
            + L+    F   ++ +Y  + +    F  N       +N W    + +     +AY   
Sbjct: 700 AACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMPAAYLTT 759

Query: 235 PSDVVKQVVLCNDK-----YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXX 289
           P DV+K  +  + K     Y G   + RT    I R+     FFKG     LRS P    
Sbjct: 760 PFDVIKTRLQIDPKKGETIYKGIIHAART----ILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 290 XXXXFEF 296
               +E 
Sbjct: 816 TLAAYEL 822

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 80.1 bits (196), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 118/301 (39%), Gaps = 55/301 (18%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN-------- 63
             VAG   GV     GHPFD +KVR Q++Q         K  +D V   LK         
Sbjct: 24  ALVAGGVGGVCAVLTGHPFDLIKVRCQSNQA--------KSTMDAVSIILKEARSLSTVN 75

Query: 64  ----------QGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG 113
                       ++G Y G  PPL G   + +    S   Y +      + +    PL+ 
Sbjct: 76  GSLTTSLFFKNSVKGFYKGVIPPLIGVTPIFAV---SFWGYDIGKRLVTWKQASDAPLTT 132

Query: 114 CII--SGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
             +  +G ++    + + AP E  K  LQ   + K +       +V              
Sbjct: 133 AQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVST------------ 180

Query: 172 GGVRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQKN-TNLSAPAINF----WAGGLSA 225
           GGV+SL+ G ++TL         ++ SYEL   +  K+        +N      AGG+ A
Sbjct: 181 GGVKSLFNGSLATLARDGPGSALYFASYELSKAFLNKSVAKKDKDEVNLANVCLAGGI-A 239

Query: 226 SFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQR-GIHGFFKGFLPSFLRSF 284
               W   +P D +K  +    +   +  S   A  DIY QR GI GFF G  P+ LRSF
Sbjct: 240 GMSMWLVVFPIDTIKTRL----QVATTPISMVQATKDIYIQRGGIKGFFPGLGPALLRSF 295

Query: 285 P 285
           P
Sbjct: 296 P 296

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 81.3 bits (199), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/304 (25%), Positives = 129/304 (42%), Gaps = 39/304 (12%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G    TV +P D VK R+Q  +      +Q+K  +DCV K  + +GI
Sbjct: 502 FDSIHNFTLGSIAGCIGATVVYPIDLVKTRMQAQR----NSVQYKNSIDCVVKIFQTKGI 557

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RGLY G  P L G +  + A+  +++++   + +Y   +   +     I+SG  AG    
Sbjct: 558 RGLYSGLGPQLIG-VAPEKAIKLTVNDF---MRQYFMNKSRTIKWYQEILSGATAGACQV 613

Query: 127 FIAAPVELAKAKLQVQYD---AKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
               P+E+ K +LQ++ D          G + +++++            G+R LYKG  +
Sbjct: 614 VFTNPLEIVKIRLQMRSDYVGENARPQLGAVGIIRQL------------GLRGLYKGAAA 661

Query: 184 TLIFRSNF-VFWWGSYELITQ---WFQKNTNLSAPAINFWAGGLSASFGFWTSAY---PS 236
            L+    F   ++ +Y  + +    F  N       +  W   L+       +AY   P 
Sbjct: 662 CLLRDVPFSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPF 721

Query: 237 DVVKQVVLCNDK-----YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXX 291
           DV+K  +  + +     Y G   + RT    I ++  I  FFKG     LRS P      
Sbjct: 722 DVIKTRLQIDPRKGETTYTGVIHAART----ILKEESIKSFFKGGPARVLRSSPQFGFTL 777

Query: 292 XXFE 295
             FE
Sbjct: 778 AAFE 781

>Kwal_55.20868
          Length = 380

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 126/309 (40%), Gaps = 48/309 (15%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
           G +AG  +GV   TV  P D  K RLQ   + S     +KG L  +   ++++G RGLY 
Sbjct: 82  GAMAGFLAGV---TVC-PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYK 137

Query: 72  GFTPPLFG----WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
           G  P + G    W+     +  S++     L+  ++P  D +  S    S + AG   + 
Sbjct: 138 GLVPIIMGYFPTWM-----IYFSVYERSKKLYPRIFPSFDFISHSA---SALTAGTVSTI 189

Query: 128 IAAPVELAKAK--LQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTL 185
           +  PV + K +  LQ   +  +T YT   D   K++           G+R+ Y GL+ +L
Sbjct: 190 LTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTT--------EGLRTFYAGLLPSL 241

Query: 186 IFRSNFVFWWGSYELITQWFQ----------KNTNLSAPAINFWAGGLSASFGFWTSAYP 235
           +   +    +  YE +  W             N NL+   I   A  + AS    T  YP
Sbjct: 242 LGLFHVAIHFPIYEKLKVWLHCTPSMSRTEDHNLNLARLIIASSASKMVAS----TLTYP 297

Query: 236 SDVVKQVVLC----NDKYDGSFKSWRTA----VSDIYRQRGIHGFFKGFLPSFLRSFPXX 287
            ++++  +       D      K+ R      +   Y+  G+ GF+ GF  +  R+ P  
Sbjct: 298 HEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPAS 357

Query: 288 XXXXXXFEF 296
                 FE+
Sbjct: 358 AITLVSFEY 366

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 76/175 (43%), Gaps = 21/175 (12%)

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQ--YDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
           +SG MAG+       P+++AK +LQ Q  +   +  Y G +  +  + +          G
Sbjct: 80  LSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRD--------EG 131

Query: 174 VRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTS 232
            R LYKGL+  ++ +   ++ ++  YE   + + +      P+ +F +   SA      S
Sbjct: 132 ARGLYKGLVPIIMGYFPTWMIYFSVYERSKKLYPR----IFPSFDFISHSASALTAGTVS 187

Query: 233 AYPSD---VVKQVVLCN---DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL 281
              ++   VVK  ++     +K    + S   A   +Y   G+  F+ G LPS L
Sbjct: 188 TILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLL 242

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQ-----TSQVGSGAGIQFKGPLDCVYKTLKNQGIRG 68
           +A   S +  +T+ +P + ++ R+Q     T  + +       G +  +  T K++G+RG
Sbjct: 282 IASSASKMVASTLTYPHEILRTRMQLKAYPTDPLAALQKTSRHGLIRLIKHTYKSEGLRG 341

Query: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHK 100
            Y GFT  L   +   +  L S   +R  L K
Sbjct: 342 FYSGFTANLARTLPASAITLVSFEYFRKYLTK 373

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 80.5 bits (197), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/293 (27%), Positives = 133/293 (45%), Gaps = 36/293 (12%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G    TV +P D +K R+Q  +    +  Q+K  +DC+ K +  +GI
Sbjct: 528 FDSLYNFSLGSIAGCIGATVVYPIDFIKTRMQAQR----SLAQYKNSIDCLLKIISREGI 583

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           +GLY G  P L G +  + A+  +++++   +   +  ++ KL L   IISG  AG    
Sbjct: 584 KGLYSGLGPQLIG-VAPEKAIKLTVNDF---MRNRLTDKNGKLSLFPEIISGASAGACQV 639

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               P+E+ K +LQVQ D     Y G  + +Q+  +        L G+R LY G+ + L+
Sbjct: 640 IFTNPLEIVKIRLQVQSD-----YVG--ENIQQANETATQIVKKL-GLRGLYNGVAACLM 691

Query: 187 FRSNF-VFWWGSYELITQ---WFQKNTNLSAPAINFW----AGGLSA-SFGFWTSAYPSD 237
               F   ++ +Y  + +    F  N       +  W    AG ++     F T+  P D
Sbjct: 692 RDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTT--PFD 749

Query: 238 VVKQVVLCN-----DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           V+K  +  +      KY+G F + RT    I ++     FFKG     LRS P
Sbjct: 750 VIKTRLQIDPRKGETKYNGIFHAIRT----ILKEESFRSFFKGGGARVLRSSP 798

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 79.7 bits (195), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 130/294 (44%), Gaps = 39/294 (13%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G    TV +P D VK R+Q  +  S    Q+K  +DC  K    +GI
Sbjct: 516 FDSIYNFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFS----QYKNSIDCFAKIFSREGI 571

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RG+Y G  P L G +  + A+  ++++Y   +   +  +H  L     I+SG  AG    
Sbjct: 572 RGIYSGLGPQLIG-VAPEKAIKLTVNDY---MRGRLMDKHANLKWYFEILSGACAGACQV 627

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILG--GVRSLYKGLIST 184
               P+E+ K +LQV+     ++Y G       V K  +   G++   G++ LYKG+ + 
Sbjct: 628 VFTNPLEVVKIRLQVR-----SEYAGD------VLKSQVTALGVIKQLGIKGLYKGIAAC 676

Query: 185 LIFRSNF-VFWWGSYELITQ---WFQKNTNLSAPAINFW----AGGLSASFGFWTSAYPS 236
           L+    F   ++ +Y  + +    +          +  W    AGGL+     + +  P 
Sbjct: 677 LMRDVPFSAIYFPTYAHLKKDVFKYDPKDKKQRNKLKTWELLVAGGLAGMPAAYLTT-PF 735

Query: 237 DVVKQVVLCN-----DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           DV+K  +  +      +Y+G F + RT    I ++     FFKG     LRS P
Sbjct: 736 DVIKTRLQIDPRKGETRYEGIFHAART----ILKEESFKSFFKGGSARVLRSSP 785

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 126/289 (43%), Gaps = 29/289 (10%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G     V +P D VK R+Q  +  S    ++K  +DC+ K L  +G+
Sbjct: 522 FDSIYNFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFS----KYKNSIDCLLKILSKEGV 577

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RGLY G  P L G +  + A+  +++++   +   +     KL L   IISG  AG    
Sbjct: 578 RGLYSGLGPQLIG-VAPEKAIKLTVNDH---MRATLAGRDGKLSLPCEIISGATAGACQV 633

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               P+E+ K +LQV+ D         ++ +  +        G++G  R     L+  + 
Sbjct: 634 VFTNPLEIVKIRLQVKSDYVADAARNSVNAISVI-----KNLGLIGLYRGAGACLLRDIP 688

Query: 187 FRSNFVFWWGSYELITQWFQKNTNLSAPAINFW----AGGLSA-SFGFWTSAYPSDVVKQ 241
           F + +   +   +     F    +     +N W    +GGL+     F T+  P DV+K 
Sbjct: 689 FSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLAGMPAAFLTT--PFDVIKT 746

Query: 242 VVLCNDK-----YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
            +  + K     Y+G + + RT    I ++ GI  FFKG     LRS P
Sbjct: 747 RLQIDPKKGESVYNGIWDAART----ILKEEGIKSFFKGGPARVLRSSP 791

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 74.7 bits (182), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 126/297 (42%), Gaps = 28/297 (9%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTS--QVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
           ++G  SG     +  PFD  K RLQ    Q  +     +KG         K++G  GLY 
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 72  GFTPPLFGWI--MMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           G  P + G+I  +M   +  S++++       ++P     P      S + AG   +   
Sbjct: 103 GLQPTVLGYIPTLM---IYFSVYDFCRKYSVDIFPHS---PFLSNASSAITAGAISTVAT 156

Query: 130 APVELAKAKLQVQ--YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIF 187
            P+ + K +L +Q      +T Y G ID  +K+ +Q         G ++LY GL+  L+ 
Sbjct: 157 NPIWVVKTRLMLQTGIGKYSTHYKGTIDTFRKIIQQE--------GAKALYAGLVPALLG 208

Query: 188 RSNFVFWWGSYELITQWF--QKNTNLSAPAI--NFWAGGLSASFGFW---TSAYPSDVVK 240
             N    +  YE +   F   ++T++S      NF    L++        T  YP ++++
Sbjct: 209 MLNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKMVASTVTYPHEILR 268

Query: 241 -QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEF 296
            ++ L +D  +   +     +   YRQ G  GF+ GF  + +R+ P        FE+
Sbjct: 269 TRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATNLVRTVPAAVVTLVSFEY 325

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 25/173 (14%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKTLKNQGIRGLY 70
              AG  S VA N    P   VK RL   Q G G     +KG +D   K ++ +G + LY
Sbjct: 145 AITAGAISTVATN----PIWVVKTRLML-QTGIGKYSTHYKGTIDTFRKIIQQEGAKALY 199

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP-------LSGCIISGVMAGW 123
            G  P L G  M++ A+   L  Y  L  ++ Y E   +            I++ +++  
Sbjct: 200 AGLVPALLG--MLNVAIQFPL--YENLKIRFGYSESTDVSTDVTSSNFQKLILASMLSKM 255

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQ--------GMATN 168
             S +  P E+ + ++Q++ D   T     + +++  ++Q        G ATN
Sbjct: 256 VASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYSGFATN 308

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 135/311 (43%), Gaps = 40/311 (12%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP-----LDC 56
           +S    + + G  AG  SGVA      P D  K RLQ      G   +F+ P     +  
Sbjct: 74  LSSTQITALSGAFAGFLSGVAVC----PLDVAKTRLQ----AQGLQTRFENPYYRGIMGT 125

Query: 57  VYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
           +   ++++G RGLY G  P + G+      +  S++ +       ++P+ D +  S    
Sbjct: 126 LSTIVRDEGPRGLYKGLVPIVLGY-FPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS---C 181

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYD--AKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
           + + AG   + +  P+ + K +L +Q +     T Y G  D  +K+F Q         G 
Sbjct: 182 AAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQE--------GF 233

Query: 175 RSLYKGLISTLIFRSNFVFWWGSYELITQWF-----QKNTNLSAPAINFWAGGLSASFGF 229
           ++LY GL+ +L+   +    +  YE +   F     + NTN    +IN     +++S   
Sbjct: 234 KALYAGLVPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTN----SINLQRLIMASSVSK 289

Query: 230 WTSA---YPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
             ++   YP ++++ ++ L +D  D   +     +   Y Q G+ GF+ GF  + +R+ P
Sbjct: 290 MIASAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIP 349

Query: 286 XXXXXXXXFEF 296
                   FE+
Sbjct: 350 ASAITLVSFEY 360

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/327 (25%), Positives = 131/327 (40%), Gaps = 55/327 (16%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQT------------------SQVGSGAGIQFKGPL 54
           FVAG   G+A   V  PFD VK RLQ+                  + V +     FK   
Sbjct: 56  FVAGGIGGMAGAVVTCPFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETF 115

Query: 55  DCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC 114
             +    +N+G R L+ G  P L G I   S    +    + +  K +    + + +   
Sbjct: 116 GIISNVYRNEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVWIH-- 173

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
           +++   AGW  S    P+ L K +LQ+     T KY    D ++ V ++     GILG  
Sbjct: 174 LMAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQK----EGILG-- 227

Query: 175 RSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNT-----NLS------APAINFW---- 219
             LYKGL ++ +     +  W  YE +    ++ +     N+S      +  I  W    
Sbjct: 228 --LYKGLSASYLGSVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRS 285

Query: 220 -AGGLSASFGFWTSAYPSDVV----KQVVLCND--KYDGSFKSWRTAVSDIYRQRGIHGF 272
            + GL A F      YP +VV    +Q  L N   KY G  +S R     I ++ G+   
Sbjct: 286 GSAGL-AKFVASIITYPHEVVRTRLRQAPLENGKLKYTGLVQSIRV----IIKEEGLASM 340

Query: 273 FKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           + G  P  LR+ P        +E V+R
Sbjct: 341 YGGLTPHLLRTVPNSIIMFGTWELVIR 367

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 68.9 bits (167), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 122/305 (40%), Gaps = 27/305 (8%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQ-TSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           S+   FVAG  +     TV +PFD VK R+Q   ++ + A   +  P+       KN+GI
Sbjct: 19  SKFGSFVAGGLAACIAVTVTNPFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGI 78

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP--EHDKLPLSGC-IISGVMAGW 123
            GL  G        I ++ + LG     R +L+   YP  E  K+   G  + +G  +G 
Sbjct: 79  AGLQKGLASAYLYQIALNGSRLGFYEPIRGILNNVFYPNVESHKVQHIGINVAAGATSGV 138

Query: 124 TVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
             +FI +P+ L K ++Q   +A    + T YT   + +  +F+          G++ L++
Sbjct: 139 VGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLATIFRS--------EGIKGLFR 190

Query: 180 GLISTLIFRSNF--VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSD 237
           G +   + R+          Y +   +  K+  ++            A FG   +  P D
Sbjct: 191 G-VDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTGLHLLSSTIAGFGVGVAMNPWD 249

Query: 238 VVKQVVLCNDK---YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXF 294
           VV   V  N K   Y G    +   V    R  G+   +KGF    LR  P         
Sbjct: 250 VVLTRVY-NQKGNLYSGPIDCFIKTV----RNEGLSALYKGFGAQILRIGPHTVLCLTFM 304

Query: 295 EFVLR 299
           E  L+
Sbjct: 305 EQTLK 309

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 69.3 bits (168), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 133/312 (42%), Gaps = 30/312 (9%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           M S+++ +  +  VAG  +G+ +    HP DT+KVR+Q  +  +  G +  G L      
Sbjct: 49  MSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRAN-EGTKPPGFLRTGANI 107

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
              +G+   Y G    + G I   +    S   YR LL      +   +      ++GV 
Sbjct: 108 YSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADR---QTGVVSTGNTFLAGVG 164

Query: 121 AGWTVS-FIAAPVELAKAKLQVQY---DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
           AG T +  +  P+E+ K +LQ Q+    A+  KY   I     + K+         G+ +
Sbjct: 165 AGVTEAVLVVNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKE--------EGIGA 216

Query: 177 LYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT 231
           LY+G+  T   +     +NF  +    E + Q +  + NL +   +   G +S + G ++
Sbjct: 217 LYRGVSLTAARQATNQGANFTVYSKLMERL-QEYHGSQNLPSWETSLI-GLVSGAIGPFS 274

Query: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQ----RGIHGFFKGFLPSFLRSFPXX 287
           +A P D +K   L  DK   +  +W   ++ I RQ     G    +KG  P  +R  P  
Sbjct: 275 NA-PLDTIK-TRLQKDKSTRNLSNW-VRITTIGRQLVQEEGFRALYKGITPRVMRVAPGQ 331

Query: 288 XXXXXXFEFVLR 299
                 +EFV R
Sbjct: 332 AVTFTVYEFVRR 343

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 68.6 bits (166), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 125/304 (41%), Gaps = 36/304 (11%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           +  +AG  +G+ +    HP DT+KVR+Q  +  +  GI+  G +         +G+  LY
Sbjct: 12  VNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPPGFIKTGRNIYTEEGLLALY 71

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS-FIA 129
            G    + G I   +    S   YR  L      +   +      ++GV AG T +  + 
Sbjct: 72  KGLGAVVIGIIPKMAIRFSSYEFYRSALAD---KQTGSVSTGNTFLAGVGAGTTEAVLVV 128

Query: 130 APVELAKAKLQVQY----DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTL 185
            P+E+ K +LQ Q+     A + +Y   +     + K+         G+ +LY+G+  T 
Sbjct: 129 NPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKE--------EGIGALYRGVSLTA 180

Query: 186 IFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTSAYPS 236
             +     +NF  +    E + +  + +      A+  W     G +S + G +++A P 
Sbjct: 181 ARQATNQGANFTVYSKLKEFLQEHHKTD------ALPSWETSCIGLISGAIGPFSNA-PL 233

Query: 237 DVVKQVVLCNDKYDGSFKSWRTAVS---DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXX 293
           D +K   L  DK   +   W   V+    + ++ G    +KG  P  +R  P        
Sbjct: 234 DTIK-TRLQKDKSTANMSGWSRIVTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTV 292

Query: 294 FEFV 297
           +EFV
Sbjct: 293 YEFV 296

>Kwal_27.12081
          Length = 369

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 121/311 (38%), Gaps = 58/311 (18%)

Query: 29  PFDTVKVRLQT---------------SQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           PFD VK RLQ+               S V S     F+     +    K +G R L+ G 
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVE 133
            P L G I   S    +    + +  +  +   ++ P    +IS   AGW  S    P+ 
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSR-AFNNGEEAPWIH-LISAATAGWATSTATNPIW 189

Query: 134 LAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVF 193
           L K +LQ+     T +Y    D ++ + ++     G  G    LYKGL ++ +     + 
Sbjct: 190 LIKTRLQLDKAGHTRQYKNSWDCLKHIIQK----EGFFG----LYKGLSASYLGSVEGIL 241

Query: 194 WWGSYELITQWF--------------QKNTNLSAPAINFW-----AGGLSASFGFWTSAY 234
            W  YE + Q                +KNT   +  I  W     + GL A F      Y
Sbjct: 242 QWLLYEQMKQMIKMRSIEKFGHISEGEKNT---SEKIKEWCQRSGSAGL-AKFLASIVTY 297

Query: 235 PSDVV----KQVVLCND--KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXX 288
           P +VV    +Q  L ND  KY G  +S+R     I ++ G+   + G  P  LR+ P   
Sbjct: 298 PHEVVRTRLRQAPLENDKLKYTGLIQSFRV----IIKEEGLASMYGGLTPHLLRTVPNSI 353

Query: 289 XXXXXFEFVLR 299
                +E V++
Sbjct: 354 IMFGTWELVIK 364

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/296 (25%), Positives = 122/296 (41%), Gaps = 26/296 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F+AG  +G  + +V +PF+  K RLQ     S A    + PL  +Y T K QGI  +Y+G
Sbjct: 13  FIAGCLAGAVEASVTYPFEFAKTRLQLLDKASKAS---RNPLVLIYNTAKTQGIGSVYVG 69

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA-AP 131
               + G               + LL     P+  +L     +I+G+ AG   S +A  P
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDTIKNLLRD---PKTGELSGPRGVIAGLGAGLLESVVAVTP 126

Query: 132 VELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR-SN 190
            E  K  L     + T KY      + + +   +   G+ G    LY+G++   + + +N
Sbjct: 127 FEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSG----LYRGVLPVSMRQAAN 182

Query: 191 FVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT------SAYPSDVVKQVV- 243
                G Y  I    Q  TN  AP     + GL+   G ++      +  P D VK  + 
Sbjct: 183 QAVRLGCYNKIKVMVQDYTN--APKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQ 240

Query: 244 -LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVL 298
            L + +Y  +   + T    I+++ G+  F+KG  P   R F         +E VL
Sbjct: 241 SLDSKRYSSTINCFTT----IFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVL 292

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
           ++  S  + FV G FSG+       P DTVK R+Q+         ++   ++C     K 
Sbjct: 206 DKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKTRMQSLD-----SKRYSSTINCFTTIFKE 260

Query: 64  QGIRGLYLGFTPPL 77
           +G++  + G TP L
Sbjct: 261 EGLKAFWKGATPRL 274

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 75/182 (41%), Gaps = 24/182 (13%)

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           S   I+G +AG   + +  P E AK +LQ+  D  +     P+ ++    K         
Sbjct: 10  SKSFIAGCLAGAVEASVTYPFEFAKTRLQL-LDKASKASRNPLVLIYNTAKT-------- 60

Query: 172 GGVRSLYKGLISTLIFRSNF--VFWWGSYELITQWFQ--KNTNLSAP--AINFWAGGLSA 225
            G+ S+Y G  + ++  +    V + G ++ I    +  K   LS P   I     GL  
Sbjct: 61  QGIGSVYVGCPAFIVGNTAKAGVRFLG-FDTIKNLLRDPKTGELSGPRGVIAGLGAGLLE 119

Query: 226 SFGFWTSAYPSDVVKQVVL-----CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
           S     +  P + +K  ++        KY  + K      + + R++G+ G ++G LP  
Sbjct: 120 SV---VAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVS 176

Query: 281 LR 282
           +R
Sbjct: 177 MR 178

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 125/316 (39%), Gaps = 49/316 (15%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT 60
           ++ +   + V G +AG  SG+    +  P D  K RLQ    GSG    ++G +  +   
Sbjct: 80  LLDDTQVTAVSGALAGFVSGI----MVCPLDVAKTRLQAQGAGSGER-YYRGIVGTLSAI 134

Query: 61  LKNQGIRGLYLGFTPPLFG----WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
           L+++G+ GLY G  P + G    W++  S              K  YP +          
Sbjct: 135 LRDEGVAGLYKGLAPIVLGYFPTWMLYFSVYEKC---------KQRYPSYLPGGFVSHAA 185

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYDA--KTTKYTGPIDVVQKVFKQGMATNGILGGV 174
           S + AG   + +  P+ + K +L +Q D    +T Y   +D  +K+++          G+
Sbjct: 186 SALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTLDAFRKMYRS--------EGL 237

Query: 175 RSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAIN--------------FWA 220
           +  Y GL+ +L    +    +  YE +  W  +NT    PA +                A
Sbjct: 238 KVFYSGLVPSLFGLFHVAIHFPVYEKLKIWLHRNT----PAADGQRLDHNKLQLDRLIVA 293

Query: 221 GGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
             LS       + YP ++++  +    ++ G   S    +  I    G  GF+ GF  + 
Sbjct: 294 SCLSKVVASVIT-YPHEILRTRM--QVRHSGVPPSLLNLLGRIRASEGYVGFYSGFATNL 350

Query: 281 LRSFPXXXXXXXXFEF 296
           +R+ P        FE+
Sbjct: 351 VRTVPASVITLVSFEY 366

>Scas_721.27
          Length = 374

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 129/330 (39%), Gaps = 57/330 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQT-------------------SQVGSG---AGIQF 50
           FVAG   G+A   V  PFD VK RLQ+                   S++ +    AG  F
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHF 115

Query: 51  KGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP 110
           K     +    K +G R L+ G  P L G I   S    +    + +  K  +    + P
Sbjct: 116 KETFGILGNVYKREGFRSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSK-AFNNGQETP 174

Query: 111 LSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGI 170
           L   ++S   AGW  S    P+ + K ++Q+     T KY    D ++ V K    + GI
Sbjct: 175 LIH-LMSAATAGWATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLK----SEGI 229

Query: 171 LGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKN-----------TNLSAPAINFW 219
            G    LY+GL ++ +     +  W  YE +    ++            T      I  W
Sbjct: 230 YG----LYRGLSASYLGSIEGILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEW 285

Query: 220 A--GGLSASFGFWTS--AYPSDVV----KQVVLCN--DKYDGSFKSWRTAVSDIYRQRGI 269
               G +    F  S   YP +VV    +Q+ + N   KY G  +S+R     I ++ G+
Sbjct: 286 CQRSGSAGVAKFIASIVTYPHEVVRTRLRQMPMENGKPKYTGLVQSFRV----IIKEEGL 341

Query: 270 HGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
              + G  P  +R+ P        +E V+R
Sbjct: 342 ASMYSGLTPHLMRTVPNSIIMFGTWELVIR 371

>Scas_602.8
          Length = 885

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 130/295 (44%), Gaps = 40/295 (13%)

Query: 7   YSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI 66
           +  +  F  G  +G    T+ +P D +K R+Q  +    +  ++K  +DC+ K    +GI
Sbjct: 496 FDSIFNFSLGSVAGCIGATLVYPIDFIKTRMQAQR----SLTKYKNSIDCLVKIFGKEGI 551

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
           RGLY G  P L G +  + A+  +++++   + K +  +   L L   ++SG  AG    
Sbjct: 552 RGLYSGLGPQLIG-VAPEKAIKLTVNDF---MRKSLVDKKGNLQLGAEVLSGATAGACQV 607

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR--SLYKGLIST 184
               P+E+ K +LQV+     ++YT  +     + K  +    I+  ++   LYKG+ + 
Sbjct: 608 VFTNPLEIVKIRLQVK-----SEYTNAM-----IPKSQLTAFQIIKELKLIGLYKGVGAC 657

Query: 185 LIFRSNF-VFWWGSYELITQ---WFQKNTNLSAPAINFW----AGGLS-ASFGFWTSAYP 235
           L+    F   ++ +Y  + +    F  N       +  W    AG L+     F T+  P
Sbjct: 658 LLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTT--P 715

Query: 236 SDVVKQVV-----LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
            DV+K  +     +   +Y G   + RT    I ++     FFKG     +RS P
Sbjct: 716 FDVIKTRLQIEPGVGETRYTGILHAVRT----ILKEESFRSFFKGGAARVMRSSP 766

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 87/197 (44%), Gaps = 14/197 (7%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           ++G  +G  +    +P + VK+RLQ     + A I  K  L   ++ +K   + GLY G 
Sbjct: 597 LSGATAGACQVVFTNPLEIVKIRLQVKSEYTNAMIP-KSQL-TAFQIIKELKLIGLYKGV 654

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK---LPLSGCIISGVMAGWTVSFIAA 130
              L   +   +    +  + +  + ++   + DK   L     + +G +AG   +F+  
Sbjct: 655 GACLLRDVPFSAIYFPTYAHLKKNVFQFDPNDKDKRDRLKTWELLTAGALAGVPAAFLTT 714

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS- 189
           P ++ K +LQ++     T+YTG +  V+ + K+           RS +KG  + ++  S 
Sbjct: 715 PFDVIKTRLQIEPGVGETRYTGILHAVRTILKE--------ESFRSFFKGGAARVMRSSP 766

Query: 190 NFVFWWGSYELITQWFQ 206
            F F   +YEL    F 
Sbjct: 767 QFGFTLAAYELFKNMFN 783

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 122/294 (41%), Gaps = 23/294 (7%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTL 61
           + +  S+   FVAG  +     TV +P + +K+R+Q   ++ + A   +K P+  +    
Sbjct: 16  AAQKISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIF 75

Query: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118
           KN+GI+GL  G        I ++ + LG     R  L++  +P+ +   +      + SG
Sbjct: 76  KNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSG 135

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYD----AKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             +G   + I +P+ L K +LQ   +     + T YTG  + +  +FK          GV
Sbjct: 136 AASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKT--------EGV 187

Query: 175 RSLYKGLISTLIFRSNF--VFWWGSYELITQWFQKNTNL-SAPAINFWAGGLSASFGFWT 231
           + L++G I   I R+          Y        KN  +   PA++  A  +S   G   
Sbjct: 188 KGLFRG-IDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISG-LGVAV 245

Query: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              P DV+   +  N K D  +K     +    R  G+   +KGF     R  P
Sbjct: 246 VMNPWDVILTRIY-NQKGD-LYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAP 297

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 126/291 (43%), Gaps = 49/291 (16%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
           G  AG+F+    NT  HP D  KVRLQ + +     +Q       +   LKN+GI GLY 
Sbjct: 13  GGAAGIFA--VMNT--HPLDLTKVRLQAAPIPKPTIVQM------LRSILKNEGIVGLYA 62

Query: 72  GFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP-----LSGCIISGVMAGWTVS 126
           G +  L       +A  G        L ++V P  DKL      L   ++SG + G   +
Sbjct: 63  GLSASLLRQCTYTTARFGMYD----ALKEHVIPR-DKLTNMWYLLGASMVSGALGGLAGN 117

Query: 127 FIAAPVELAKAKLQ----VQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR-SLYKGL 181
           F     +L   ++Q    +  D K   Y   ID + K++K   A +  L G + ++ +G+
Sbjct: 118 F----ADLINIRMQNDSALPLD-KRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGV 172

Query: 182 ISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAIN--FWAGGLSASFGFWTSAYPSDVV 239
           + T    S  V    +Y++   +     N+  P  N       L A F   T   P+DV+
Sbjct: 173 LMT---ASQVV----TYDMFKNFLVTKYNMD-PKKNSTHLTSSLLAGFVATTVCSPADVI 224

Query: 240 KQVVLCNDK-----YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           K +V+   K     +D SFK    A++    + G    F+G++PSF R  P
Sbjct: 225 KTIVMNAHKKPGHNHDSSFKILMEAIN----KEGPSFMFRGWVPSFTRLAP 271

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 12/190 (6%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQ-FKGPLDCVYKTL 61
           + +  S+V  F+AG  +     TV +PF+ VK R+Q     S    + ++ P   +    
Sbjct: 17  AAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALGVIF 76

Query: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118
           KN+G++GL  G        I ++ + LG     R +L+K  +PE D   L      + +G
Sbjct: 77  KNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDPHKLQNVAVNVTAG 136

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             +G   + + +P+ L K ++Q   +A    + T YT   + +  +FK+     G+LG  
Sbjct: 137 ATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKK----EGVLGLF 192

Query: 175 RSLYKGLIST 184
           R +   ++ T
Sbjct: 193 RGVDAAILRT 202

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 36/203 (17%)

Query: 105 EHDK-----LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTK---YTGPIDV 156
           EH+K     +   G  I+G +A      +  P EL K ++Q+Q +   T    Y  P   
Sbjct: 12  EHEKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQA 71

Query: 157 VQKVFKQGMATNGILGGVRSLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTN- 210
           +  +FK          GV+ L +GL+S  +++     S   F+     ++ + F   ++ 
Sbjct: 72  LGVIFKN--------EGVKGLQRGLVSAYVYQIGLNGSRLGFYEPIRTVLNKTFFPESDP 123

Query: 211 --LSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK--------SWRTAV 260
             L   A+N  AG  S   G    + P  +VK  +     Y  + K        S    +
Sbjct: 124 HKLQNVAVNVTAGATSGIIGAIVGS-PLFLVKTRM---QSYSNAIKIGEQTHYTSMSNGL 179

Query: 261 SDIYRQRGIHGFFKGFLPSFLRS 283
           + I+++ G+ G F+G   + LR+
Sbjct: 180 ATIFKKEGVLGLFRGVDAAILRT 202

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            ++   +G+    V +P+D V  R+   +     G  +KGP+DC++KT+K +GI  LY G
Sbjct: 234 LLSSTVTGLGVGIVMNPWDVVLTRVYNQK-----GNTYKGPIDCMFKTIKIEGIGALYKG 288

Query: 73  FTPPLF 78
           F   LF
Sbjct: 289 FGAQLF 294

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 69/169 (40%), Gaps = 18/169 (10%)

Query: 15  AGMFSGVAKNTVGHPFDTVKVRLQT--SQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           AG  SG+    VG P   VK R+Q+  + +  G    +    + +    K +G+ GL+ G
Sbjct: 135 AGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRG 194

Query: 73  FTPPLFGWIMMDSALLGSLHNYR-MLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAP 131
               +       S  L   +  +  LL   +  E   L L    +S  + G  V  +  P
Sbjct: 195 VDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMKEGTALHL----LSSTVTGLGVGIVMNP 250

Query: 132 VELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
            ++   ++   Y+ K   Y GPID + K  K        + G+ +LYKG
Sbjct: 251 WDVVLTRV---YNQKGNTYKGPIDCMFKTIK--------IEGIGALYKG 288

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 63.5 bits (153), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 122/295 (41%), Gaps = 29/295 (9%)

Query: 1   MVSEETYSRV---MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCV 57
           M S+ T S V     F+AG  +G A+  + +PF+  K RLQ     S A    + PL  +
Sbjct: 1   MSSKATKSDVDPLHSFLAGSLAGAAEACITYPFEFAKTRLQLIDKASKAS---RNPLVLI 57

Query: 58  YKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIIS 117
           YKT K QGI  +Y+G    + G               + +L      E  +L  +  +I+
Sbjct: 58  YKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRD---SETGELSGTRGVIA 114

Query: 118 GVMAGWTVSFIA-APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
           G+ AG   S  A  P E  K  L     + T KY      V + +   +   G  G    
Sbjct: 115 GLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSG---- 170

Query: 177 LYKGLISTLIFR-SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT---- 231
           LY+G++   + + +N     G Y  I    Q  T+  +P     + GL+   G ++    
Sbjct: 171 LYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTD--SPKDKPLSSGLTFLVGAFSGIVT 228

Query: 232 --SAYPSDVVKQVV--LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
             S  P D VK  +  L + KY  +   + T    I+++ G+  F+KG  P   R
Sbjct: 229 VYSTMPLDTVKTRMQSLDSTKYSSTMNCFAT----IFKEEGLKTFWKGATPRLGR 279

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 63.5 bits (153), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 128/327 (39%), Gaps = 65/327 (19%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQ----------TSQVGSGA----GIQFKGPLDCV 57
           G +AG  +GV    +  P D  K RLQ          T  VGS A    G  + G    +
Sbjct: 110 GALAGFLAGV----IVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTL 165

Query: 58  YKTLKNQGIRGLYLGFTPPLFG----WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG 113
              ++++ IRGLY G  P + G    W++  S       +Y    +   +  H       
Sbjct: 166 TTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHS------ 219

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKT---TKYTGPIDVVQKVFKQGMATNGI 170
             +S + AG   + +  P+ + K +L +Q        T Y   +D   K++K        
Sbjct: 220 --MSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYK-------- 269

Query: 171 LGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWF---------QKNTNL---SAP---- 214
           + G++S Y GLI +L    +    +  YE + +           Q+  N+   S P    
Sbjct: 270 VEGIKSFYSGLIPSLFGLLHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTTG 329

Query: 215 AINFWAGGL-SASFG----FWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGI 269
           + NF  G L  AS G      T  YP ++++  +        S KS    +   Y + GI
Sbjct: 330 STNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKS---IIRTTYAKEGI 386

Query: 270 HGFFKGFLPSFLRSFPXXXXXXXXFEF 296
            GF+ GFL +  R+ P        FE+
Sbjct: 387 RGFYSGFLTNMFRTVPASAITLVSFEY 413

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 8/84 (9%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL-KNQGIRGLYL 71
            VA   S +  +T+ +P + ++ RLQ            K  +  + +T    +GIRG Y 
Sbjct: 339 IVASCGSKMIASTLTYPHEILRTRLQLKS-------DMKPSIKSIIRTTYAKEGIRGFYS 391

Query: 72  GFTPPLFGWIMMDSALLGSLHNYR 95
           GF   +F  +   +  L S   +R
Sbjct: 392 GFLTNMFRTVPASAITLVSFEYFR 415

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 124/310 (40%), Gaps = 44/310 (14%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQGIR 67
           +  +AG  +G+ +    HP DT+KVR+Q  +    AGI+   P   +       + +G  
Sbjct: 12  INLMAGGTAGLFEALCCHPLDTIKVRMQIYR--RVAGIEHVKPPGFIKTGRTIYQKEGFL 69

Query: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS- 126
            LY G    + G I   +    S   YR LL   V  E   +      ++GV AG T + 
Sbjct: 70  ALYKGLGAVVIGIIPKMAIRFSSYEFYRTLL---VNKESGIVSTGNTFVAGVGAGITEAV 126

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGP-----IDVVQKVFKQGMATNGILGGVRSLYKGL 181
            +  P+E+ K +LQ Q+   +    GP     I     + K+         GV +LY+G+
Sbjct: 127 LVVNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKE--------EGVSALYRGV 178

Query: 182 ISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWA----GGLSASFGFWTS 232
             T   +     +NF  +    E +  + Q +   S      W     G +S + G +++
Sbjct: 179 SLTAARQATNQGANFTVYSKLKEFLQNYHQMDVLPS------WETSCIGLISGAIGPFSN 232

Query: 233 AYPSDVVKQVVLCNDK-----YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXX 287
           A P D +K   L  DK          K   T  + + ++ G    +KG  P  +R  P  
Sbjct: 233 A-PLDTIK-TRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQ 290

Query: 288 XXXXXXFEFV 297
                 +E+V
Sbjct: 291 AVTFTVYEYV 300

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 62.8 bits (151), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 131/328 (39%), Gaps = 57/328 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQT----SQVGSGAG---------------IQFKGP 53
           FVAG   G+A   V  PFD VK RLQ+    +Q  S A                + FK  
Sbjct: 54  FVAGGIGGMAGAIVTCPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKET 113

Query: 54  LDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG 113
              +    + +G R L+ G  P L G I   S    +    + +  + +    +   +  
Sbjct: 114 FGIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIH- 172

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
            +++   AGW  S +  P+ L K +LQ+   A T  Y   +D ++ V K      G+LG 
Sbjct: 173 -LLAAATAGWATSTVTNPIWLVKTRLQLD-KAGTKTYKNSLDCIKSVVKN----EGVLG- 225

Query: 174 VRSLYKGLISTLIFRSNFVFWWGSYELITQWFQ-----------KNTNLSAPAINFW--- 219
              LYKGL ++ +     +  W  YE + +  +           ++   ++  +  W   
Sbjct: 226 ---LYKGLSASYLGSVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQR 282

Query: 220 --AGGLSASFGFWTSAYPSDVV----KQVVLCND--KYDGSFKSWRTAVSDIYRQRGIHG 271
             + GL A F      YP +VV    +Q    N   KY G  +S+R     I ++ G+  
Sbjct: 283 SGSAGL-AKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFRV----IIKEEGLVS 337

Query: 272 FFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
            + G  P  LR+ P        +E V++
Sbjct: 338 MYSGLTPHLLRTVPNSIIMFGTWELVIK 365

 Score = 60.8 bits (146), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 101/226 (44%), Gaps = 39/226 (17%)

Query: 3   SEETYSRVMG---------FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP 53
           +++ YSR +           +A   +G A +TV +P   VK RLQ  + G+     +K  
Sbjct: 154 TKDIYSRTLNNGQEAPWIHLLAAATAGWATSTVTNPIWLVKTRLQLDKAGTKT---YKNS 210

Query: 54  LDCVYKTLKNQGIRGLYLGFTPPLFG-------WIMMDSALLGSLHNYRML-----LHKY 101
           LDC+   +KN+G+ GLY G +    G       WI+ +   +  +   R +     +H+ 
Sbjct: 211 LDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQWILYEQ--MKRIIKERSIEKFGHIHED 268

Query: 102 VYPEHDKLPLSGCIISGV--MAGWTVSFIAAPVELAKAKL-QVQYDAKTTKYTGPIDVVQ 158
                DK+    C  SG   +A +  S +  P E+ + +L Q   +    KYTG +   +
Sbjct: 269 AKSTSDKVK-EWCQRSGSAGLAKFVASIVTYPHEVVRTRLRQAPTENGKLKYTGLVQSFR 327

Query: 159 KVFKQGMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYELITQ 203
            + K+         G+ S+Y GL   L+    N +  +G++EL+ +
Sbjct: 328 VIIKE--------EGLVSMYSGLTPHLLRTVPNSIIMFGTWELVIK 365

>Kwal_26.7653
          Length = 325

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 123/301 (40%), Gaps = 37/301 (12%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTL 61
           + +  S+   F+AG  +     TV +P + VK R+Q   ++ + A   +K P+  +    
Sbjct: 18  AAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALKVIF 77

Query: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118
           KN+GIRGL  G +      I ++ + LG     R +L+K  YP  D   +      ++SG
Sbjct: 78  KNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKVQNVAVNVVSG 137

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             +G   + + +P+ L K ++Q   +A    + T YT   + +  +++          G 
Sbjct: 138 ATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA--------EGF 189

Query: 175 RSLYKGLISTLIFRSNF-------VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASF 227
           + LY+G +   I R+         ++    + L+     K        ++  A  +S  F
Sbjct: 190 KGLYRG-VDAAILRTGAGSSVQLPIYNTAKHFLLKHDLMK----EGTGLHLVASTVSG-F 243

Query: 228 GFWTSAYPSDVVKQVVLCNDK---YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSF 284
           G      P DV+   V  N K   Y G    +   V    R  GI   +KGF     R  
Sbjct: 244 GVGVVMNPWDVILTRVY-NQKGNLYKGPLDCFVKTV----RIEGIGALYKGFEAQIFRIA 298

Query: 285 P 285
           P
Sbjct: 299 P 299

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 77/197 (39%), Gaps = 27/197 (13%)

Query: 104 PEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQ----YDAKTTKYTGPIDVVQK 159
           P   K+  +G  I+G MA      +  P+EL K ++Q+Q     DA+   Y  P+  ++ 
Sbjct: 17  PAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRI-YKNPMQALKV 75

Query: 160 VFKQGMATNGILGGVRSLYKGLISTLIFRSNFV-FWWGSYELITQWFQKN-------TNL 211
           +FK          G+R L KGL    I++        G YE I     K          +
Sbjct: 76  IFKN--------EGIRGLQKGLSCAYIYQIGLNGSRLGFYEPIRSVLNKTFYPAMDPHKV 127

Query: 212 SAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDK-----YDGSFKSWRTAVSDIYRQ 266
              A+N  +G  S   G    + P  ++K  +              + S    +S IYR 
Sbjct: 128 QNVAVNVVSGATSGIIGAIMGS-PLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRA 186

Query: 267 RGIHGFFKGFLPSFLRS 283
            G  G ++G   + LR+
Sbjct: 187 EGFKGLYRGVDAAILRT 203

>Scas_667.4
          Length = 308

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 124/295 (42%), Gaps = 52/295 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQ--VGSGA-GIQFKGPLDCVYKTLKNQGIRGL 69
           F+ G  S     T   P + VK+ +Q     +  G+   ++KG ++C  +T K +GI   
Sbjct: 17  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDSKYKGIIECFQRTAKTEGIIAF 76

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           + G T  +  +     AL  +  +    +  +   E      +G + SG  AG       
Sbjct: 77  WRGNTANVIRYFPTQ-ALNFAFKDKIKAMFGFKKEEGYGKWFAGNLASGGAAGGLSLLFV 135

Query: 130 APVELAKAKLQVQYDAKTTK------YTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
             ++ A+ +L    DAK++K      Y G IDV    +KQ +AT+G+ G  R     ++ 
Sbjct: 136 YSLDYARTRLAA--DAKSSKKGGSRQYKGLIDV----YKQTLATDGMAGLYRGFLPSVVG 189

Query: 184 TLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASF------------GFWT 231
            +++R     ++G Y+ +            PA+    G L  SF            G  T
Sbjct: 190 IIVYRG---LYFGLYDSLK-----------PAV--LTGSLEGSFLASFLLGWIVTTGAST 233

Query: 232 SAYPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           ++YP D V++ ++       KYDG+F  +R  V+      G+   FKG   + LR
Sbjct: 234 ASYPLDTVRRRMMMTSGQAVKYDGAFDCFRKVVA----AEGVSSLFKGCGANILR 284

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 112/281 (39%), Gaps = 37/281 (13%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTP 75
           G F G+      HP D  KVRLQT+       ++         + L+N+G+ GLY G T 
Sbjct: 15  GGFGGIVACVATHPLDLAKVRLQTAPAPKPTLVRMAS------QILRNEGVPGLYSGLTA 68

Query: 76  PLFGWIMMDSALLGSLHNYRMLLHKYVYPEH--DKLPLSGC-IISGVMAGWTVSFIAAPV 132
            +       +A  G    Y  +  +Y+  E+    L L  C + SG + G     I  P 
Sbjct: 69  AILRQCTYTTARFGV---YDFVKERYIPKEYLNSMLYLLPCSMFSGAVGG----LIGNPA 121

Query: 133 ELAKAKLQVQYDAKTT---KYTGPIDVVQKVFKQGMATNGILGGVRSLYKG----LISTL 185
           ++   ++Q            Y    D + K+            GV  L+ G    L+  +
Sbjct: 122 DVVNIRMQNDSSLPAELRRNYKNAADGLYKICSG--------EGVAKLFTGWQPNLVRGI 173

Query: 186 IFRSNFVFWWGSYELITQWFQKNTNLSAP-AINFWAGGLSASFGFWTSAYPSDVVKQVVL 244
           +  S+ V    +Y++   +  +N  L        +A  L A     T   P+DV+K  V+
Sbjct: 174 LMTSSQVV---TYDIAKNYLVQNVGLDKDNKSTHFASSLLAGLVATTVCSPADVIKTRVM 230

Query: 245 CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              K+  S  S    + D  +Q G    F+G+LPSF+R  P
Sbjct: 231 NAHKH--SHDSAVRILLDAVKQEGPSFMFRGWLPSFVRLGP 269

>Scas_691.4
          Length = 334

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 131/324 (40%), Gaps = 44/324 (13%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           +++  S ++  VAG  +G+ +    HP DT+KVR+Q ++     G++  G +        
Sbjct: 7   NDKKSSPLINLVAGGTAGLFEALCCHPLDTIKVRMQIAK--RTEGMRPHGFITTGRNIYS 64

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAG 122
           ++G   LY G    + G I   +    S   YR  L      E   +      ++GV AG
Sbjct: 65  HEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRNALTD---KETRTITTGNTFLAGVGAG 121

Query: 123 WTVS-FIAAPVELAKAKLQVQY---------------DAKTT---KYTGPIDVVQKVFKQ 163
            T +  +  P+E+ K +LQ Q+                A T    KY   I     + K+
Sbjct: 122 ITEAVLVVNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKE 181

Query: 164 GMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYELITQWFQKNTNLSAPAINFWA-- 220
                    G  +LY+G+  T   + +N    +  Y  +  + QK  N    ++  W   
Sbjct: 182 --------EGAGALYRGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRE--SLPSWETS 231

Query: 221 --GGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAV---SDIYRQRGIHGFFKG 275
             G +S + G +++A P D +K   L  DK   S  +W+      + + ++ G    +KG
Sbjct: 232 CIGLISGAIGPFSNA-PLDTIK-TRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKG 289

Query: 276 FLPSFLRSFPXXXXXXXXFEFVLR 299
             P  +R  P        +EFV +
Sbjct: 290 ITPRVMRVAPGQAVTFTVYEFVRK 313

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 61.2 bits (147), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 120/305 (39%), Gaps = 33/305 (10%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQT-SQVGSGAGIQFKGP-LDCVYKTLK 62
           E    V    AG F+G+ ++++  P D +K R+Q  S  GS A  +     L  + K   
Sbjct: 13  ENAPLVYQLAAGAFAGIMEHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKIST 72

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKL--PLSGCIISGVM 120
            +G   L+ G    + G     +    +   Y M   + + PE  +   PL   + SG +
Sbjct: 73  TEGSLALWKGVQSVVLGAGPAHAVYFAT---YEMCKSRLIDPEDRQTHQPLKTAL-SGTL 128

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           A      +  P +  K +LQ+           P D + K   +     GI     S    
Sbjct: 129 ATVAADALMNPFDTIKQRLQLH----------PSDSMTKCAVRMYQREGIAAFFYSYPTT 178

Query: 181 LISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLS-ASFGFWTSAYPSDV 238
           +   + F + NFV     YE  T+ F  + N + P I+   GG+S A+    T+  P D 
Sbjct: 179 IAMNIPFAALNFVI----YESSTKIFNPSNNYN-PWIHCLCGGISGATCAAITT--PLDC 231

Query: 239 VKQVVLCN--DKYDGSF----KSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXX 292
           VK V+     D           ++R A S I++  G  GFF+G  P  + + P       
Sbjct: 232 VKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWT 291

Query: 293 XFEFV 297
            +EF 
Sbjct: 292 SYEFA 296

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 83/208 (39%), Gaps = 17/208 (8%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
            +T+  +   ++G  + VA + + +PFDT+K RLQ     S           C  +  + 
Sbjct: 114 RQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQLHPSDSMT--------KCAVRMYQR 165

Query: 64  QGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGW 123
           +GI   +  + P      +  +AL   ++       K   P ++  P   C+  G+ +G 
Sbjct: 166 EGIAAFFYSY-PTTIAMNIPFAALNFVIYESST---KIFNPSNNYNPWIHCLCGGI-SGA 220

Query: 124 TVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLI 182
           T + I  P++  K  LQ++  D+  ++     D  +K       T G  G  R L   +I
Sbjct: 221 TCAAITTPLDCVKTVLQIRGADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRII 280

Query: 183 STLIFRSNFVFWWGSYELITQWFQKNTN 210
           S +         W SYE        N+N
Sbjct: 281 SNM---PATAISWTSYEFAKHLLFTNSN 305

>Kwal_26.7967
          Length = 297

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 115/279 (41%), Gaps = 24/279 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F+AG  +G  + ++ +PF+  K RLQ     S A    + PL  +Y+T K QG+  +Y+G
Sbjct: 13  FLAGSLAGAVEASITYPFEFAKTRLQLVDKSSTAS---RNPLTLIYRTAKVQGLGAVYVG 69

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA-AP 131
               + G               + +L     P   +L     I++G+ AG   S +A  P
Sbjct: 70  CPAFIVGNTAKAGVRFLGFDAIKNILRD---PTTGELSGPRGIVAGLGAGLLESVVAVTP 126

Query: 132 VELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR-SN 190
            E  K  L     + + KY      + + +   +   G  G    LY+G++   + + +N
Sbjct: 127 FEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSG----LYRGVLPVSMRQAAN 182

Query: 191 FVFWWGSYELITQWFQKNTNLS-----APAINFWAGGLSASFGFWTSAYPSDVVKQVV-- 243
                G Y  I    Q  TN +     +  + F  G  S     +T+  P D VK  +  
Sbjct: 183 QAVRLGCYNKIKTMIQDYTNSAKDKPLSSGMTFVVGAFSGIVTVYTT-MPIDTVKTRMQS 241

Query: 244 LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           L + KY  +   + T    ++R+ G+  F+KG  P   R
Sbjct: 242 LDSSKYSSTINCFAT----VFREEGLKTFWKGATPRLGR 276

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
           ++  S  M FV G FSG+       P DTVK R+Q+         ++   ++C     + 
Sbjct: 206 DKPLSSGMTFVVGAFSGIVTVYTTMPIDTVKTRMQSLDSS-----KYSSTINCFATVFRE 260

Query: 64  QGIRGLYLGFTPPLFGWIM 82
           +G++  + G TP L   I+
Sbjct: 261 EGLKTFWKGATPRLGRLIL 279

>Scas_489.4
          Length = 297

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 112/279 (40%), Gaps = 24/279 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F+AG  +G  + ++ +PF+  K RLQ     S A    + PL  +Y T K QG   +Y+G
Sbjct: 14  FIAGALAGAIEASITYPFEFAKTRLQLIDKTSTAS---RNPLVLIYNTAKTQGTGAIYVG 70

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC--IISGVMAGWTVSFIA- 129
               + G               + +L   V  E     LSG   +++G+ AG   S +A 
Sbjct: 71  CPAFIVGNTAKAGIRFLGFDTIKNMLRDPVTGE-----LSGPRGVVAGLGAGLLESVVAV 125

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR- 188
            P E  K  L     A   KY      + + +   +   GI+G    LY+G++   + + 
Sbjct: 126 TPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIMG----LYRGVLPVSMRQA 181

Query: 189 SNFVFWWGSYELITQWFQKNTNLS-----APAINFWAGGLSASFGFWTSAYPSDVVKQVV 243
           +N     G Y  I    Q  TN       +  + F  G  S     +T+  P D VK  +
Sbjct: 182 ANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGLTFIVGAFSGVVTVYTT-MPIDTVKTRM 240

Query: 244 LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
              D     + S     + I+++ G+  F+KG  P   R
Sbjct: 241 QSLDAT--KYTSTVNCFAKIFKEEGLKTFWKGATPRLGR 277

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+ G FSGV       P DTVK R+Q+         ++   ++C  K  K +G++  +
Sbjct: 214 LTFIVGAFSGVVTVYTTMPIDTVKTRMQSLD-----ATKYTSTVNCFAKIFKEEGLKTFW 268

Query: 71  LGFTPPLFGWIM 82
            G TP L   I+
Sbjct: 269 KGATPRLGRLIL 280

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 121/294 (41%), Gaps = 23/294 (7%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQ-TSQVGSGAGIQFKGPLDCVYKTL 61
           + +  S+   F AG  +     TV +P + VK+R+Q   ++ +     +  P   +    
Sbjct: 12  AAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVF 71

Query: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---IISG 118
           +N+GIRGL  G        I ++ + LG     R +++K  YP+ +   +      + +G
Sbjct: 72  RNEGIRGLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAG 131

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             +G   + + +P+ L K +LQ   +A    + T YTG  +        G+ T  +  GV
Sbjct: 132 AASGIIGAVMGSPLFLVKTRLQSYSNAIKIGEQTHYTGVWN--------GLKTIYMTEGV 183

Query: 175 RSLYKGLISTLIFRSNF--VFWWGSYELITQWFQKNTNLS-APAINFWAGGLSASFGFWT 231
           + L++G I   I R+          Y     +  +N  +   P+++  A  +S   G   
Sbjct: 184 KGLFRG-IDAAILRTGAGSSVQLPIYNTAKNFLLRNDIMEDGPSLHLTASTISG-LGVAV 241

Query: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              P DV+   +  N K D  +K     +    +  GI   +KGF     R  P
Sbjct: 242 VMNPWDVILTRIY-NQKGD-LYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGP 293

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 80/338 (23%), Positives = 128/338 (37%), Gaps = 68/338 (20%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQ---------------------------TSQV 42
           V+  VAG  +G+ +    HP DT+KVR+Q                               
Sbjct: 12  VVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQAAPAAAAVASMAGGAGGAATATVGGG 71

Query: 43  GSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYV 102
            + A I+  G +         +G   LY G    + G I   +    S   YR LL    
Sbjct: 72  DATAAIKPPGFIRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLAD-- 129

Query: 103 YPEHDKLPLSGCIISGVMAGWTVS-FIAAPVELAKAKLQVQ-----YDAKTTKYTGPIDV 156
             +   +  S   I+GV AG T +  +  P+E+ K +LQ Q     +D    KYT  +  
Sbjct: 130 -KQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQA 188

Query: 157 VQKVFKQGMATNGILGGVRSLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNL 211
              + K+         G+ +LY+G+  T   +     +NF  +    E + ++    T  
Sbjct: 189 GYTIIKE--------EGISALYRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTETLP 240

Query: 212 SAPAINFWA----GGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK---SWRTAV---S 261
           S      W     G +S + G +++A P D +K   L  DK   SFK    W+      +
Sbjct: 241 S------WETSCIGLISGAIGPFSNA-PLDTIK-TRLQKDK-STSFKGESGWKRIAHIGT 291

Query: 262 DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
            + ++ G    +KG  P  +R  P        +EFV R
Sbjct: 292 QLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 68/316 (21%), Positives = 127/316 (40%), Gaps = 47/316 (14%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           ET S     +AG  SGV       P DTVK+R Q   V      ++KG    V   +K +
Sbjct: 14  ETVSWYNSVIAGSVSGVFARMATAPMDTVKIRYQLQPVQED---KYKGIASTVRTIMKEE 70

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124
           G+R L+ G  P    +++  +   GS   +  +     +P   +      +  G +AG T
Sbjct: 71  GLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVWSAK-FPRFSQ--QGQTLTVGALAGMT 127

Query: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGL--- 181
            S ++ P++L + +L      +T+  T   +  ++++        +  GVR  + G+   
Sbjct: 128 SSVVSYPLDLLRTRLIAN---RTSHRTSVAEECRQMW--------LNEGVRGFFTGISTA 176

Query: 182 ISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW------TSAYP 235
           ++T+   +  +F   +YE +      N         FW+  +SAS G        T  +P
Sbjct: 177 MTTVTLSTAIMFL--TYETV------NIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFP 228

Query: 236 SDVV-KQVVLCNDK------------YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
            D + +++ + N K            ++  +KS    +  I RQ G+   ++G      +
Sbjct: 229 IDTLRRRMQVMNSKRTVHFTKFPAVYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGLCK 288

Query: 283 SFPXXXXXXXXFEFVL 298
           S P        +E  +
Sbjct: 289 SVPTTAISLFVYERTM 304

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 14/84 (16%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQF------------ 50
            +E +SR +   +G+ +G    T+  P DT++ R+Q   + S   + F            
Sbjct: 202 EKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQV--MNSKRTVHFTKFPAVYHEYRY 259

Query: 51  KGPLDCVYKTLKNQGIRGLYLGFT 74
           K     +YK L+ +G+  LY G T
Sbjct: 260 KSSTAIIYKILRQEGVSALYRGLT 283

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 112/279 (40%), Gaps = 24/279 (8%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F+AG  +G  + ++ +PF+  K RLQ     S A    + PL  +Y T KN GI  +Y+G
Sbjct: 94  FLAGSIAGAIEASITYPFEFAKTRLQLVDKASKAS---RNPLVLIYNTGKNYGISSIYVG 150

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG--CIISGVMAGWTVSFIA- 129
               + G               + LL      E     LSG   +++G+ AG   S +A 
Sbjct: 151 CPAFIVGNTAKAGIRFLGFDTIKNLLRDKKTGE-----LSGFRGVVAGLGAGLLESVVAV 205

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR- 188
            P E  K  L     A   KY      +   + + ++  G  G    LY+G++   + + 
Sbjct: 206 TPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSG----LYRGVLPVSMRQA 261

Query: 189 SNFVFWWGSYELITQWFQKNTNLS-----APAINFWAGGLSASFGFWTSAYPSDVVKQVV 243
           +N     G Y  I    Q  TN+      +  + F  G  S     +T+  P D VK  +
Sbjct: 262 ANQAVRLGCYNKIKTLVQDYTNVPKDKPLSSGLTFIVGAFSGIVTVYTT-MPIDTVKTRM 320

Query: 244 LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
                  G + S     + I+++ G+  F+KG  P   R
Sbjct: 321 --QSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGR 357

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 9/157 (5%)

Query: 12  GFVAGMFSGVAKNTVG-HPFDTVKVRLQTSQVGSGAGIQF--KGPLDCVYKTLKNQGIRG 68
           G VAG+ +G+ ++ V   PF+ +K  L   +  +    Q   KG +    K L +QG  G
Sbjct: 189 GVVAGLGAGLLESVVAVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSG 248

Query: 69  LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCI--ISGVMAGWTVS 126
           LY G  P         +  LG  +  + L+  Y     DK PLS  +  I G  +G    
Sbjct: 249 LYRGVLPVSMRQAANQAVRLGCYNKIKTLVQDYTNVPKDK-PLSSGLTFIVGAFSGIVTV 307

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQ 163
           +   P++  K ++Q        +Y+  I+    +FK+
Sbjct: 308 YTTMPIDTVKTRMQ---SLNAGQYSSTINCFATIFKE 341

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+ G FSG+       P DTVK R+Q+   G     Q+   ++C     K +G++  +
Sbjct: 294 LTFIVGAFSGIVTVYTTMPIDTVKTRMQSLNAG-----QYSSTINCFATIFKEEGLKTFW 348

Query: 71  LGFTPPLFGWIM 82
            G TP L   I+
Sbjct: 349 KGATPRLGRLIL 360

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 127/312 (40%), Gaps = 28/312 (8%)

Query: 1   MVSEETYSR-VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYK 59
           M S++  S   +  +AG  +G+ +    HP DT+KVR+Q  +   G+G++  G +    +
Sbjct: 1   MASKQKSSNPAVNLIAGGGAGLMEGLCCHPLDTIKVRMQIYKNAVGSGVKAPGFIKTGGE 60

Query: 60  TLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119
             +N+G    Y G    + G     +    S   YR LL      E  K+      I+GV
Sbjct: 61  IYRNEGFLAFYKGLGAVVIGITPKMAIRFSSYEFYRTLLAD---KETGKVSTGNTFIAGV 117

Query: 120 MAGWT-VSFIAAPVELAKAKLQVQY---DAKTTKYTGPIDVVQKVFKQGMATNGILGGVR 175
            AG T    +  P+E+ K +LQ Q+        KY   +     + K+         G  
Sbjct: 118 GAGITEAVVVVNPMEVVKIRLQAQHLNPVEGAPKYKNAVQACYTIVKE--------EGFS 169

Query: 176 SLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW 230
           +LY+G+  T   +     +NF  +    E + Q +     L +   +   G +S + G +
Sbjct: 170 ALYRGVSLTAARQATNQGANFTVYSKLKEFL-QGYHNQEMLPSWETSLI-GLISGAIGPF 227

Query: 231 TSAYPSDVVKQVVLCNDKYDGSFKSWRTAV---SDIYRQRGIHGFFKGFLPSFLRSFPXX 287
           ++A P D +K   L  DK   +    +        + ++ G    +KG  P  +R  P  
Sbjct: 228 SNA-PLDTIK-TRLQKDKSTKNMSGLKRITIIGKQLIQEEGFRALYKGITPRVMRVAPGQ 285

Query: 288 XXXXXXFEFVLR 299
                 +EF+ +
Sbjct: 286 AVTFTAYEFIRK 297

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 113/286 (39%), Gaps = 38/286 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           FVAG  +G  + ++ +PF+  K RLQ     S A    + PL  +Y T K QG+  +Y+G
Sbjct: 14  FVAGALAGAVEASITYPFEFAKTRLQLIDKSSKAS---RNPLVLIYNTAKTQGVGAIYVG 70

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC--IISGVMAGWTVSFIA- 129
               + G     +         R LL      E     LSG   +++G+ AG   S +A 
Sbjct: 71  CPAFIVGNTAKAATRFLGYDTIRNLLKDKKTGE-----LSGPRGVLAGLGAGLLESVVAV 125

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL----GGVRSLYKGLISTL 185
            P E  K  L     +   KY            + MA N I      G R LY G++   
Sbjct: 126 TPFEAIKTVLIDDKQSVRPKYQNN--------GRSMARNYISLVKDEGFRGLYGGVLPVS 177

Query: 186 IFR-SNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT------SAYPSDV 238
           + + +N     G Y  I    Q  T   AP       GL+   G ++      +  P D 
Sbjct: 178 MRQAANQAVRLGCYNKIKVLVQDYTG--APKDKPLTSGLTFIVGAFSGVVTVYATMPIDT 235

Query: 239 VKQVV--LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           VK  +  L   KY  +   + T    IY++ G+  F+KG  P   R
Sbjct: 236 VKTRMQSLTASKYSSTLNCFTT----IYKEEGLKTFWKGATPRLGR 277

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+ G FSGV       P DTVK R+Q     S    ++   L+C     K +G++  +
Sbjct: 214 LTFIVGAFSGVVTVYATMPIDTVKTRMQ-----SLTASKYSSTLNCFTTIYKEEGLKTFW 268

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRML 97
            G TP L G +++   ++ +++   +L
Sbjct: 269 KGATPRL-GRLILSGGIVFTIYENVLL 294

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 82/186 (44%), Gaps = 28/186 (15%)

Query: 13  FVAGMFSGVAKNTVG----HPFDTVKVRLQTSQVGSGAGIQ--FKGPLDCVYKTLKNQGI 66
           F   +FSG A   +     +  D  + RL     GS +  Q  F G LD   KTLK  G+
Sbjct: 118 FAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDVYKKTLKTDGL 177

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
            GLY GF P + G I+      G   +++        P      L G  ++  + GW ++
Sbjct: 178 LGLYRGFVPSVLGIIVYRGLYFGLYDSFK--------PVLLTGALEGSFVASFLLGWVIT 229

Query: 127 FIAA----PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLI 182
             A+    P++  + ++ +    +T KY G +D ++K+ ++         G  SL+KG  
Sbjct: 230 MGASTASYPLDTVRRRMMMT-SGQTIKYDGALDCLRKIVQK--------EGAYSLFKGCG 280

Query: 183 STLIFR 188
           +  IFR
Sbjct: 281 AN-IFR 285

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 117/285 (41%), Gaps = 31/285 (10%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAG---IQFKGPLDCVYKTLKNQGIRGL 69
           F+ G  S     T   P + VK+ +Q  +     G    ++KG LDC  +T  ++GI   
Sbjct: 17  FLMGGVSAAIAKTGAAPIERVKLLMQNQEEMLKQGSLDTRYKGILDCFKRTATHEGIVSF 76

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP--LSGCIISGVMAGWTVSF 127
           + G T  +  +    +         + LL      E D      +G + SG  AG     
Sbjct: 77  WRGNTANVLRYFPTQALNFAFKDKIKSLLS--YDRERDGYAKWFAGNLFSGGAAGGLSLL 134

Query: 128 IAAPVELAKAKLQVQYDAKTTKYT------GPIDVVQKVFKQGMATNGILGGVRSLYKGL 181
               ++ A+ +L    DA+ +K T      G +DV +K  K    T+G+LG  R     +
Sbjct: 135 FVYSLDYARTRLAA--DARGSKSTSQRQFNGLLDVYKKTLK----TDGLLGLYRGFVPSV 188

Query: 182 ISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQ 241
           +  +++R  +   + S++ +        +  A  +  W   + AS    T++YP D V++
Sbjct: 189 LGIIVYRGLYFGLYDSFKPVLLTGALEGSFVASFLLGWVITMGAS----TASYPLDTVRR 244

Query: 242 VVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
            ++       KYDG+    R     I ++ G +  FKG   +  R
Sbjct: 245 RMMMTSGQTIKYDGALDCLR----KIVQKEGAYSLFKGCGANIFR 285

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69
           V  F+ G    +  +T  +P DTV+ R+  +   SG  I++ G LDC+ K ++ +G   L
Sbjct: 219 VASFLLGWVITMGASTASYPLDTVRRRMMMT---SGQTIKYDGALDCLRKIVQKEGAYSL 275

Query: 70  YLGFTPPLF 78
           + G    +F
Sbjct: 276 FKGCGANIF 284

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/304 (22%), Positives = 117/304 (38%), Gaps = 43/304 (14%)

Query: 29  PFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN--------------QGIRGLYLGFT 74
           PFD VK RLQ+         Q     + VY+ L +              +G R L+ G  
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 75  PPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVEL 134
           P L G I   S    +    +    + +    +   +    ++G  AGW  S    P+ L
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPWIH--FLAGATAGWATSTATNPIWL 186

Query: 135 AKAKLQVQY--DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFV 192
            K +LQ+    D ++ +Y    D ++ V    M   GILG    LYKGL ++ +     +
Sbjct: 187 VKTRLQLDKAADGRSRRYKNSWDCLKGV----MRNEGILG----LYKGLSASYLGSVESI 238

Query: 193 FWWGSYELITQWFQKNT-----NLSAP------AINFWA--GGLSASFGFWTS--AYPSD 237
             W  YE +    ++ +     ++S         +  W    G + +   + S   YP +
Sbjct: 239 LQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHE 298

Query: 238 VVKQVVLCNDKYDGSFK--SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           VV+  +    K +G  K      + S I ++ G    + G  P  +R+ P        +E
Sbjct: 299 VVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGTWE 358

Query: 296 FVLR 299
            V++
Sbjct: 359 LVIK 362

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 95/226 (42%), Gaps = 34/226 (15%)

Query: 2   VSEETYSRVMG---------FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKG 52
           V+++T SR++          F+AG  +G A +T  +P   VK RLQ  +   G   ++K 
Sbjct: 147 VTKDTASRLLNDGQEAPWIHFLAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKN 206

Query: 53  PLDCVYKTLKNQGIRGLYLGFTPPLFG-------WIMMDSALLGSLHNYRMLLHKYVYPE 105
             DC+   ++N+GI GLY G +    G       W++ +   +  +   R +       E
Sbjct: 207 SWDCLKGVMRNEGILGLYKGLSASYLGSVESILQWVLYEQ--MKHIIRQRSIEEFGDISE 264

Query: 106 HDKLPLSG----CIISGV--MAGWTVSFIAAPVELAKAKL-QVQYDAKTTKYTGPIDVVQ 158
            +K         C  SG    A    S +  P E+ + +L Q   +    KYTG      
Sbjct: 265 ENKTTYMKVKEWCQRSGSAGAAKLFASILTYPHEVVRTRLRQAPKENGKLKYTGLFQSFS 324

Query: 159 KVFKQGMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYELITQ 203
            + K+         G  S+Y GL   L+    N +  +G++EL+ +
Sbjct: 325 LIIKE--------EGFASMYSGLTPHLMRTVPNSIIMFGTWELVIK 362

>AER184W [2686] [Homologous to ScYBL030C (PET9) - SH; ScYBR085W
           (AAC3) - SH] complement(978781..979698) [918 bp, 305 aa]
          Length = 305

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 63/293 (21%), Positives = 124/293 (42%), Gaps = 23/293 (7%)

Query: 1   MVSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---QFKGPLDCV 57
           M   +  + ++ F+ G  S     T   P + VK+ +Q        G    ++ G +DC 
Sbjct: 1   MSDNKQSNFLINFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKQGSLDRRYNGIVDCF 60

Query: 58  YKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP--LSGCI 115
            +T  ++G+   + G T  +  +    +         + +       E D      +G +
Sbjct: 61  KRTAASEGVISFWRGNTANVIRYFPTQALNFAFKDKIKAMFG--FRKEVDGYAKWFAGNL 118

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGG 173
            SG  AG         ++ A+ +L    D+K+ K  G    + +  V+K+ +A++GI G 
Sbjct: 119 ASGGAAGGLSLLFVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGIAGL 176

Query: 174 VRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSA 233
            R     ++  +++R     ++G Y+ +        NL +  I  +  G + + G  T++
Sbjct: 177 YRGFLPSVVGIVVYRG---LYFGMYDSLKPLLLTG-NLESSFIASFLLGWAVTTGASTAS 232

Query: 234 YPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           YP D V++ ++       KYDG+F ++R  V+      G+   FKG   + LR
Sbjct: 233 YPLDTVRRRMMMTSGQAVKYDGAFDAFRKIVA----AEGVKSLFKGCGANILR 281

>Scas_721.129
          Length = 323

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/297 (23%), Positives = 118/297 (39%), Gaps = 29/297 (9%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQ-FKGPLDCVYKTL 61
           + +  S+   F+AG  +     T  +P + VK+R+Q     +  G + ++ P+  +    
Sbjct: 15  AAQKVSKFGSFIAGGMAACIAVTFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIF 74

Query: 62  KNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE---HDKLPLSGCIISG 118
           +N+GIRGL  G        I ++ + LG     R  L+   YP    H    +S  + +G
Sbjct: 75  RNEGIRGLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAG 134

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYDA----KTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             +G   + I +P+ L K ++Q   DA    + T Y        +    G++T     G 
Sbjct: 135 ASSGIIGAVIGSPLFLVKTRMQSYSDAIKIGEQTHY--------RNVWNGLSTIARTEGF 186

Query: 175 RSLYKGLISTLIFRSNF--VFWWGSYELITQWFQKNTNL-SAPAINFWAGGLSASFGFWT 231
           + L++G I   I R+          Y     +  KN  +   P ++  A  +S   G   
Sbjct: 187 KGLFRG-IDAAILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISG-LGVAV 244

Query: 232 SAYPSDVVKQVVLCNDK---YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
              P DV+   +  N K   Y G    +   V    R  GI   +KGF    LR  P
Sbjct: 245 VMNPWDVILTRIY-NQKGNLYKGPVDCFVKTV----RTEGISALYKGFQAQILRIAP 296

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 121/293 (41%), Gaps = 35/293 (11%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG F+G+ +++V  P D +K R+Q+S   SGA  Q  G +  + K    +G   L+ G
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSS--SSGAATQ--GLIKQISKITTAEGSLALWKG 75

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE--HDKLPLSGCIISGVMAGWTVSFIAA 130
               + G     +    +   Y     K + P+  H   P+    ISG+ A      +  
Sbjct: 76  VQSVILGAGPAHAVYFAT---YEFSKSKLIDPQDMHTHQPIKTA-ISGMAATTVADALMN 131

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190
           P ++ K ++Q+         T  I       K+G A         + Y    +TL+    
Sbjct: 132 PFDVIKQRMQLNTRESVWHVTKNI-----YHKEGFA---------AFYYSYPTTLVMNIP 177

Query: 191 F-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLS-ASFGFWTSAYPSDVVKQVV----- 243
           F  F +  YE  T+ F   +N   P I+  +GGLS A+    T+  P D +K V+     
Sbjct: 178 FAAFNFAIYESATK-FMNPSNEYNPFIHCISGGLSGATCAAITT--PLDCIKTVLQVRGS 234

Query: 244 -LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
              +++      +++ A S IY+  G  GF +G  P  + + P        +E
Sbjct: 235 ETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYE 287

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 44/208 (21%), Positives = 82/208 (39%), Gaps = 41/208 (19%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN- 63
            T+  +   ++GM +    + + +PFD +K R+Q +   S            V+   KN 
Sbjct: 108 HTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRES------------VWHVTKNI 155

Query: 64  ---QGIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLS 112
              +G    Y  +   L        F + + +SA             K++ P ++  P  
Sbjct: 156 YHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESAT------------KFMNPSNEYNPFI 203

Query: 113 GCIISGVMAGWTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
            C ISG ++G T + I  P++  K  LQV+  +  + +     +  Q+        +G  
Sbjct: 204 HC-ISGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWK 262

Query: 172 GGVRSLYKGLISTLIFRSNFVFWWGSYE 199
           G +R L   +I+ +   +     W SYE
Sbjct: 263 GFLRGLKPRVIANMPATA---ISWTSYE 287

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 108/256 (42%), Gaps = 28/256 (10%)

Query: 29  PFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALL 88
           P  T+  R+Q S+     G + K  L+ V +  + +G+ G Y G    ++G   M +  L
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYG---MAANSL 92

Query: 89  GSLHNYRMLLHKYVYPE-HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKT 147
              + Y +     +      +L  S  I+S  +AG   +  + P+ +   ++ V    ++
Sbjct: 93  NYYYFYELAARATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQS 152

Query: 148 TKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYE----LITQ 203
           T     +D+V+K             GV +L+ GL   L+  SN +  +  +E    ++ +
Sbjct: 153 T-LAVLLDIVRK------------DGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLK 199

Query: 204 WFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK-QVVLCNDKYDGSFKS--WRTAV 260
           W   +  L + A    A G  A+ G   S YP   +K ++ L   K D   +   W   V
Sbjct: 200 WSGSDVLLPSWAFLLGAVGKLAATG---STYPYITLKTRMHLAKGKEDADTQQSMWSLMV 256

Query: 261 SDIYRQRGIHGFFKGF 276
            DI ++ GI G + G 
Sbjct: 257 -DIVKKEGIQGLYHGI 271

>Kwal_47.18216
          Length = 333

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 120/326 (36%), Gaps = 54/326 (16%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           +  VAG  +G+ +    HP DT+KVR+Q        G + +G +         +G   LY
Sbjct: 12  INLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALY 71

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS-FIA 129
            G    + G I   +    S   +R LL      +   +      ++GV AG T +  + 
Sbjct: 72  KGLGAVVIGIIPKMAIRFTSYEFFRTLLADR---QTGVVSTGNTFVAGVGAGITEAVMVV 128

Query: 130 APVELAKAKLQVQY------------------------------DAKTTKYTGPIDVVQK 159
            P+E+ K +LQ Q+                               A T KY   I     
Sbjct: 129 NPMEVVKIRLQAQHVRYVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYV 188

Query: 160 VFKQGMATNGILGGVRSLYKGLISTLIFR-----SNFVFWWGSYELITQWFQKNTNLSAP 214
           + K+         G R+LY+G+  T   +     +NF  +      + ++ Q  T++   
Sbjct: 189 IVKE--------EGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQ--TDMLPS 238

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVS---DIYRQRGIHG 271
                 G +S + G +++A P D +K   L  DK       W   ++    + R+ G   
Sbjct: 239 WETSLIGLISGALGPFSNA-PLDTIK-TRLQKDKSTSKDSGWSRILAIGRQLIREEGFRA 296

Query: 272 FFKGFLPSFLRSFPXXXXXXXXFEFV 297
            +KG  P  +R  P        +E +
Sbjct: 297 LYKGITPRVMRVAPGQAVTFTVYELI 322

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 125/322 (38%), Gaps = 55/322 (17%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
           +E  S     VAG  SG+   T   P DTVK++LQ +     A +        +   LK 
Sbjct: 10  DEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQVTPHNKNANV--------LINILKR 61

Query: 64  QGIRGLYLGFTPPLFGWIMMDSALLGSLHNY-----RMLLHKYVYPEHDKLPLSGCIISG 118
           +GIRG + G  P    +I+   A  GS + Y     R  L   + P+     L  C++ G
Sbjct: 62  EGIRGFWKGNVPGSIMYIIYGGAQFGS-YTYIGSFLRGGLDLNISPQ-----LYSCLV-G 114

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
            +AG T S  + P ++ + +       +  K    I  +        +  G++G     +
Sbjct: 115 SLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAI-------WSHEGLMG----FF 163

Query: 179 KGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSA-----PAINFWAGGLSASFGFWTS 232
            G  S++I    N    +G YE I  + ++ + LS        +N  AG +S  F    +
Sbjct: 164 SGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISG-FTSKLA 222

Query: 233 AYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYR----------------QRGIHGFFKGF 276
            +P D V++ +   +  +   +  R    DIY+                Q G    ++G 
Sbjct: 223 TFPLDTVRRRIQIRNSPNEE-RHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLSLYRGV 281

Query: 277 LPSFLRSFPXXXXXXXXFEFVL 298
             S ++S P        +E  +
Sbjct: 282 TMSLIKSVPSTAISLWSYELFM 303

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 56.2 bits (134), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 123/297 (41%), Gaps = 45/297 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP--LDCVYKTLKNQGIRGLY 70
            +AG  SG+   ++  P DT+K+RLQ +      G++  G   ++     +KN+GIR  +
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPAN---GLKPFGSQVMEVARSMIKNEGIRSFW 76

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA 130
            G  P    ++   SA   S      L ++Y+ P   +  L   ++ G  AG T S ++ 
Sbjct: 77  KGNIPGSLLYVTYGSAQFSSYS----LFNRYLTPFGLEARLHSLVV-GAFAGITSSIVSY 131

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLI---STLIF 187
           P ++ + +L       +   T  +  + K           L G+   +KG I   +T+  
Sbjct: 132 PFDVLRTRLVANNQMHSMSITREVRDIWK-----------LEGLPGFFKGSIASMTTITL 180

Query: 188 RSNFVFWWGSYELITQWFQKNTNLSA-------PAINFWAGGLSASFGFWTSAYPSDVVK 240
            ++ +F  G+YE I  +  +N   +A         +N  AG +        +     + +
Sbjct: 181 TASIMF--GTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRR 238

Query: 241 QVVLCNDKY----------DGSFKSWRTAVS--DIYRQRGIHGFFKGFLPSFLRSFP 285
           ++   N K+           GS+K +  A     I +Q G+   ++G L +  ++ P
Sbjct: 239 RMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIP 295

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 84/208 (40%), Gaps = 15/208 (7%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
           +R+   V G F+G+  + V +PFD ++ RL  +       I  +     V    K +G+ 
Sbjct: 111 ARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITRE-----VRDIWKLEGLP 165

Query: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLL--HKYVYPEHDKLPLSGCIIS-GVMAGWT 124
           G + G    +    +  S + G+    R+    ++     H K  L+    S G + G  
Sbjct: 166 GFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVI 225

Query: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGI----LGGVRSLYKG 180
              I  P+E  + ++Q        K++    V       G A  G+      GV SLY+G
Sbjct: 226 AKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRG 285

Query: 181 LISTL--IFRSNFVFWWGSYELITQWFQ 206
           ++  L     + FV +WG YE    + +
Sbjct: 286 ILVALSKTIPTTFVSFWG-YETAIHYLR 312

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 56.2 bits (134), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/325 (22%), Positives = 132/325 (40%), Gaps = 56/325 (17%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK----NQGIRGL 69
           +AG  SG    T+  P D +K+  QTS        ++ G L  +Y+  K    N GIRG 
Sbjct: 23  LAGGVSGSCAKTLIAPLDRIKILFQTSNPHYS---KYAGSLVGLYEAAKHIWINDGIRGF 79

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYR-MLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
           + G +  L       +    +    R +L+    Y  H +      + SG +AG    FI
Sbjct: 80  FQGHSVTLLRIFPYAAVKFVAYEQIRSILIPSREYESHWRR-----LASGSLAGLCSVFI 134

Query: 129 AAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR---------SLYK 179
             P++L + +L    + K  K     D+V+ ++ +  A+ G+   +          + Y+
Sbjct: 135 TYPLDLTRVRLAYVTEHKRVKLR---DIVKTIYHEP-ASEGLTSHLLVPKWFAHWCNFYR 190

Query: 180 GLISTL-------------------IFRSNFVFWWGSYELITQWFQKNTNLSAPA-INFW 219
           G + T+                   I +S+ +  +   +L +Q   +   L     +  W
Sbjct: 191 GYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQEELERKKLRQKTPLRTW 250

Query: 220 ----AGGLSASFGFWTSAYPSDVVK---QVVLCNDK--YDGSFKSWRTAVSDIYRQRGIH 270
               AGGLS      T+AYP ++++   QV   + +  YD  F+S  +    IY+++G  
Sbjct: 251 AELVAGGLSGILS-QTAAYPLEIIRRRLQVSTLSPRKMYDHKFQSISSIARIIYQEKGWR 309

Query: 271 GFFKGFLPSFLRSFPXXXXXXXXFE 295
           GFF G    +++  P        +E
Sbjct: 310 GFFVGLSIGYIKVTPMVACSFFVYE 334

>Kwal_23.3965
          Length = 307

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/305 (19%), Positives = 124/305 (40%), Gaps = 36/305 (11%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            VAG  SG++   V  P DT+K+RLQ  Q+ + A  Q+ G L    + ++ +G+R L+ G
Sbjct: 18  LVAGCLSGISARIVTAPLDTLKIRLQL-QLANEA--QYGGILVTFKRLVRQEGVRALWKG 74

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPV 132
             P +  +I+  S    S      LL K   P       +G +  G ++G   +  + P 
Sbjct: 75  NVPAMAMYILYGSTQFTSYAILNKLLSKSQLPAQIH---TGMV--GALSGTCSAIASYPC 129

Query: 133 ELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFV 192
           ++ + +    +  + +     +   Q++++      G  G  + +   ++S  +  S+ +
Sbjct: 130 DVLRTRFIANHSRELSTM---LSTAQEIWRH----EGFRGFFKGVSSSIVSIAVATSSIL 182

Query: 193 FWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW--TSAYPSDVVKQVVLCND--- 247
               +YE +  + ++  +  +  I       S   G    T  +P D V++     D   
Sbjct: 183 ---ATYESVKIFCEQRPDRDSSVIQLLESSASVIAGIVSKTIVFPIDTVRKRYQVIDWQQ 239

Query: 248 -----KYDGSFKSWRTAVSD--------IYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXF 294
                  + ++K++++  S         I  + G+   + G+     +S P        +
Sbjct: 240 LGHPGHTNKAYKAYKSYTSTNFLRLALMIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVY 299

Query: 295 EFVLR 299
           E+ LR
Sbjct: 300 EWCLR 304

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166
            ++P+   +++G ++G +   + AP++  K +LQ+Q  A   +Y G +   +++ +Q   
Sbjct: 10  QEVPVFQSLVAGCLSGISARIVTAPLDTLKIRLQLQL-ANEAQYGGILVTFKRLVRQ--- 65

Query: 167 TNGILGGVRSLYKGLISTLIFRSNFVFW----WGSYELITQWFQKNTNLSAPAINFWAGG 222
                 GVR+L+KG +  +   + ++ +    + SY ++ +   K + L A       G 
Sbjct: 66  -----EGVRALWKGNVPAM---AMYILYGSTQFTSYAILNKLLSK-SQLPAQIHTGMVGA 116

Query: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL 281
           LS +     S YP DV++   + N  +     +  +   +I+R  G  GFFKG   S +
Sbjct: 117 LSGTCSAIAS-YPCDVLRTRFIAN--HSRELSTMLSTAQEIWRHEGFRGFFKGVSSSIV 172

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 120/287 (41%), Gaps = 49/287 (17%)

Query: 16  GMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK----NQGIRGLYL 71
           G  +G+    V HP D  KVRLQ + +          P   +++ L+    N+G+ GLY 
Sbjct: 20  GGAAGIFATMVTHPLDLAKVRLQAAPM----------PKPTLFRMLESILANEGVVGLYS 69

Query: 72  GFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD------KLPLSGCIISGVMAGWTV 125
           G +  +       +   G+      LL + V P          LP S  + SG + G   
Sbjct: 70  GLSAAVLRQCTYTTVRFGAYD----LLKENVIPREQLTNMAYLLPCS--MFSGAIGGLAG 123

Query: 126 SFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG----L 181
           +F A  V +          AK   Y   ID V K+++         GG+++L+ G    +
Sbjct: 124 NF-ADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYE-------GGLKTLFTGWKPNM 175

Query: 182 ISTLIFRSNFVFWWGSYE--LITQW-FQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDV 238
           +  ++  ++ V  +  ++  L+T+  F  + N +    +  AG ++      T   P+DV
Sbjct: 176 VRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVAT-----TVCSPADV 230

Query: 239 VKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           +K  ++      G  +     ++D  R+ G    F+G+LPSF R  P
Sbjct: 231 MKTRIMNG---SGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGP 274

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/275 (21%), Positives = 114/275 (41%), Gaps = 12/275 (4%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---QFKGPLDCVYKTLKNQGIRGL 69
           F+ G  S     T   P + VK+ +Q        G    ++KG +DC  +T + +GI   
Sbjct: 15  FLMGGVSAAVAKTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEGIISF 74

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           + G T  +  +     AL  +  +    +  +   E      +G + SG +AG       
Sbjct: 75  WRGNTANVIRYFPTQ-ALNFAFKDQIKAMFGFKKEEGYAKWFAGNLASGGIAGGLSLMFV 133

Query: 130 APVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGGVRSLYKGLISTLIF 187
             ++ A+ +L    DAK++K  G    + +  V+K+ +A++G+ G  R     +I  +++
Sbjct: 134 YSLDYARTRLAA--DAKSSKKGGERQFNGLVDVYKKTIASDGVAGLYRGFLPSVIGIVVY 191

Query: 188 RSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCND 247
           R     ++G Y+         + L    I  +  G   + G  T++YP D V++ ++   
Sbjct: 192 RG---LYFGLYDSCKPLLLTGS-LEGSFIASFLLGWVVTTGASTASYPLDTVRRRMMMTS 247

Query: 248 KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
                +K     +  I    G+   FKG   + LR
Sbjct: 248 GQAVKYKGAMDCLQKIVAAEGVSSLFKGCGANILR 282

 Score = 34.7 bits (78), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 7/77 (9%)

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWRTAVSDIY----RQRG 268
           AI+F  GG+SA+    T+A P + VK ++   D+    GS       + D +    RQ G
Sbjct: 12  AIDFLMGGVSAAVA-KTAASPIERVKLLIQNQDEMIKQGSLDHRYKGIVDCFQRTARQEG 70

Query: 269 IHGFFKGFLPSFLRSFP 285
           I  F++G   + +R FP
Sbjct: 71  IISFWRGNTANVIRYFP 87

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/323 (21%), Positives = 126/323 (39%), Gaps = 52/323 (16%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK----NQGIRGL 69
           +AG  SG    T+  P D +K+  QTS   +    ++ G L  + +  K    N G+RG 
Sbjct: 38  LAGGISGSCAKTLIAPLDRIKILFQTS---NPHYTKYTGSLIGLVEAAKHIWINDGVRGF 94

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           + G +  L       +    +    R  L     P  +       ++SG +AG    FI 
Sbjct: 95  FQGHSATLLRIFPYAAVKFVAYEQIRNTL----IPSKEFESHWRRLVSGSLAGLCSVFIT 150

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV--------RSLYKGL 181
            P++L + +L  + + K  K      +++K++K+  +   I             + Y+G 
Sbjct: 151 YPLDLVRVRLAYETEHKRVKLG---RIIKKIYKEPASATLIKNDYIPNWFCHWCNFYRGY 207

Query: 182 ISTL-------------------IFRSNFVFWWGSYELIT-QWFQKNTNLSAPAINFWA- 220
           + T+                   + +S F   +   EL      ++        +  WA 
Sbjct: 208 VPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDDELERVQKKQRRPLRTWAE 267

Query: 221 ---GGLSASFGFWTSAYPSDVVK---QVVLCNDK--YDGSFKSWRTAVSDIYRQRGIHGF 272
              GGL A     T+AYP ++++   QV   + K  YD  F+S       I+++RG+ GF
Sbjct: 268 LISGGL-AGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGF 326

Query: 273 FKGFLPSFLRSFPXXXXXXXXFE 295
           F G    +++  P        +E
Sbjct: 327 FVGLSIGYIKVTPMVACSFFVYE 349

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 220 AGGLSASFGFWTSAYPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
           AGG+S S    T   P D +K +   ++    KY GS      A   I+   G+ GFF+G
Sbjct: 39  AGGISGSCA-KTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQG 97

Query: 276 FLPSFLRSFPXXXXXXXXFEFVLRT 300
              + LR FP        +E +  T
Sbjct: 98  HSATLLRIFPYAAVKFVAYEQIRNT 122

>Scas_716.29
          Length = 316

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 118/313 (37%), Gaps = 50/313 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ-----TSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
            VAG  SG+   TV  P DT+K+RLQ     T Q  SG     KG +      L   G+R
Sbjct: 26  LVAGSVSGLLARTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMI------LNEGGLR 79

Query: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
             + G  P    +++   A   S   Y  L  +      D       ++ G +AG T SF
Sbjct: 80  SFWKGNVPGTMMYVLYGGAQFSSYSFYNNLFGE----TSDMNGQLQSLVVGALAGMTSSF 135

Query: 128 IAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS---T 184
           ++ P ++ +           T++    DV       G      + G+   ++G  +   T
Sbjct: 136 VSYPTDVLR-----------TRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFT 184

Query: 185 LIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTS--AYPSDVVKQV 242
           +   ++ +F  G+YE I  +  + +   +   N+     S+  G  +    YP D +++ 
Sbjct: 185 ITLSASILF--GTYESIKIYCDEYSK-ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRR 241

Query: 243 VLCNDKYDGSFKSWRTAVSDIY----------------RQRGIHGFFKGFLPSFLRSFPX 286
           +   +            V++IY                RQ G+   ++G   S  ++ P 
Sbjct: 242 IQVRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPS 301

Query: 287 XXXXXXXFEFVLR 299
                  +E V+R
Sbjct: 302 TVVSLWAYETVMR 314

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 80/178 (44%), Gaps = 17/178 (9%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166
           + + +S  +++G ++G     + AP++  K +LQ++       YTG          +GM 
Sbjct: 18  EDVKVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-----PSYTGQAPSGLLKMMKGMI 72

Query: 167 TNGILGGVRSLYKGLISTLIFRSNFVFWWG----SYELITQWFQKNTNLSAPAINFWAGG 222
            N   GG+RS +KG +   +    +V + G    SY      F + ++++    +   G 
Sbjct: 73  LNE--GGLRSFWKGNVPGTMM---YVLYGGAQFSSYSFYNNLFGETSDMNGQLQSLVVGA 127

Query: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
           L+     + S YP+DV++   + N   D +  S      +I+   GI GFF+G   S 
Sbjct: 128 LAGMTSSFVS-YPTDVLRTRFIANQ--DVALSSLSHGCKEIWNMEGIPGFFRGCTASM 182

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 19/35 (54%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQ 38
           E  Y+  + + A   SGV    V +P DT++ R+Q
Sbjct: 209 ESDYTNYLRYSASSISGVTSKMVTYPLDTIRRRIQ 243

>Scas_718.24
          Length = 337

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 70/165 (42%), Gaps = 23/165 (13%)

Query: 28  HPFDTVKVRLQTSQVGS--GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDS 85
           +  D  + RL      S  G   QF G +D   KTLK+ G+ GLY GF P + G I+   
Sbjct: 165 YSLDFARTRLAADSKSSKKGGSRQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGIIVYRG 224

Query: 86  ALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA----PVELAKAKLQV 141
              G        L+  + P      L G  ++  + GW V+  A+    P++  + K+ +
Sbjct: 225 LYFG--------LYDSIKPVLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDTVRRKMMM 276

Query: 142 QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               +  KY G  D  +K+            GV SL+KG  + ++
Sbjct: 277 T-SGQAVKYKGAFDCFKKIVAA--------EGVASLFKGCGANIL 312

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 124/296 (41%), Gaps = 29/296 (9%)

Query: 1   MVSEETYSR-VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---QFKGPLDC 56
           M +E+  S   + F+ G  S     T   P + VK+ +Q        G    ++KG +DC
Sbjct: 33  MSTEKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQNEMLKQGTLDTKYKGIVDC 92

Query: 57  VYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
             +T + +GI   + G T  +  +     AL  +  +   L+  +   +      +G + 
Sbjct: 93  FRRTAQQEGIISFWRGNTANVIRYFPTQ-ALNFAFKDKIKLMFGFKKEDGYGKWFAGNLA 151

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTK------YTGPIDVVQKVFKQGMATNGI 170
           SG  AG         ++ A+ +L    D+K++K      + G IDV +K  K    ++G+
Sbjct: 152 SGGAAGGLSLLFVYSLDFARTRLAA--DSKSSKKGGSRQFNGLIDVYKKTLK----SDGV 205

Query: 171 LGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW 230
            G  R     ++  +++R     ++G Y+ I       + L    +  +  G   + G  
Sbjct: 206 AGLYRGFLPSVVGIIVYRG---LYFGLYDSIKPVLLTGS-LEGSFLASFLLGWVVTTGAS 261

Query: 231 TSAYPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           T +YP D V++ ++       KY G+F  ++  V+      G+   FKG   + LR
Sbjct: 262 TCSYPLDTVRRKMMMTSGQAVKYKGAFDCFKKIVA----AEGVASLFKGCGANILR 313

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 13/92 (14%)

Query: 206 QKNTNLSAP------AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWR 257
           Q NT +S        AI+F  GG+SA+    T+A P + VK ++   ++    G+  +  
Sbjct: 28  QSNTIMSTEKPQSNFAIDFLMGGVSAAVA-KTAASPIERVKLLIQNQNEMLKQGTLDTKY 86

Query: 258 TAVSDIYR----QRGIHGFFKGFLPSFLRSFP 285
             + D +R    Q GI  F++G   + +R FP
Sbjct: 87  KGIVDCFRRTAQQEGIISFWRGNTANVIRYFP 118

>Kwal_27.12481
          Length = 304

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 73/165 (44%), Gaps = 23/165 (13%)

Query: 28  HPFDTVKVRLQTSQVGS--GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDS 85
           +  D  + RL     G+  G   QF G +D   KTL + GI GLY GF P + G ++   
Sbjct: 133 YSLDYARTRLAADSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRG 192

Query: 86  ALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA----PVELAKAKLQV 141
              G   + + LL            L G  ++  + GW V+  A+    P++  + ++ +
Sbjct: 193 LYFGGYDSLKPLLLTG--------SLEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 142 QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               +  KY G  D  +K+    +A  GI    +SL+KG  + ++
Sbjct: 245 T-SGQAVKYNGAFDAFRKI----VAAEGI----KSLFKGCGANIL 280

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/279 (22%), Positives = 120/279 (43%), Gaps = 20/279 (7%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQ--VGSGA-GIQFKGPLDCVYKTLKNQGIRGL 69
           F+ G  S     T   P + VK+ +Q     +  G+   ++ G  +C  +T  N+GI   
Sbjct: 14  FLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIGECFKRTAANEGIASF 73

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           + G T  +  +     AL  +  +    +  +   E      +G + SG  AG       
Sbjct: 74  WRGNTANVIRYFPTQ-ALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGGLSLMFV 132

Query: 130 APVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGGVRSLYKGLISTLIF 187
             ++ A+ +L    D+K  K  G    + +  V+K+ +A++GI G  R     ++  +++
Sbjct: 133 YSLDYARTRLAA--DSKGAKKGGERQFNGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVY 190

Query: 188 RSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCND 247
           R     ++G Y+ +       + L    +  +  G + + G  T++YP D V++ ++   
Sbjct: 191 RG---LYFGGYDSLKPLLLTGS-LEGSFLASFLLGWAVTTGASTASYPLDTVRRRMMMTS 246

Query: 248 ----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
               KY+G+F ++R  V+      GI   FKG   + LR
Sbjct: 247 GQAVKYNGAFDAFRKIVA----AEGIKSLFKGCGANILR 281

>Scas_379.2
          Length = 301

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 122/294 (41%), Gaps = 38/294 (12%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG F+G+ +++V  P D +K R+Q++   S + +     L  + K    +G   L+ G
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNM-----LSQMAKISTAEGSLALWKG 81

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHD---KLPLSGCIISGVMAGWTVSFIA 129
               + G     +    +    +    KY+  E D     PL    +SG +A      + 
Sbjct: 82  VQSVILGAGPAHAVYFATYEYTK----KYLIDEKDMQTHQPLKTA-LSGTVATIAADALM 136

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS 189
            P +  K ++Q+  +  TT +    +V ++++K          G  + Y    +TL    
Sbjct: 137 NPFDTLKQRMQL--NTNTTVW----NVTKQIYKN--------EGFSAFYYSYPTTLAMNI 182

Query: 190 NF-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLS-ASFGFWTSAYPSDVVKQVVLCND 247
            F  F +  YE  T++F   TN   P ++  +GGLS A+    T+  P D +K V+    
Sbjct: 183 PFAAFNFMIYESATKFFNP-TNDYNPLVHCLSGGLSGATCAAITT--PLDCIKTVLQVRG 239

Query: 248 KYDGSFK------SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
               S +      +++ A   IY+  G  GF++G  P    + P        +E
Sbjct: 240 SESVSLQVMKEANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYE 293

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 29/146 (19%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           +T+  +   ++G  + +A + + +PFDT+K R+   Q+ +   +      +   +  KN+
Sbjct: 114 QTHQPLKTALSGTVATIAADALMNPFDTLKQRM---QLNTNTTV-----WNVTKQIYKNE 165

Query: 65  GIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
           G    Y  +   L        F +++ +SA             K+  P +D  PL  C +
Sbjct: 166 GFSAFYYSYPTTLAMNIPFAAFNFMIYESAT------------KFFNPTNDYNPLVHC-L 212

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQ 142
           SG ++G T + I  P++  K  LQV+
Sbjct: 213 SGGLSGATCAAITTPLDCIKTVLQVR 238

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 71/182 (39%), Gaps = 20/182 (10%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166
           D  PLS  +++G  AG     +  P++  K ++Q    AK+T           +  Q MA
Sbjct: 19  DSAPLSHQLLAGAFAGIMEHSVMFPIDALKTRIQ-STSAKSTS---------NMLSQ-MA 67

Query: 167 TNGILGGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWF--QKNTNLSAPAINFWAGGL 223
                 G  +L+KG+ S ++        ++ +YE   ++   +K+     P     +G +
Sbjct: 68  KISTAEGSLALWKGVQSVILGAGPAHAVYFATYEYTKKYLIDEKDMQTHQPLKTALSGTV 127

Query: 224 SASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRS 283
            A+        P D +KQ +  N     +   W      IY+  G   F+  +  +   +
Sbjct: 128 -ATIAADALMNPFDTLKQRMQLNT----NTTVWNV-TKQIYKNEGFSAFYYSYPTTLAMN 181

Query: 284 FP 285
            P
Sbjct: 182 IP 183

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 74/165 (44%), Gaps = 23/165 (13%)

Query: 28  HPFDTVKVRLQTSQVGS--GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDS 85
           +  D  + RL      S  G   QF G  D   KTLK+ GI GLY GF P + G ++   
Sbjct: 135 YSLDFARTRLAADAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRG 194

Query: 86  ALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA----PVELAKAKLQV 141
              G   + + L+            L G  ++  + GW V+  A+    P++  + ++ +
Sbjct: 195 LYFGMFDSLKPLVLTG--------SLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMM 246

Query: 142 QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               +  KY G ID ++K+    +A+     GV SL+KG  + ++
Sbjct: 247 T-SGQAVKYNGAIDCLKKI----VASE----GVGSLFKGCGANIL 282

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 117/283 (41%), Gaps = 20/283 (7%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---QFKGPLDCVYKTLKNQGI 66
            + F+ G  S     T   P + VK+ +Q        G    ++ G +DC  +T K +G+
Sbjct: 13  AINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDCFKRTAKQEGL 72

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
              + G T  +  +     AL  +  +   L+  +   E      +G + SG  AG    
Sbjct: 73  ISFWRGNTANVIRYFPTQ-ALNFAFKDKIKLMFGFKKEEGYGKWFAGNLASGGAAGALSL 131

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGGVRSLYKGLIST 184
                ++ A+ +L    DAK++K  G    + +  V+K+ + ++GI G  R     ++  
Sbjct: 132 LFVYSLDFARTRLAA--DAKSSKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGI 189

Query: 185 LIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244
           +++R  +   + S + +      + +  A  +  W     AS    T +YP D V++ ++
Sbjct: 190 VVYRGLYFGMFDSLKPLVLTGSLDGSFLASFLLGWVVTTGAS----TCSYPLDTVRRRMM 245

Query: 245 CND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRS 283
                  KY+G+    +  V+      G+   FKG   + LRS
Sbjct: 246 MTSGQAVKYNGAIDCLKKIVA----SEGVGSLFKGCGANILRS 284

 Score = 35.4 bits (80), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 44/86 (51%), Gaps = 10/86 (11%)

Query: 206 QKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWRTAVSDI 263
           Q+ TN    AINF  GG+SA+    T+A P + VK ++   D+    G+     + + D 
Sbjct: 7   QQETNF---AINFLMGGVSAAIA-KTAASPIERVKILIQNQDEMIKQGTLDKKYSGIVDC 62

Query: 264 YR----QRGIHGFFKGFLPSFLRSFP 285
           ++    Q G+  F++G   + +R FP
Sbjct: 63  FKRTAKQEGLISFWRGNTANVIRYFP 88

>YBL030C (PET9) [164] chr2 complement(163006..163962) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [957 bp, 318 aa]
          Length = 318

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 117/286 (40%), Gaps = 28/286 (9%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGI---QFKGPLDCVYKTLKNQGI 66
           ++ F+ G  S     T   P + VK+ +Q        G    ++ G LDC  +T   +G+
Sbjct: 24  LIDFLMGGVSAAVAKTAASPIERVKLLIQNQDEMLKQGTLDRKYAGILDCFKRTATQEGV 83

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
              + G T  +  +     AL  +  +    +  +   E      +G + SG  AG    
Sbjct: 84  ISFWRGNTANVIRYFPTQ-ALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSL 142

Query: 127 FIAAPVELAKAKLQVQYDAKTTK------YTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
                ++ A+ +L    D+K++K      + G IDV +K  K    ++G+ G  R     
Sbjct: 143 LFVYSLDYARTRLAA--DSKSSKKGGARQFNGLIDVYKKTLK----SDGVAGLYRGFLPS 196

Query: 181 LISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
           ++  +++R     ++G Y+ +       + L    +  +  G   + G  T +YP D V+
Sbjct: 197 VVGIVVYRG---LYFGMYDSLKPLLLTGS-LEGSFLASFLLGWVVTTGASTCSYPLDTVR 252

Query: 241 QVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           + ++       KYDG+F   R  V+      G+   FKG   + LR
Sbjct: 253 RRMMMTSGQAVKYDGAFDCLRKIVA----AEGVGSLFKGCGANILR 294

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 82/193 (42%), Gaps = 29/193 (15%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVG----HPFDTVKVRLQTSQVGS--GAGIQFKGPLDCV 57
           EE Y++   F   + SG A   +     +  D  + RL      S  G   QF G +D  
Sbjct: 120 EEGYAKW--FAGNLASGGAAGALSLLFVYSLDYARTRLAADSKSSKKGGARQFNGLIDVY 177

Query: 58  YKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIIS 117
            KTLK+ G+ GLY GF P + G ++      G   + + LL            L G  ++
Sbjct: 178 KKTLKSDGVAGLYRGFLPSVVGIVVYRGLYFGMYDSLKPLLLTG--------SLEGSFLA 229

Query: 118 GVMAGWTVSFIAA----PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
             + GW V+  A+    P++  + ++ +    +  KY G  D ++K+            G
Sbjct: 230 SFLLGWVVTTGASTCSYPLDTVRRRMMMT-SGQAVKYDGAFDCLRKIVAA--------EG 280

Query: 174 VRSLYKGLISTLI 186
           V SL+KG  + ++
Sbjct: 281 VGSLFKGCGANIL 293

>Scas_328.1
          Length = 227

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 79/179 (44%), Gaps = 31/179 (17%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           +  +F  + KN +G    ++K         SGA  +F G LD   KTL   G+ GLY GF
Sbjct: 52  IVCLFLRLCKNEIGSDAKSIK---------SGAPRKFNGILDVYKKTLFTDGVLGLYRGF 102

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA--- 130
            P + G ++      G   + + +L    + E+  LP         + GW V+  A+   
Sbjct: 103 LPSVVGIMVYRGLYFGLYDSLKPVLLTGSF-ENAFLP-------SFLLGWAVTISASTTS 154

Query: 131 -PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR 188
            P++  + ++ +    +  KY G ID  Q++  Q         GV SL+KG  +  IFR
Sbjct: 155 YPLDTVRRRMMMT-SGQAVKYKGAIDCFQQIVSQ--------EGVYSLFKGCGAN-IFR 203

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 78/163 (47%), Gaps = 26/163 (15%)

Query: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGGVRSLYKGLI 182
            SF    + L   K ++  DAK+ K   P   + +  V+K+ + T+G+LG  R     ++
Sbjct: 48  CSFPIVCLFLRLCKNEIGSDAKSIKSGAPRKFNGILDVYKKTLFTDGVLGLYRGFLPSVV 107

Query: 183 STLIFRSNFVFWWGSYE-----LITQWFQKNTNLSAPAINF-WAGGLSASFGFWTSAYPS 236
             +++R     ++G Y+     L+T  F+   N   P+    WA  +SAS    T++YP 
Sbjct: 108 GIMVYRG---LYFGLYDSLKPVLLTGSFE---NAFLPSFLLGWAVTISAS----TTSYPL 157

Query: 237 DVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
           D V++ ++       KY G+   ++  VS    Q G++  FKG
Sbjct: 158 DTVRRRMMMTSGQAVKYKGAIDCFQQIVS----QEGVYSLFKG 196

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 36/66 (54%), Gaps = 3/66 (4%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           F+ G    ++ +T  +P DTV+ R+  +   SG  +++KG +DC  + +  +G+  L+ G
Sbjct: 140 FLLGWAVTISASTTSYPLDTVRRRMMMT---SGQAVKYKGAIDCFQQIVSQEGVYSLFKG 196

Query: 73  FTPPLF 78
               +F
Sbjct: 197 CGANIF 202

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 79/194 (40%), Gaps = 23/194 (11%)

Query: 105 EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQG 164
           +H   PL   +ISG+ AG   + +  P++L K +LQ+   +    + GP  V++++ +  
Sbjct: 3   DHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRS- 61

Query: 165 MATNGILGGVRSLYKGLISTLIFRSNFVFWWGSY--------ELI---------TQWFQK 207
            + N        LY+GL   L   +     WG Y        ELI         TQ    
Sbjct: 62  -SANSGRSVTNELYRGLSINLFGNA---IAWGVYFGLYGVTKELIYKSVAKPGETQLKGV 117

Query: 208 NTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDK-YDGSFKSWRTAVSDIYRQ 266
             +    ++ + + G S+         P  V+K  ++   K   G++ S    V  + R 
Sbjct: 118 GNDHKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRT 177

Query: 267 RGIHGFFKGFLPSF 280
            G  G +KG +P+ 
Sbjct: 178 DGFQGLWKGLVPAL 191

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/308 (21%), Positives = 117/308 (37%), Gaps = 42/308 (13%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRG----- 68
           ++G+ +G     V HP D +KVRLQ S   + A     GP   + + +++    G     
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLS--ATSAQKAHYGPFMVIKEIIRSSANSGRSVTN 71

Query: 69  -LYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVY-PEHDKLPLSGC---------IIS 117
            LY G +  LFG  +      G     + L++K V  P   +L   G          + +
Sbjct: 72  ELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSA 131

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSL 177
           G  +G   + +  P+ + K ++          YT   + VQ++ +    T+G  G    L
Sbjct: 132 GASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLR----TDGFQG----L 183

Query: 178 YKGLISTLIFRSNFVFWWGSYELITQWFQKN----------TNLSAPAINFWAGGLSASF 227
           +KGL+  L   S    ++  Y+ + Q   +           TNL    I      +S + 
Sbjct: 184 WKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTL 243

Query: 228 GFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXX 287
                 YP  ++K  +      +  F+ +   +  I    G  G +KG   + +R+ P  
Sbjct: 244 -----VYPFQLLKSNLQSFRANEQKFRLF-PLIKLIIANDGFVGLYKGLSANLVRAIPST 297

Query: 288 XXXXXXFE 295
                 +E
Sbjct: 298 CITFCVYE 305

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 82/186 (44%), Gaps = 24/186 (12%)

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQV-QYDAKTTKYTGPIDVVQKVFKQGMATN 168
           PL   IISG+ AG   + +  P++L K +LQ+   D K + Y    + VQ++ K G  T 
Sbjct: 11  PLQKEIISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSY---YNQVQRIIKDGSGTQ 67

Query: 169 GILGGVRSLYKGLISTLI------------FR--SNFVFWWGSYELITQWFQKNTNLSAP 214
            +L   +  Y+GL   +I            +R   + V+   S   +   F  +  +++ 
Sbjct: 68  QLL---KEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFMNDRKMTSS 124

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFK 274
                AG    +    T+  P  V+K  ++      G + S   A++ IY + G+  F++
Sbjct: 125 MYLVSAGASGLATALLTN--PMWVIKTRIMSTKSSQG-YTSILNAITRIYTEEGLKTFWR 181

Query: 275 GFLPSF 280
           G +PS 
Sbjct: 182 GLVPSL 187

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/298 (17%), Positives = 119/298 (39%), Gaps = 27/298 (9%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCV-----YKTLKNQGIR 67
            ++G+ +G     V HP D +K+RLQ + +       +      +      + L  +  R
Sbjct: 16  IISGLTAGTITTIVTHPLDLIKLRLQLAAIDLKPSSYYNQVQRIIKDGSGTQQLLKEAYR 75

Query: 68  GLYLGFTPPLFGWIM------MDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMA 121
           GL +        W +          ++ SL +   L +K++     K+  S  ++S   +
Sbjct: 76  GLGINIIGNAVAWGLYFGLYRCSKDVVYSLSSEPALQNKFM--NDRKMTSSMYLVSAGAS 133

Query: 122 GWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGL 181
           G   + +  P+ + K ++     ++   YT  ++ + +++ +         G+++ ++GL
Sbjct: 134 GLATALLTNPMWVIKTRIMSTKSSQ--GYTSILNAITRIYTE--------EGLKTFWRGL 183

Query: 182 ISTLIFRSNFVFWWGSYE-LITQWFQKNTNLSAPAINFWA--GGLSASFGF-WTSAYPSD 237
           + +L   +    ++  Y+ L  ++     ++    +N     G +S S     +S YP  
Sbjct: 184 VPSLFGVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGIISLSKMISVSSVYPLQ 243

Query: 238 VVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           ++K  +              + +  I+   GI GF+KG   + +R+ P        +E
Sbjct: 244 LLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAIPSTCITFGVYE 301

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 54/268 (20%), Positives = 111/268 (41%), Gaps = 42/268 (15%)

Query: 28  HPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSAL 87
           +P  T+  +LQT   G+    Q K  L+ + +  +  G+ G Y G    ++G  + +   
Sbjct: 32  YPLVTITTKLQTQ--GNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFV- 88

Query: 88  LGSLHNYRMLLHKYVYP--EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDA 145
               + +  L  + V    +H KL     +++G +AG   +  + P+ +A  ++ V    
Sbjct: 89  ---YYYFYELTSRNVLKVRKHKKLNTLESMLTGCVAGSVTAIASNPIWVANTRMTVTKSE 145

Query: 146 KTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYE----LI 201
           KT   T  I++V+K               ++L+ GL   L+   N +  +  +E    L+
Sbjct: 146 KTALAT-IIEIVKK------------DSAKTLFNGLKPALVLVMNPIVQYTVFEQLKNLV 192

Query: 202 TQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDK------------- 248
             W ++   + +P+  F  G L        S YP   +K  +  ++              
Sbjct: 193 LAWNKQ--GILSPSWAFLLGAL-GKLAATGSTYPYITLKTRMHLSESGKHTDDDSGKKAK 249

Query: 249 -YDGSFKSWRTAVSDIYRQRGIHGFFKG 275
            +  S KS  + +++I ++ G+ G ++G
Sbjct: 250 GHKASSKSMLSLITEIVKKDGVSGLYRG 277

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/249 (22%), Positives = 99/249 (39%), Gaps = 32/249 (12%)

Query: 49  QFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSA-----LLGSLHNYRMLLHKYVY 103
           ++K  LD + K  +N+G  GLY G +  L G  +   +      L   H +R+   K V 
Sbjct: 86  RYKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRV---KKVK 142

Query: 104 PEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQ 163
            E  +      ++  ++A  T      P+ +   K Q +   +        +  + + K+
Sbjct: 143 GEAARFSTIEELLLSMLAAATSQLFTNPINIVSTKQQTRRGLEGD------NSFKAIAKE 196

Query: 164 GMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYELI------TQWFQKNTNLSA---- 213
               +GI G     +K L  +L+   N    + S E +       +W  K+ N S+    
Sbjct: 197 VYDEDGITG----FWKSLKVSLVLTINPSITYASAEKLKDILYHVEWNAKDLNDSSLQLK 252

Query: 214 PAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFF 273
           P  NF  G LS       + +P  V K  +    +    F S++  ++ +YR  G H  +
Sbjct: 253 PGQNFLIGVLSKIISTCLT-HPLIVAKASL---QRSSSKFTSFQEVLTYLYRHEGAHALW 308

Query: 274 KGFLPSFLR 282
           KG LP   +
Sbjct: 309 KGLLPQLTK 317

>Kwal_55.21106
          Length = 328

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 123/303 (40%), Gaps = 55/303 (18%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQ----VGSGAG------------IQFKGPLDCV 57
           + G  +    N V +P D VK  +QT      +GS AG            I++K  LD +
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 58  YKTLKNQGIRGLYLGFTPPL-------FGWIMMDSALLGSLHNYRML---LHKYVYPEHD 107
            K  K +G+ GLY G    +       F +    S +  S   Y++L   L K+  PE  
Sbjct: 68  IKIFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFSTPEE- 126

Query: 108 KLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMAT 167
                  ++ G++A        +P+ +   +   Q  + +    G  +V+ +++ +    
Sbjct: 127 -------LLLGIVAAAVSQIFTSPIGVISTR---QQTSTSGSKGGFREVLHQIYSE---Q 173

Query: 168 NGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWF---QKNTNLSAPAINFWAGGLS 224
           N I G     ++G   +LI   N    + SYE +   F   ++  + +   +   +G LS
Sbjct: 174 NNITG----FWRGFKVSLILTVNPSITFASYEKLQDIFITSKRAVDENGQLLE-TSGQLS 228

Query: 225 ASFGFWTSAYP---SDVVKQVVLCNDKY----DGSFKSWRTAVSDIYRQRGIHGFFKGFL 277
               F    +    S ++ Q ++ +  Y      +F+S++  +  +Y+Q G+   +KG  
Sbjct: 229 PRQNFLLGVFSKVISTLITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGLA 288

Query: 278 PSF 280
           P  
Sbjct: 289 PQL 291

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 74/192 (38%), Gaps = 37/192 (19%)

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYD------------------AKTTKYTGPIDVV 157
           I+G +A    + +  P++L K  +Q Q                     +  +Y   +D +
Sbjct: 8   ITGAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDAL 67

Query: 158 QKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWG-------SYELITQWFQKNTN 210
            K+FK    T G+LG  + L+  +I+  +   ++ FW+         Y+L+     K + 
Sbjct: 68  IKIFK----TKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLGKFST 123

Query: 211 LSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIY-RQRGI 269
                +   A  +S  F   TS       +Q         GS   +R  +  IY  Q  I
Sbjct: 124 PEELLLGIVAAAVSQIF---TSPIGVISTRQ----QTSTSGSKGGFREVLHQIYSEQNNI 176

Query: 270 HGFFKGFLPSFL 281
            GF++GF  S +
Sbjct: 177 TGFWRGFKVSLI 188

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/287 (19%), Positives = 114/287 (39%), Gaps = 32/287 (11%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAG-----IQFKGPLDCVYKTLKNQGI 66
            F   + S +A  TV +P D  K  +QT    + +G      ++K  +DC+ K  K +G 
Sbjct: 7   AFTGAVASSLAATTV-YPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGF 65

Query: 67  RGLYLGFTPPLFGWIMMD------SALLGSLHNYRMLLHKYVYPEHDKLPLSGCIIS--- 117
            GLY G    +    + +       +L+ S  NY +     +  + D   +    I    
Sbjct: 66  LGLYQGLATNVAANFVQNFIYFFWYSLIRS--NYFVFKAGRLQLKDDSKFIELSTIEELA 123

Query: 118 -GVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
            G+ AG     +  P+ +   + Q+  D +         V+++++++        G + +
Sbjct: 124 LGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKA---VIKQIYEESN------GDLTA 174

Query: 177 LYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPA--INFWAGGLSASFGFWTSAY 234
            +KG    L+  +N    +GSY+ +         LS         + G +   G ++   
Sbjct: 175 FWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMI 234

Query: 235 PSDVVKQVVLCNDKYDG---SFKSWRTAVSDIYRQRGIHGFFKGFLP 278
            + V + +++      G    FK+++  +  IY+  G    +KG +P
Sbjct: 235 STFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGVIP 281

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 6/66 (9%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
            F+ GMFS +    V  P    K+ LQ      G G +FK   + +    +N+G   L+ 
Sbjct: 224 NFLLGMFSKMISTFVTQPLIVAKITLQ------GKGSKFKTFQEVLQHIYQNEGFLSLWK 277

Query: 72  GFTPPL 77
           G  P +
Sbjct: 278 GVIPQV 283

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 103/266 (38%), Gaps = 21/266 (7%)

Query: 45  GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP 104
            + ++F G L+   K    +GI  L+ G +  L   +M   A +     Y  +  + V P
Sbjct: 97  NSSLKFNGTLEAFTKIASVEGITSLWRGISLTL---LMAIPANMVYFSGYEYI--RDVSP 151

Query: 105 EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQG 164
                P    +  G +A    +   AP+EL K KL  Q   +++K T    +V+ +  + 
Sbjct: 152 IASTYPTLNPLFCGAIARVFAATSIAPLELVKTKL--QSIPRSSKSTKTWMMVKDLLNET 209

Query: 165 MATNGILGGVRSLYKGLISTLIFRSNF-VFWWGSYELITQ--WFQKNTNLSAPA-----I 216
                ++G  R+L+KGL  TL     F   +W SYEL  +  W       S  A     I
Sbjct: 210 RQEMKMVGPSRALFKGLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFI 269

Query: 217 NFWAGGLSASFGFWTSAYPSDVVK---QVVLCNDKYDGSFKSWRTA---VSDIYRQRGIH 270
           N +A G  +        +P DV K   Q+ + N+         R     +  I+R  G+ 
Sbjct: 270 NSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLA 329

Query: 271 GFFKGFLPSFLRSFPXXXXXXXXFEF 296
             + G     ++  P        +E 
Sbjct: 330 ALYTGLAARVIKIRPSCAIMISSYEI 355

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSG---AGIQFKGPLDCVYKTLKNQGI 66
           +  F +G  SG+      HPFD  K R Q S + +     G + +     +    + +G+
Sbjct: 269 INSFASGCISGMIAAICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGL 328

Query: 67  RGLYLGF 73
             LY G 
Sbjct: 329 AALYTGL 335

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/330 (23%), Positives = 127/330 (38%), Gaps = 54/330 (16%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTS-----------QVGSG------------AGIQ 49
           FVAG   G+A   V  PFD VK RLQ+             +  G            AG  
Sbjct: 56  FVAGGIGGMAGAVVTCPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTH 115

Query: 50  FKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKL 109
           FK  L  +    K +G R L+ G  P L G I   S    +    + +  K  +    + 
Sbjct: 116 FKETLGIIGNVYKQEGFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAK-AFNNGQET 174

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTT--KYTGPIDVVQKVFKQGMAT 167
           P+   +++   AGW  +    P+ L K ++Q+    KT+  +Y    D ++ V +     
Sbjct: 175 PMIH-LMAAATAGWATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRN---- 229

Query: 168 NGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKN-----------TNLSAPAI 216
                G   LYKGL ++ +     +  W  YE + +  ++            T  ++  +
Sbjct: 230 ----EGFTGLYKGLSASYLGSVEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKV 285

Query: 217 NFW-----AGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK--SWRTAVSDIYRQRGI 269
             W     + GL A F    + YP +VV+  +    K +G  K      +   I ++ G+
Sbjct: 286 KEWCQRSGSAGL-AKFVASIATYPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGL 344

Query: 270 HGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
              + G  P  +R+ P        +E V+R
Sbjct: 345 FSMYSGLTPHLMRTVPNSIIMFGTWEIVIR 374

>Kwal_23.4731
          Length = 314

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 25/192 (13%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166
           D  PL   II+G+ AG   +    P++L K +LQ+  +  TT   G  +V++ + +   A
Sbjct: 9   DFTPLQREIIAGLAAGTLTTIATHPLDLVKLRLQLLVN--TTHSHGYKEVIKTIIRDSKA 66

Query: 167 TNGILGGVRSLYKGLISTLI--------------FRSNFVFWWGSYELIT---QWFQKNT 209
            + +    R  Y+GL   LI              F  + V+ +G  ++ T     FQK+ 
Sbjct: 67  DSNVF---REAYRGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDK 123

Query: 210 NLSAPAINFWAGGLSASFGFWTSAYPSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRG 268
            +  P++   +  LS   G      P  V+K +++  + +    +K+    +  +Y   G
Sbjct: 124 AM-GPSLYLASAALSG-LGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEG 181

Query: 269 IHGFFKGFLPSF 280
             GF++G +PS 
Sbjct: 182 FSGFWRGLVPSL 193

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/308 (20%), Positives = 121/308 (39%), Gaps = 41/308 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG--IRGLY 70
            +AG+ +G       HP D VK+RLQ   V +     +K  +  + +  K      R  Y
Sbjct: 17  IIAGLAAGTLTTIATHPLDLVKLRLQL-LVNTTHSHGYKEVIKTIIRDSKADSNVFREAY 75

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKY-----------VYPEHDKLPLSGCIISGV 119
            G    L G  +      G     + ++++Y            + +   +  S  + S  
Sbjct: 76  RGLGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMGPSLYLASAA 135

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
           ++G   + +  P+ + K ++       + +Y    D ++KV+           G    ++
Sbjct: 136 LSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAH--------EGFSGFWR 187

Query: 180 GLISTLIFRSNFVFWWGSYE-LITQWF--------QKNTNLSAPAINFWAGGLSASFGFW 230
           GL+ +L   +    ++  Y+ L  Q+F        +K  NL   AI   +  LS      
Sbjct: 188 GLVPSLFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSVSKMLSV----- 242

Query: 231 TSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXX 287
           T+ YP  ++K   Q     +K D S++ W   V  I+++ G+ G +KG   + LR+ P  
Sbjct: 243 TAVYPFQLLKSNLQSFAAVEKRD-SYRFW-NLVKSIHQKEGLQGLYKGLSANLLRAIPST 300

Query: 288 XXXXXXFE 295
                 +E
Sbjct: 301 CITFCIYE 308

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 128/307 (41%), Gaps = 31/307 (10%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+AG  +G    TV  PF+ VK+ L   QV S      +G    + +    +G +GL+
Sbjct: 24  IAFLAGGVAGAVSRTVVSPFERVKILL---QVQSSTTSYNRGIFSSIRQVYHEEGTKGLF 80

Query: 71  LG---FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
            G       +F +  +   +  +    + L H       ++L  +  + SG + G     
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACK--KKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVV 138

Query: 128 IAAPVELAKAKLQVQYDAKTTKYTGPIDVVQK---VFKQGMATNGILGGVRSLYKGLIST 184
              P++L K +L +Q    ++        + K   +++    T  + GG+R LY+G+  T
Sbjct: 139 ATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPT 198

Query: 185 LIFRSNFV-FWWGSYELITQWFQKNTNLSAPA---------INFWAGGLSASFGFWTSAY 234
            +    +V   +  YE + + F  N++ + P+         I   +GG++      T  Y
Sbjct: 199 SLGVVPYVALNFAVYEQLRE-FGVNSSDAQPSWKSNLYKLTIGAISGGVAQ-----TITY 252

Query: 235 PSDVVKQ----VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXX 290
           P D++++    + +  ++    + S   A+  I R  G+ G++KG   +  +  P     
Sbjct: 253 PFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVS 312

Query: 291 XXXFEFV 297
              +E V
Sbjct: 313 WLVYEVV 319

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 122/306 (39%), Gaps = 32/306 (10%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+AG  +G    TV  PF+ VK+ LQ     +      +G +  V +  + +G  GL+
Sbjct: 24  VAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYN---QGIVGAVRQVYREEGTPGLF 80

Query: 71  LGF---TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
            G       +F +  +   +  +   +    H       ++L     + SG + G     
Sbjct: 81  RGNGLNCIRIFPYSAVQFVVYEACKKH--FFHVDGSKGREQLQNWQRLFSGALCGGCSVL 138

Query: 128 IAAPVELAKAKLQVQYDAKT----------TKYTGPIDVVQKVFKQGMATNGILGGVRSL 177
              P++L + +L +Q    T          +K  G  D++ + +K+        GG++ L
Sbjct: 139 ATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEE-------GGIKGL 191

Query: 178 YKGLISTLIFRSNFV-FWWGSYELITQWFQKNT-NLSAPAINFWAGGLSASFGFWTSAYP 235
           Y+G+  T +    +V   +  YE   ++  + T N  A       G LS      T  YP
Sbjct: 192 YRGVWPTSLGVVPYVALNFAVYEQFKEFMPEGTDNTLANFYKLSIGALSGGVA-QTVTYP 250

Query: 236 SDVVKQ----VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXX 291
            D++++    + +  ++    +KS   A+  I +  G  G++KG   +  +  P      
Sbjct: 251 FDLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSW 310

Query: 292 XXFEFV 297
             +E V
Sbjct: 311 LVYEVV 316

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKTL 61
           ++ T +       G  SG    TV +PFD ++ R Q   +G    G ++K  +D +    
Sbjct: 224 TDNTLANFYKLSIGALSGGVAQTVTYPFDLLRRRFQVLAMGGNELGFRYKSVMDALITIG 283

Query: 62  KNQGIRGLYLGFTPPLFGWI 81
           K +G RG Y G T  LF  I
Sbjct: 284 KTEGFRGYYKGLTANLFKVI 303

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 116/329 (35%), Gaps = 80/329 (24%)

Query: 26  VGHPFDTVKVRLQT--------SQVGS---------------GAGIQFKGPLDCVYKTLK 62
           V  PFD VK RLQ+        SQ  +                A   FK  +  +    +
Sbjct: 73  VTCPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYR 132

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAG 122
            +G R L+ G  P L G I        S++ +     K +Y        S    +G  A 
Sbjct: 133 QEGFRSLFKGLGPNLVGVIPAR-----SINFFTYGTTKDIY--------SKAFNNGQEAP 179

Query: 123 W-----------TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           W             +    P+ + K ++Q+    KT  Y    D ++ + +         
Sbjct: 180 WIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRN-------- 231

Query: 172 GGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQK-----------NTNLSAPAINFWA 220
            G+  LY+GL ++ +     +  W  YE +    +K           +T  +   I  W 
Sbjct: 232 EGIYGLYRGLSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWC 291

Query: 221 ----GGLSASFGFWTSAYPSDVV----KQVVLCND--KYDGSFKSWRTAVSDIYRQRGIH 270
               G   A F      YP +VV    +Q  L N   KY G  +S+R     I ++ G+ 
Sbjct: 292 QRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRV----IIKEEGLA 347

Query: 271 GFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
             + G  P  +R+ P        +E V++
Sbjct: 348 SMYSGLTPHLMRTVPNSIIMFGTWEVVIK 376

>Kwal_33.14050
          Length = 314

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/309 (22%), Positives = 123/309 (39%), Gaps = 47/309 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ--TSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
             AG F+G+ ++++  P D +K R+Q  ++ +GS A    K P + V +  +     G  
Sbjct: 20  LAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGS-ANAAAKLPSNIVQQIARISTTEG-- 76

Query: 71  LGFTPPLFGWIMMDSALLGS-------LHNYRMLLHKYVYPE----HDKLPLSGCIISGV 119
                 +  W  + S +LG+          Y M     + P+    H  L  +    SG+
Sbjct: 77  -----SMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTAA---SGI 128

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
            A      +  P +  K ++Q++  +K   ++    V  ++++          G+ + + 
Sbjct: 129 AATVAADLLMNPFDTIKQRMQLRTFSKDRMWS----VASRIYRN--------EGLAAFFY 176

Query: 180 GLISTLIFRSNF-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLS-ASFGFWTSAYPSD 237
              +T+     F  F +  YE  T++F    N   P I+   GG+S A+    T+  P D
Sbjct: 177 SYPTTIAMNIPFAAFNFAIYESATKFFNPE-NTYNPLIHCLCGGISGATCAAITT--PLD 233

Query: 238 VVK---QVVLCNDKYDGSFKSWRT---AVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXX 291
            +K   QV       D  F+   T   A S I +  G  GF++G  P  + + P      
Sbjct: 234 CIKTVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISW 293

Query: 292 XXFEFVLRT 300
             +E    T
Sbjct: 294 TAYECAKHT 302

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 83/212 (39%), Gaps = 47/212 (22%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           +T+  +    +G+ + VA + + +PFDT+K R+Q                    +  +N+
Sbjct: 116 QTHQPLKTAASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVAS------RIYRNE 169

Query: 65  GIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
           G+   +  +   +        F + + +SA             K+  PE+   PL  C+ 
Sbjct: 170 GLAAFFYSYPTTIAMNIPFAAFNFAIYESAT------------KFFNPENTYNPLIHCLC 217

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
            G+ +G T + I  P++  K  LQV+         G   VV  +F+Q    +     +  
Sbjct: 218 GGI-SGATCAAITTPLDCIKTVLQVR---------GSESVVDPLFRQADTFSRAASAISK 267

Query: 177 LY------KGLISTLIFRSNF---VFWWGSYE 199
           +Y      +GL   +I  SN       W +YE
Sbjct: 268 VYGWSGFWRGLKPRII--SNMPATAISWTAYE 297

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 74/186 (39%), Gaps = 23/186 (12%)

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQ---VQYDAKTTKYTGPIDVVQKVFKQGMA 166
           PL+  + +G  AG     I  P++  K ++Q       +       P ++VQ++     A
Sbjct: 15  PLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQI-----A 69

Query: 167 TNGILGGVRSLYKGLISTLI-FRSNFVFWWGSYELIT------QWFQKNTNLSAPAINFW 219
                 G  +L+KG+ S ++        ++ +YE+        Q FQ +  L        
Sbjct: 70  RISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDPQDFQTHQPLKTA----- 124

Query: 220 AGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPS 279
           A G++A+        P D +KQ +    +     + W  A S IYR  G+  FF  +  +
Sbjct: 125 ASGIAATVAADLLMNPFDTIKQRMQL--RTFSKDRMWSVA-SRIYRNEGLAAFFYSYPTT 181

Query: 280 FLRSFP 285
              + P
Sbjct: 182 IAMNIP 187

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 71/165 (43%), Gaps = 23/165 (13%)

Query: 28  HPFDTVKVRL--QTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDS 85
           +  D  + RL   +     G   QF G +D   KTL + G+ GLY GF P + G ++   
Sbjct: 133 YSLDYARTRLAADSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGIVVYRG 192

Query: 86  ALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAA----PVELAKAKLQV 141
              G        L+  + P      L    ++  + GW V+  A+    P++  + ++ +
Sbjct: 193 LYFG--------LYDSLKPLLLTGSLENSFLASFLLGWAVTTGASTASYPLDTVRRRMMM 244

Query: 142 QYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
               +  KY G  D  +K+    +A  GI    +SL+KG  + ++
Sbjct: 245 T-SGQAVKYDGAFDAFRKI----VAAEGI----KSLFKGCGANIL 280

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/286 (22%), Positives = 128/286 (44%), Gaps = 28/286 (9%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQ--VGSGA-GIQFKGPLDCVYKTLKNQGI 66
            + F+ G  S     T   P + VK+ +Q     +  G+   ++ G ++C  +T  ++G+
Sbjct: 11  AIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKQGSLDRRYTGIVECFKRTAADEGV 70

Query: 67  RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVS 126
              + G T  +  +     AL  +  +    +  +   E      +G + SG +AG    
Sbjct: 71  ASFWRGNTANVIRYFPT-QALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGLAGGLSL 129

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGP--IDVVQKVFKQGMATNGILGGVRSLYKGLIST 184
                ++ A+ +L    D+K+ K  G    + +  V+K+ +A++G+ G  R     ++  
Sbjct: 130 LFVYSLDYARTRLAA--DSKSAKKGGERQFNGLVDVYKKTLASDGVAGLYRGFLPSVVGI 187

Query: 185 LIFRSNFVFWWGSYE----LITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
           +++R     ++G Y+    L+     +N+ L++  +  WA    AS    T++YP D V+
Sbjct: 188 VVYRG---LYFGLYDSLKPLLLTGSLENSFLASFLLG-WAVTTGAS----TASYPLDTVR 239

Query: 241 QVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           + ++       KYDG+F ++R  V+      GI   FKG   + LR
Sbjct: 240 RRMMMTSGQAVKYDGAFDAFRKIVA----AEGIKSLFKGCGANILR 281

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/324 (19%), Positives = 122/324 (37%), Gaps = 72/324 (22%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ-------- 64
            ++G+ +G       HP D VKVRLQ            +G  D V + +K+         
Sbjct: 12  MISGLTAGTITTVSTHPLDLVKVRLQLLATNKKP----QGYYDVVKRIVKDSKQHSFFRE 67

Query: 65  -----GIR--------GLYLGFTPP----LFGWIMMDSALLGSLHNYRMLLHKYVYPEHD 107
                G+         GLY G        +F W   D     +  N    +   +Y    
Sbjct: 68  TYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSLMY---- 123

Query: 108 KLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMAT 167
                  +++  M+G   S +  P+ + K ++       +  Y   +D ++K+++     
Sbjct: 124 -------LLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYR----- 171

Query: 168 NGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQWF---------QKNTNLSAPAINF 218
              + G+   ++GL+ +L   S    ++  Y+ +   +         +K +NL    I  
Sbjct: 172 ---IEGLAGFWRGLVPSLFGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITITS 228

Query: 219 WAGGLSASFGFWTSAYPSDVVKQVV-------LCNDKYDGSFKSWRTAVSDIYRQRGIHG 271
            +  +S      T+ YP  ++K  +       + N K   S + W+  ++ IY + G+ G
Sbjct: 229 LSKMVSV-----TAVYPLQLLKSNLQSFEVSTVINPK--TSHRVWK-LITTIYVRDGVTG 280

Query: 272 FFKGFLPSFLRSFPXXXXXXXXFE 295
            +KG L + +R+ P        +E
Sbjct: 281 LYKGLLANLIRAVPSTCITFCVYE 304

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 78/186 (41%), Gaps = 21/186 (11%)

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNG 169
           P+   +ISG+ AG   +    P++L K +LQ+   A   K  G  DVV+++ K     + 
Sbjct: 7   PVQKEMISGLTAGTITTVSTHPLDLVKVRLQLL--ATNKKPQGYYDVVKRIVKDSKQHSF 64

Query: 170 ILGGVRSLYKGLISTLIFRS-----NFVFWWGSYELITQW-------FQKNTNLSAPAIN 217
                R  Y+GL   L+  S      F  +  S + + QW       F    N      +
Sbjct: 65  F----RETYRGLGVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTS 120

Query: 218 FWAGGLSASFGFWTSAY--PSDVVKQVVLCNDKYDG-SFKSWRTAVSDIYRQRGIHGFFK 274
                 +A  G  TS    P  V+K  ++     D  S++S    +  +YR  G+ GF++
Sbjct: 121 LMYLLAAAMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWR 180

Query: 275 GFLPSF 280
           G +PS 
Sbjct: 181 GLVPSL 186

>YPR128C (ANT1) [5547] chr16 complement(791212..792198)
           Peroxisome-localized protein involved in adenine
           nucleotide transport, medium-chain fatty acid
           metabolism, and peroxisome proliferation, has similarity
           to ADP/ATP carrier proteins [987 bp, 328 aa]
          Length = 328

 Score = 47.8 bits (112), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 121/294 (41%), Gaps = 40/294 (13%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-----------GIQFKGPLDCVYKTLK 62
           + G  +    N   +P D  K  +Q SQV   +             ++K  +DC+    K
Sbjct: 8   LTGAVASAMANIAVYPLDLSKTIIQ-SQVSPSSSEDSNEGKVLPNRRYKNVVDCMINIFK 66

Query: 63  NQGIRGLYLGFTPPLFGWIMMD-------SALLGSLHNYRMLLHKYVYPEHDKLPLSGC- 114
            +GI GLY G T       + +       + +  S   +++L  + +      +  S   
Sbjct: 67  EKGILGLYQGMTVTTVATFVQNFVYFFWYTFIRKSYMKHKLLGLQSLKNRDGPITPSTIE 126

Query: 115 -IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
            ++ GV A        +P+ +   + Q  + A++ K+T   +V++ ++++        G 
Sbjct: 127 ELVLGVAAASISQLFTSPMAVVATRQQTVHSAESAKFT---NVIKDIYRENN------GD 177

Query: 174 VRSLYKGLISTLIFRSNFVFWWGSYELITQ-WFQKNTN----LSAPAINFWAGGLSASFG 228
           + + +KGL + L    N    + S++ + + +F  ++N    LSA   NF  G LS    
Sbjct: 178 ITAFWKGLRTGLALTINPSITYASFQRLKEVFFHDHSNDAGSLSAVQ-NFILGVLSKMIS 236

Query: 229 FWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
              +  P  V K ++         F +++ A+  +Y+  G+   +KG LP   +
Sbjct: 237 TLVTQ-PLIVAKAML---QSAGSKFTTFQEALLYLYKNEGLKSLWKGVLPQLTK 286

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 131/308 (42%), Gaps = 37/308 (12%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + FVAG   G    TV  P + VK+ L   QV S       G +  V +  K +G++GL+
Sbjct: 18  IAFVAGGVGGAVSRTVVSPVERVKILL---QVQSSTTAYNGGLVHAVKQVYKEEGVKGLF 74

Query: 71  LGFTPPLFGWIMMDSALLGSLHNY-RMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
            G        I   SA+  +++ + +  +       H++L     ++ G + G     + 
Sbjct: 75  RGNGINCL-RIFPYSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVT 133

Query: 130 APVELAKAKLQVQ-------YDAKTTKYTGP---IDVVQKVFKQGMATNGILGGVRSLYK 179
            P++L + +L +Q       + +K      P   +++++++F++        GG+R  Y+
Sbjct: 134 YPLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREE-------GGLRGWYR 186

Query: 180 GLISTLI-----FRSNFVFWWGSYELITQWFQKNTNLSAP-AINFWAGGLSASFGFWTSA 233
           G+  T +        NF  +     LI   +   +  +A  AI   +GG++      T  
Sbjct: 187 GVYPTSLGVVPFVALNFALYERLKALIPHDYDAGSVAAAKLAIGAVSGGIAQ-----TVV 241

Query: 234 YPSDVVK---QVVLCNDKYDG-SFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXX 289
           YP D+++   QV+       G  + S   A+  I RQ G+ G++KG   + ++  P    
Sbjct: 242 YPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAV 301

Query: 290 XXXXFEFV 297
               +E +
Sbjct: 302 QWFVYELI 309

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 126/316 (39%), Gaps = 57/316 (18%)

Query: 29  PFDTVKVRLQ----------TSQVGSGAG------------------IQFKGPLDCVYKT 60
           P D V+VRL           T Q+   AG                   + +G L+ + K 
Sbjct: 31  PLDVVRVRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARLQGTLEGLRKI 90

Query: 61  LKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
            + +G+  L+ G    L   +M   A +     Y  L      P   +LP++  ++ G  
Sbjct: 91  AQLEGLPTLWRGLGITL---VMAVPANVVYFSGYEALRDNS--PLASRLPVANPLVCGAF 145

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           A    +   AP+EL + +LQ    A+ T+ T  I ++  + ++      ++ G R+L+KG
Sbjct: 146 ARILAATTIAPLELLRTRLQSVPRARDTERT--IYLIGDLLREMRHEVSVM-GYRALFKG 202

Query: 181 LISTLIFRSNF-VFWWGSYELI-TQ-WFQKNTNLSAPAINFWAGGLSA-SFGFWTSA--- 233
           L  TL     F   +WG+YE   TQ W +     +A   + + G  +  S G   +A   
Sbjct: 203 LEITLWRDVPFSAIYWGTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLT 262

Query: 234 YPSDVVK---QVVLCN----------DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
           +P DV K   Q+ + +           K D S +   + ++ I +  GI   + G LP  
Sbjct: 263 HPFDVGKTRMQIAIASPQQLTVGGKATKTDDS-RGMFSFLNAIRKSEGIRALYTGLLPRV 321

Query: 281 LRSFPXXXXXXXXFEF 296
           ++  P        +E 
Sbjct: 322 MKIAPSCAIMISTYEL 337

 Score = 32.0 bits (71), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 29/72 (40%), Gaps = 9/72 (12%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTS-------QVGSGAGI--QFKGPLDCVYKTLKN 63
           F  G   G     + HPFD  K R+Q +        VG  A      +G    +    K+
Sbjct: 248 FACGSMGGAVAALLTHPFDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKS 307

Query: 64  QGIRGLYLGFTP 75
           +GIR LY G  P
Sbjct: 308 EGIRALYTGLLP 319

>Scas_662.12
          Length = 308

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 76/185 (41%), Gaps = 11/185 (5%)

Query: 106 HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTK----YTGPIDVVQKVF 161
           H+  P+   IISG+ AG   + I  P++L K +LQ+     T +    YT  I+ +    
Sbjct: 2   HELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNS 61

Query: 162 KQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQ----WFQKNTNLSAPAIN 217
           K+  +   I   ++  Y+GL   L+   N V W   + +        FQ N   +     
Sbjct: 62  KKMGSQGPIYNLIKESYRGLPINLL--GNAVAWSLYFTIYNSTKDYMFQNNYLHNNNTTI 119

Query: 218 FWAGGLSASFGFWTSAYPSDVVKQVVLCNDK-YDGSFKSWRTAVSDIYRQRGIHGFFKGF 276
           F   GL +         P  V+K  ++   + +  S+KS R     +  + G    + G 
Sbjct: 120 FLTSGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGL 179

Query: 277 LPSFL 281
           LPS L
Sbjct: 180 LPSLL 184

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 126/316 (39%), Gaps = 57/316 (18%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQ-----TSQ-------------VGSGAGIQFKGPL 54
            ++G+ +G     + HP D +KVRLQ     T+Q             + +   +  +GP 
Sbjct: 11  IISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGP- 69

Query: 55  DCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC 114
             +Y  +K +  RGL +        W +  + +  S  +Y M  + Y++  +  + L+  
Sbjct: 70  --IYNLIK-ESYRGLPINLLGNAVAWSLYFT-IYNSTKDY-MFQNNYLHNNNTTIFLT-- 122

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             SG+++G + + +  P+ + K ++          Y        K  + G  +     G 
Sbjct: 123 --SGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSY--------KSIRHGFKSLLTKEGP 172

Query: 175 RSLYKGLISTLIFRSNFVFWWGSYELITQWFQ----------KNTNLSAPAINFWAGGLS 224
           ++++ GL+ +L+  S    ++  Y+ +   F            N NL    I+  +  LS
Sbjct: 173 KAIWMGLLPSLLGVSQGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSLSKMLS 232

Query: 225 ASFGFWTSAYPSDVVKQVV-----LCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPS 279
                  S YP  ++K  +     + N+     +  + T +  IYR  GI G +KG   +
Sbjct: 233 V-----MSVYPFQLLKSNLQTFRSVTNNIPQNDYH-FITLIRKIYRDNGIKGLYKGLSAN 286

Query: 280 FLRSFPXXXXXXXXFE 295
            LR+ P        +E
Sbjct: 287 LLRAIPSTCITFCIYE 302

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 111/291 (38%), Gaps = 30/291 (10%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG F+G+ +++V  P D +K R+Q++   S   +  K  L  +     ++G   L+ G
Sbjct: 37  LIAGAFAGIMEHSVMFPIDALKTRIQSANAKS---LSAKNMLSQISHISTSEGTLALWKG 93

Query: 73  FTPPLFGWIMMDSALLGSLH-NYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAP 131
               + G     +   G+     + L+       H     +   ISG  A      +  P
Sbjct: 94  VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTA---ISGACATTASDALMNP 150

Query: 132 VELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS-N 190
            +  K ++Q+   A           V +  KQ   + G+     S    L+  + F + N
Sbjct: 151 FDTIKQRIQLNTSAS----------VWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFN 200

Query: 191 FVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYD 250
           FV +  S +     F   +N   P I+   G +S S     +  P D +K V+       
Sbjct: 201 FVIYESSTK-----FLNPSNEYNPLIHCLCGSISGSTCAAITT-PLDCIKTVLQIRGSQT 254

Query: 251 GSFKSWR------TAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
            S +  R       A S IY+  G  GF++G+ P  + + P        +E
Sbjct: 255 VSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYE 305

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 117/301 (38%), Gaps = 49/301 (16%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQ---TSQVGSGAGIQFKGPLDCVYKTLKNQGI---- 66
           ++G+ +G     + HP D  KVRLQ   TS    G            Y+ L ++ +    
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKKG------------YRNLWSEIVGSDL 60

Query: 67  ---RGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG--CIISGVMA 121
              R LY G T  L G  +       S    +  L  Y +   +   LS    + +   +
Sbjct: 61  SLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASS 120

Query: 122 GWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGL 181
           G   + +  P+ + K ++  + ++  T          KV +  +  +G+ G    L+KGL
Sbjct: 121 GMLTTVLTNPLWVIKTRMMSKANSDLTS--------MKVLRDLIKNDGVQG----LWKGL 168

Query: 182 ISTLIFRSNFVFWWGSYELIT-QWFQKN------TNLSAPAINFWAGGLSASFGFWTSAY 234
           +  L+  S     +  Y+ +  +   KN      TNL   A+   +  LS S     + Y
Sbjct: 169 VPALVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLSTS-----AVY 223

Query: 235 PSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXF 294
           P  ++K  +      +  FK    +   IY + G+ GF+KG   + LRS P        +
Sbjct: 224 PFQLLKSNLQSFQASENDFKLLPLS-KMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIY 282

Query: 295 E 295
           E
Sbjct: 283 E 283

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 82/186 (44%), Gaps = 33/186 (17%)

Query: 110 PLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNG 169
           PL   +ISG+ AG   + I  P++L K +LQ+   + T K  G  ++  ++    ++   
Sbjct: 7   PLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTTKK--GYRNLWSEIVGSDLSL-- 62

Query: 170 ILGGVRSLYKGLISTLIFRSNFVFW---WGSYELITQWF-------QKNTNLSAPAINFW 219
                R LY+GL   L+   N + W   + SY +   +        + + +LS+     W
Sbjct: 63  ----TRELYRGLTVNLV--GNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSS-----W 111

Query: 220 A-GGLSASFGFWTSAY--PSDVVKQVVLCNDKYD-GSFKSWRTAVSDIYRQRGIHGFFKG 275
                SAS G  T+    P  V+K  ++     D  S K  R    D+ +  G+ G +KG
Sbjct: 112 MYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLR----DLIKNDGVQGLWKG 167

Query: 276 FLPSFL 281
            +P+ +
Sbjct: 168 LVPALV 173

>Scas_705.9
          Length = 323

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/298 (18%), Positives = 116/298 (38%), Gaps = 36/298 (12%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAG---------IQFKGPLDCVY 58
           S +   + G  +    N + +P D  K  +Q+                 ++ +  + C+ 
Sbjct: 2   SNLESAITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLI 61

Query: 59  KTLKNQGIRGLYLGFTPPLFGWIMMD-------SALLGSLHNYRMLLHKYVYPEHDKLPL 111
           +  + +G+RGLY G +  +F   +         S L     + ++L +    P +    +
Sbjct: 62  RIFRKRGLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTV 121

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
              I+ GV A      +  P+E+   K Q   D     +     V+++++   + +NG L
Sbjct: 122 EELIV-GVGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYS---VLKQIY---VESNGKL 174

Query: 172 GGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT 231
               S +KG   +LI   N    + +Y+       K  + S  +   ++G L+ +  F  
Sbjct: 175 S---SYWKGFKVSLILTVNPSITFAAYQRFKDILLKQVSNSEKS---YSGQLTVNQNFIL 228

Query: 232 SAYP---SDVVKQVVLCN----DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
            A     S ++ Q ++       + +  FK +   +  +Y++ G+   +KG  P   +
Sbjct: 229 GALAKIISTIITQPLIVAKVSLQRSNSKFKHFEEVLRYLYKEEGVLALWKGVGPQLTK 286

>Scas_645.9
          Length = 391

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 106/275 (38%), Gaps = 31/275 (11%)

Query: 45  GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP 104
            + ++F G L+   K  K +GI  L+ G +  L   +M   A +     Y  L      P
Sbjct: 124 NSSVRFNGTLEAFNKIWKLEGITTLWRGISINL---LMAIPANIVYFTGYEYLRDNS--P 178

Query: 105 EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQG 164
                P    ++ G +A    +   AP+EL K KL  Q   + +K T    +V+++ K+ 
Sbjct: 179 LATSSPTFNPLMCGAIARILAASTVAPLELLKTKL--QSIPRVSKSTTSWMMVKELLKET 236

Query: 165 MATNGILGGVRSLYKGLISTLIFRSNF-VFWWGSYELITQWFQKNTNLSAPAINFW---- 219
                I G   +L+KGL  TL     F   +WGSYE        +T+ S   + F+    
Sbjct: 237 RQEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTSKSHSNLTFFINSF 296

Query: 220 -AGGLSASFGF------------WTSAYPSDVVKQVVLCND--KYDGSFKSWRTAVSDIY 264
             G +S +               W  ++  +  K VV   D  +    FK  R    +I+
Sbjct: 297 IGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLR----NIW 352

Query: 265 RQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           +  G    + G +P  ++  P        +E   R
Sbjct: 353 KLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKR 387

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%), Gaps = 8/74 (10%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP----LDCVYKTLKN-- 63
           +  F+ G  SG     V HPFD  K R Q S +G+      K P       ++K L+N  
Sbjct: 293 INSFIGGSISGTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIW 352

Query: 64  --QGIRGLYLGFTP 75
             +G   LY G  P
Sbjct: 353 KLEGWGALYTGLVP 366

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/301 (19%), Positives = 118/301 (39%), Gaps = 21/301 (6%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+AG  +G    TV  PF+ VK+ L   QV S      KG  D + +  K + I+GL+
Sbjct: 25  VAFLAGGIAGAISRTVVSPFERVKILL---QVQSSTTAYNKGLFDAIGQVYKEENIKGLF 81

Query: 71  LG---FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
            G       +F +  +   +      +  + H     + ++L     + SG + G     
Sbjct: 82  RGNGLNCIRVFPYSAVQFVVFEGCKKH--IFHVDTKGKGEQLNNWQRLFSGALCGGCSVV 139

Query: 128 IAAPVELAKAKLQVQY-------DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
              P++L + +L VQ         ++ +    P  V + + K      GI+G  R ++  
Sbjct: 140 ATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPT 199

Query: 181 LISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVV 239
            +  + + + NF  +    E +      N+++         G +S      T  YP D++
Sbjct: 200 SLGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVA-QTITYPFDLL 258

Query: 240 KQ----VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
           ++    + +  ++    + S   A+  I +  G  G++KG   +  +  P        +E
Sbjct: 259 RRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYE 318

Query: 296 F 296
            
Sbjct: 319 L 319

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 5/78 (6%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKT 60
           + +  Y   MG ++G   GVA+ T+ +PFD ++ R Q   +G    G  +    D +   
Sbjct: 231 MRDSLYKLSMGAISG---GVAQ-TITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTI 286

Query: 61  LKNQGIRGLYLGFTPPLF 78
            K +G +G Y G T  LF
Sbjct: 287 GKTEGFKGYYKGLTANLF 304

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 6/95 (6%)

Query: 201 ITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAV 260
           +  + +++TN++     F AGG++ +    T   P + VK ++          K    A+
Sbjct: 15  LKNFLKQDTNVA-----FLAGGIAGAISR-TVVSPFERVKILLQVQSSTTAYNKGLFDAI 68

Query: 261 SDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
             +Y++  I G F+G   + +R FP        FE
Sbjct: 69  GQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFE 103

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 113/293 (38%), Gaps = 33/293 (11%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           S E       FVAG  +G  +  V +PF+  K RLQ +Q GSG   + + PL  +Y+T +
Sbjct: 4   SREGADAARSFVAGAAAGAIEGCVTYPFEFAKTRLQLAQQGSG---ESRNPLVLLYRTAR 60

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAG 122
            QG   LY+G   P F  ++ ++   G        L + +  E   L     +++G+ AG
Sbjct: 61  TQGAGALYVGC--PAF--VVGNTCKAGVRFLGFDALRRALQDERGALSGPRGMLAGLGAG 116

Query: 123 WTVSFIA-APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATN-----GILGGVRS 176
              S +A  P E  K  L     A   +Y        +   +G A N       LG    
Sbjct: 117 LLESVLAVTPFEAVKTALIDDRQAARPRY--------QHNGRGAARNYALLLRELGLRGL 168

Query: 177 LYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSA-----PAINFWAGGLSASFGFWT 231
               +   L   SN    +G Y  + Q  Q+     A         F  G LS     + 
Sbjct: 169 YGGLVPVALRQASNQAVRFGCYTQLKQAVQRYAGTPADQPLGSGQTFLVGALSGIVTVYA 228

Query: 232 SAYPSDVVKQVVLCND--KYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           +  P D VK  +   D  +Y  +   +R  V    R+ G+   ++G  P   R
Sbjct: 229 T-MPVDTVKTRMQALDAARYGSTVGCFRAVV----REEGVRALWRGATPRLGR 276

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 67/322 (20%), Positives = 121/322 (37%), Gaps = 55/322 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV------RLQTSQVGSGAGIQFKGP-----------LD 55
           F+AG  SGV   T   PFD +KV       L ++ + S   +  K P           + 
Sbjct: 204 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVK 263

Query: 56  CVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK-LPLSGC 114
            +    +  GI+  Y+G            S   GS    + L+ K    +  K L     
Sbjct: 264 AIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLST 323

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL--- 171
            I+G +AG    F   P++  K ++Q            P++   K  K  + T   +   
Sbjct: 324 FIAGGLAGVCAQFSVYPIDTLKFRMQC----------APLNAELKGRKLMIQTAKEMYTE 373

Query: 172 GGVRSLYKGL-ISTLIFRSNFVFWWGSYELITQWF-----------QKNTNLSAPAINFW 219
           GG++  Y+G+ +  L          G++ ++ +W+           +++  LS   +   
Sbjct: 374 GGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVV-LP 432

Query: 220 AGGLSASFGFWTSAYPSDVVKQVVLCND------KYDGSFKSWRTAVSDIYRQRGIHGFF 273
            G  S +FG  T  YP ++++  +          +YDG    +R  +    ++ G  G F
Sbjct: 433 MGAFSGTFG-ATVVYPINLLRTRLQAQGTFAHPYRYDG----FRDVLLKTIQREGYPGLF 487

Query: 274 KGFLPSFLRSFPXXXXXXXXFE 295
           KG +P+  +  P        +E
Sbjct: 488 KGLVPTLAKVCPAVSISYLCYE 509

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 83/191 (43%), Gaps = 28/191 (14%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQ 64
           S++  F+AG  +GV      +P DT+K R+Q + + +    + KG    +    +     
Sbjct: 319 SKLSTFIAGGLAGVCAQFSVYPIDTLKFRMQCAPLNA----ELKGRKLMIQTAKEMYTEG 374

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKL-------PLSGCII- 116
           G++  Y G T  + G     +  LG+   + ML   Y+  +  KL        LS  ++ 
Sbjct: 375 GLKLFYRGVTVGVLGIFPYAALDLGT---FSMLKKWYISSKAKKLNKKEEDVELSNLVVL 431

Query: 117 -SGVMAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
             G  +G   + +  P+ L + +LQ Q   A   +Y G  DV+ K  ++         G 
Sbjct: 432 PMGAFSGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQR--------EGY 483

Query: 175 RSLYKGLISTL 185
             L+KGL+ TL
Sbjct: 484 PGLFKGLVPTL 494

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 80/194 (41%), Gaps = 24/194 (12%)

Query: 113 GCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQK-----------VF 161
           G  I+G ++G       AP +  K  L  + D  +T      DV+ K             
Sbjct: 202 GFFIAGGISGVISRTCTAPFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPL 261

Query: 162 KQGMATNGILGGVRSLY--KGLISTLIFRSNFVFWWGSYELITQWFQKNTNLS-----AP 214
            + + +    GG++S Y   GL +  +F  + +  +GS+E+  +   K  N       + 
Sbjct: 262 VKAIISLYRQGGIKSFYVGNGLNALKVFPESSI-KFGSFEITKKLMTKVENCKDTKDLSK 320

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLC---NDKYDGSFKSWRTAVSDIYRQRGIHG 271
              F AGGL+     + S YP D +K  + C   N +  G     +TA  ++Y + G+  
Sbjct: 321 LSTFIAGGLAGVCAQF-SVYPIDTLKFRMQCAPLNAELKGRKLMIQTA-KEMYTEGGLKL 378

Query: 272 FFKGFLPSFLRSFP 285
           F++G     L  FP
Sbjct: 379 FYRGVTVGVLGIFP 392

>Scas_578.3*
          Length = 524

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 63/306 (20%), Positives = 124/306 (40%), Gaps = 45/306 (14%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV------RLQTSQVGSGAGIQFKG--------PLDCVY 58
           F+AG  SGV   T   P D +KV       L ++ +     ++ +G        P+    
Sbjct: 212 FIAGGLSGVISRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSPIIKAI 271

Query: 59  KTLKNQG-IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKL--PLSG-- 113
           ++L  QG +R  Y+G    +F      S   G+    + L+        DKL   LS   
Sbjct: 272 RSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANL---SGDKLVNDLSKLQ 328

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGILG 172
             ++G +AG        P++  K ++Q    +         I   ++++K+G        
Sbjct: 329 TYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEGNLKGNALLISTAKEMYKEG-------- 380

Query: 173 GVRSLYKG-LISTLIFRSNFVFWWGSYELITQWF--QKNTNLSAPAINFW--------AG 221
           G+R  Y+G L+  L          G++  + +W+  +++  L+ P  +           G
Sbjct: 381 GIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLPMG 440

Query: 222 GLSASFGFWTSAYPSDVVKQVVLCNDKYDG--SFKSWRTAVSDIYRQRGIHGFFKGFLPS 279
             S + G  T+ YP ++++  +     Y    ++  +R       ++ G+ GF+KG +P+
Sbjct: 441 AFSGTVG-ATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYKGLVPT 499

Query: 280 FLRSFP 285
            ++  P
Sbjct: 500 LVKVCP 505

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 80/190 (42%), Gaps = 24/190 (12%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQ 64
           S++  +VAG  +GV      +P DT+K R+Q + +        KG    +    +  K  
Sbjct: 325 SKLQTYVAGGIAGVMAQISIYPIDTLKFRIQCAPLEG----NLKGNALLISTAKEMYKEG 380

Query: 65  GIRGLYLGF---TPPLFGWIMMDSALLGSLHNY--RMLLHKYVYPEHDKLPLSGCII--S 117
           GIR  Y G       +F +  +D     +L  +  +    K   PE D + LS  ++   
Sbjct: 381 GIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVM-LSYLLVLPM 439

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
           G  +G   +    P+ L + +LQ Q   A    YTG  DV  +  K+         GV  
Sbjct: 440 GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKR--------EGVPG 491

Query: 177 LYKGLISTLI 186
            YKGL+ TL+
Sbjct: 492 FYKGLVPTLV 501

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/328 (20%), Positives = 122/328 (37%), Gaps = 59/328 (17%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV------RLQTSQVGSGAGI----------QFKGPLDC 56
           F+AG  SGV   T   PFD +KV       L ++ + S   +          + K PL  
Sbjct: 203 FIAGGCSGVVSRTCTAPFDRIKVFLIARTDLSSTLLNSKDTLLAKNPNADLSKIKSPLIK 262

Query: 57  VYKTLKNQ-GIRGLYLG----------FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE 105
              TL  Q G+R  Y+G           +   FG   M   ++  L N +         +
Sbjct: 263 AATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVK---------D 313

Query: 106 HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQG 164
             +L      I+G + G    F   P++  K ++Q    +    K +  +   +++++Q 
Sbjct: 314 TSELSRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQ- 372

Query: 165 MATNGILGGVRSLYKGL-ISTLIFRSNFVFWWGSYELITQWF----QKNTNLSAPA---- 215
                  GG+R  Y+G+ I  +          G++  + +W+     K T L        
Sbjct: 373 -------GGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVIIS 425

Query: 216 --INFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWRTAVSDIYRQRGIHG 271
             I    G  S + G  T  YP ++++  +     Y    ++  +   +    ++ G  G
Sbjct: 426 NLIVLPMGAFSGTVG-ATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQG 484

Query: 272 FFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
            FKG +P+  +  P        +E + R
Sbjct: 485 LFKGLVPNLAKVCPAVSISYLCYENLKR 512

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 84/193 (43%), Gaps = 32/193 (16%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG-- 65
           SR+  ++AG   GVA     +P DT+K R+Q + + +   ++    L    K +  QG  
Sbjct: 318 SRLSTYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNT--NLKKSSILLQTAKEMYQQGGI 375

Query: 66  ---IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK--LPLSGCIIS--- 117
               RG+++G    +F +  +D     +L  +      Y+  E  K  LP    IIS   
Sbjct: 376 RLFYRGVHIGVM-GIFPYAALDLGTFSALKKW------YIKKEAKKTGLPEDEVIISNLI 428

Query: 118 ----GVMAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILG 172
               G  +G   + +  P+ L + +LQ Q   A    Y G  DV++K  ++         
Sbjct: 429 VLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQR--------E 480

Query: 173 GVRSLYKGLISTL 185
           G + L+KGL+  L
Sbjct: 481 GYQGLFKGLVPNL 493

 Score = 35.0 bits (79), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
            E   S ++    G FSG    T+ +P + ++ RLQ +Q        + G  D + KT++
Sbjct: 420 DEVIISNLIVLPMGAFSGTVGATLVYPINLLRTRLQ-AQGTYAHPHTYNGFSDVLKKTIQ 478

Query: 63  NQGIRGLYLGFTPPL 77
            +G +GL+ G  P L
Sbjct: 479 REGYQGLFKGLVPNL 493

>Scas_717.20
          Length = 356

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 67/327 (20%), Positives = 125/327 (38%), Gaps = 60/327 (18%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQ------VGSGAGIQFKGPLDCVYKTLKNQGIR 67
           +AG  SG    T+  P D +K+  QTS        GS  G++     +       N GIR
Sbjct: 37  LAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLK-----EAAKHIWLNDGIR 91

Query: 68  GLYLGFTPPL---FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124
           G + G +  L   F +  +       + N   L+    Y  H +      ++SG +AG  
Sbjct: 92  GFFQGHSVTLMRIFPYAAVKFVAYEQIRN--TLIPSKEYESHWRR-----LMSGSLAGLC 144

Query: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV--------RS 176
             F   P++L + +L    + K     G   +V+ ++K+  +T     G          +
Sbjct: 145 SVFTTYPLDLIRVRLAYVTEHKRISLLG---LVKTIYKEPASTTLEAKGYIPNWFAHWCN 201

Query: 177 LYKGLISTLI----------FRSNFVFWWGSYELI----------TQWFQKNTNLSAPAI 216
            Y+G   T++          F  + +     + ++          ++  +++       +
Sbjct: 202 FYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEERHFKHQRLPL 261

Query: 217 NFWAGGLS---ASFGFWTSAYPSDVVKQ-----VVLCNDKYDGSFKSWRTAVSDIYRQRG 268
             WA  LS   A     T+AYP +++++      +  +  YD  F+S       IY++RG
Sbjct: 262 RTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERG 321

Query: 269 IHGFFKGFLPSFLRSFPXXXXXXXXFE 295
             GFF G    +++  P        +E
Sbjct: 322 WRGFFVGLSIGYIKVTPMVACSFFVYE 348

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 77/194 (39%), Gaps = 38/194 (19%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYK--- 59
           S+E  S     ++G  +G+      +P D ++VRL  + V     I   G +  +YK   
Sbjct: 125 SKEYESHWRRLMSGSLAGLCSVFTTYPLDLIRVRL--AYVTEHKRISLLGLVKTIYKEPA 182

Query: 60  --TLKNQGI--------RGLYLGFTPPLFGWIMMDSALLGS---LHNYRMLLHKYVYP-- 104
             TL+ +G            Y G+TP + G I        +   LH+  +L H  + P  
Sbjct: 183 STTLEAKGYIPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHD--VLKHPILAPYS 240

Query: 105 --------------EHDKLPLS--GCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTT 148
                         +H +LPL     ++SG +AG      A P E+ + +LQV   + + 
Sbjct: 241 VLALSESEQEERHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQ 300

Query: 149 KYTGPIDVVQKVFK 162
            Y      + ++ K
Sbjct: 301 MYDHRFQSISEIAK 314

 Score = 35.4 bits (80), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 220 AGGLSASFGFWTSAYPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
           AGG+S S    T   P D +K +   ++    KY GS    + A   I+   GI GFF+G
Sbjct: 38  AGGISGSCA-KTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQG 96

Query: 276 FLPSFLRSFPXXXXXXXXFEFVLRT 300
              + +R FP        +E +  T
Sbjct: 97  HSVTLMRIFPYAAVKFVAYEQIRNT 121

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTS--QVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
            ++G  +G+A  T  +PF+ ++ RLQ S   V      +F+   +      K +G RG +
Sbjct: 267 LLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHRFQSISEIAKIIYKERGWRGFF 326

Query: 71  LGFT 74
           +G +
Sbjct: 327 VGLS 330

>Scas_582.7
          Length = 329

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/298 (20%), Positives = 115/298 (38%), Gaps = 40/298 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG F+G+ +++   P D +K R+Q S    G        +  + K    +G   L+ G
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQ-STTTKGTEQTSTSIIKQISKISTMEGSLALWKG 98

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLS--------GCIISGVMAGWT 124
                     + S +LG+   + +    Y + +   +P S           +SG  A   
Sbjct: 99  ----------VQSVILGAGPAHAVYFATYEFTKAHLIPDSQRETHQPIKVAVSGATATVA 148

Query: 125 VSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIST 184
             F   P +  K ++Q+    K   Y    +V +K++         L G+ + Y    +T
Sbjct: 149 SDFFMNPFDTIKQRMQISDLKKEKVY----NVAKKIYN--------LEGLSAFYYSYPTT 196

Query: 185 LIFRSNF-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVV 243
           +     F  F +  YE  +++F    + + P I+   GG+S +     +  P D +K V+
Sbjct: 197 IAMNIPFAAFNFMIYESASKFFNPLHHYN-PLIHCLCGGISGAIAAAVTT-PLDCIKTVI 254

Query: 244 LCNDKYDGSFK------SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
                   S +      +++ A S I    G  GF++G  P  L + P        +E
Sbjct: 255 QIRGSSVVSLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYE 312

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 77/177 (43%), Gaps = 34/177 (19%)

Query: 4   EETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN 63
            ET+  +   V+G  + VA +   +PFDT+K R+Q S +        K  +  V K + N
Sbjct: 130 RETHQPIKVAVSGATATVASDFFMNPFDTIKQRMQISDLK-------KEKVYNVAKKIYN 182

Query: 64  -QGIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC 114
            +G+   Y  +   +        F +++ +SA             K+  P H   PL  C
Sbjct: 183 LEGLSAFYYSYPTTIAMNIPFAAFNFMIYESA------------SKFFNPLHHYNPLIHC 230

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           +  G+ +G   + +  P++  K  +Q++  +  +     ++V++K      AT+ IL
Sbjct: 231 LCGGI-SGAIAAAVTTPLDCIKTVIQIRGSSVVS-----LEVMKKANTFKKATSAIL 281

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 90/215 (41%), Gaps = 37/215 (17%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           +T+  +   ++G  + +A + + +PFDTVK RLQ         ++       +Y   +N+
Sbjct: 116 QTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLD-----TNLRVWNVTKQIY---QNE 167

Query: 65  GIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCII 116
           G    Y  +   L        F +++ +SA             K+  P++   PL  C+ 
Sbjct: 168 GFAAFYYSYPTTLAMNIPFAAFNFMIYESA------------SKFFNPQNSYNPLIHCLC 215

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILG--GV 174
            G+ +G T + +  P++  K  LQV+        T  I++++     G A+  IL   G 
Sbjct: 216 GGI-SGATCAALTTPLDCIKTVLQVR-----GSETVSIEIMKDANTFGRASRAILEVHGW 269

Query: 175 RSLYKGLISTLIFR-SNFVFWWGSYELITQWFQKN 208
           +  ++GL   ++         W +YE    +  KN
Sbjct: 270 KGFWRGLKPRIVANIPATAISWTAYECAKHFLMKN 304

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/293 (20%), Positives = 116/293 (39%), Gaps = 34/293 (11%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG F+G+ ++++  P D +K R+Q + +   A     G +  + K    +G   L+ G
Sbjct: 27  LLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAAS---TGMISQISKISTMEGSMALWKG 83

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE--HDKLPLSGCIISGVMAGWTVSFIAA 130
               + G     +   G+   Y     + + PE      P+    +SG +A      +  
Sbjct: 84  VQSVILGAGPAHAVYFGT---YEFCKARLISPEDMQTHQPMKTA-LSGTIATIAADALMN 139

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190
           P +  K +LQ+  + +        +V +++++          G  + Y    +TL     
Sbjct: 140 PFDTVKQRLQLDTNLRV------WNVTKQIYQN--------EGFAAFYYSYPTTLAMNIP 185

Query: 191 F-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLS-ASFGFWTSAYPSDVVKQVVLCNDK 248
           F  F +  YE  +++F    + + P I+   GG+S A+    T+  P D +K V+     
Sbjct: 186 FAAFNFMIYESASKFFNPQNSYN-PLIHCLCGGISGATCAALTT--PLDCIKTVLQVRGS 242

Query: 249 YDGSFKSWRTAVS------DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFE 295
              S +  + A +       I    G  GF++G  P  + + P        +E
Sbjct: 243 ETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYE 295

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 65/306 (21%), Positives = 118/306 (38%), Gaps = 50/306 (16%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPL-DCVYKTLKN-------- 63
            +AG F+G+A+++V  P D +K RLQ     S  G Q   P+   + + L +        
Sbjct: 22  LMAGAFAGIAEHSVIFPLDALKTRLQAMHAISTTGGQ---PIPSTMLRQLSSISAQEGSM 78

Query: 64  ---QGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVM 120
              +G++ + LG  P    +      +   L +      KY + +           SG  
Sbjct: 79  VLWKGVQSVLLGAGPAHAVYFATYEMVKSFLIDEATSTSKYHFFK--------TAFSGAT 130

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           A      +  P ++ K ++Q+  +          D  ++++ +         G ++ Y  
Sbjct: 131 ATIAADALMNPFDVIKQRIQLNTNISV------WDTAKRIYSKE--------GFQAFYSS 176

Query: 181 LISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINFWAGGLS--ASFGFWTSAYPSD 237
             +TL     F  F +G Y+  T++F   + +  P I+   GG+S  A  G  T   P D
Sbjct: 177 YPTTLAINIPFAAFNFGIYDTATRYFNP-SGVYNPFIHCLCGGISGAACAGLTT---PLD 232

Query: 238 VVKQVVLCNDKYDGSFK------SWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXX 291
            +K  +        S +      +++ A   IY+  G  GF+ G  P  L + P      
Sbjct: 233 CIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISW 292

Query: 292 XXFEFV 297
             +EF 
Sbjct: 293 TAYEFA 298

 Score = 37.4 bits (85), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 77/183 (42%), Gaps = 14/183 (7%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA 166
           D  PL+  +++G  AG     +  P++  K +LQ  +   T   TG   +   + +Q ++
Sbjct: 14  DHAPLAHQLMAGAFAGIAEHSVIFPLDALKTRLQAMHAIST---TGGQPIPSTMLRQ-LS 69

Query: 167 TNGILGGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAINFWA---GG 222
           +     G   L+KG+ S L+        ++ +YE++   F  +   S    +F+     G
Sbjct: 70  SISAQEGSMVLWKGVQSVLLGAGPAHAVYFATYEMVKS-FLIDEATSTSKYHFFKTAFSG 128

Query: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
            +A+        P DV+KQ +  N     +   W TA   IY + G   F+  +  +   
Sbjct: 129 ATATIAADALMNPFDVIKQRIQLNT----NISVWDTA-KRIYSKEGFQAFYSSYPTTLAI 183

Query: 283 SFP 285
           + P
Sbjct: 184 NIP 186

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/191 (20%), Positives = 71/191 (37%), Gaps = 45/191 (23%)

Query: 1   MVSEETYSRVMGFVAGMFSG----VAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDC 56
           ++ E T +    F    FSG    +A + + +PFD +K R+Q +   S          D 
Sbjct: 109 LIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNIS--------VWDT 160

Query: 57  VYKTLKNQGIRGLYLGFTPPL--------FGWIMMDSALLGSLHNYRMLLHKYVYPEHDK 108
             +    +G +  Y  +   L        F + + D+A             +Y  P    
Sbjct: 161 AKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTAT------------RYFNPSGVY 208

Query: 109 LPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATN 168
            P   C+  G+ +G   + +  P++  K  LQV+         G   V  +VFKQ    +
Sbjct: 209 NPFIHCLCGGI-SGAACAGLTTPLDCIKTALQVR---------GSEKVSMEVFKQA---D 255

Query: 169 GILGGVRSLYK 179
                 R++Y+
Sbjct: 256 TFKKATRAIYQ 266

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 87/189 (46%), Gaps = 24/189 (12%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ--- 64
           S+   ++AG  +G+A     +P DT+K R+Q + + +    + KG  + +++T K+    
Sbjct: 346 SKFSTYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDT----KLKGN-NLLFQTAKDMFRE 400

Query: 65  -GIRGLYLGFTPPLFG---WIMMDSALLGSLHN-YRMLLHKYVYPEHDKLPLSGCII--S 117
            G+R  Y G T  + G   +  +D     +L   Y     K +    D++ LS  ++   
Sbjct: 401 GGLRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPM 460

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
           G  +G   + +  P+ L + +LQ Q   A    Y G  DV+ K  ++         G + 
Sbjct: 461 GAFSGTVGASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLER--------EGYQG 512

Query: 177 LYKGLISTL 185
           L+KGL+ TL
Sbjct: 513 LFKGLVPTL 521

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/315 (20%), Positives = 114/315 (36%), Gaps = 41/315 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV----RLQTSQV-----------GSGAGI-QFKGPLDC 56
           F+AG  SGV   T   PFD +KV    R   S +              A I +   PL  
Sbjct: 231 FIAGGISGVISRTCTAPFDRLKVFLIARTDLSSILLNSKTDLLAKNPNADINKISSPLAK 290

Query: 57  VYKTLKNQ-GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK-LPLSGC 114
             K+L  Q GI+  Y+G    +       S   GS    + ++ K       K L     
Sbjct: 291 AVKSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFEVTKKIMTKLEGCRDTKDLSKFST 350

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
            I+G +AG    F   P++  K ++Q    D K           + +F++        GG
Sbjct: 351 YIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFRE--------GG 402

Query: 174 VRSLYKGLISTLI-FRSNFVFWWGSYELITQWF----QKNTNLSAPAINFW------AGG 222
           +R  Y+G+   ++          G++  + +W+     K  NL    +          G 
Sbjct: 403 LRLFYRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVTLSNLVVLPMGA 462

Query: 223 LSASFGFWTSAYPSDVVKQVVLCNDKYDGS--FKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
            S + G  +  YP ++++  +     Y     +  ++  +     + G  G FKG +P+ 
Sbjct: 463 FSGTVG-ASVVYPINLLRTRLQAQGTYAHPYVYNGFKDVLLKTLEREGYQGLFKGLVPTL 521

Query: 281 LRSFPXXXXXXXXFE 295
            +  P        +E
Sbjct: 522 AKVCPAVSISYLCYE 536

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 6   TYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65
           T S ++    G FSG    +V +P + ++ RLQ +Q        + G  D + KTL+ +G
Sbjct: 451 TLSNLVVLPMGAFSGTVGASVVYPINLLRTRLQ-AQGTYAHPYVYNGFKDVLLKTLEREG 509

Query: 66  IRGLYLGFTPPL 77
            +GL+ G  P L
Sbjct: 510 YQGLFKGLVPTL 521

>Scas_702.10
          Length = 302

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 127/292 (43%), Gaps = 54/292 (18%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKT-LKNQGIRGLY 70
           G  AG+F+ V    + HP D  KVRLQ + +        K  L  +  T L+N+ + GLY
Sbjct: 16  GGAAGIFACV----MTHPLDLAKVRLQAAPLP-------KPTLGRMLTTILRNENVMGLY 64

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE---HDKLPLSGC-IISGVMAGWTVS 126
            G +  +       +   G+      L+ + + P+   +D + L  C + SG + G   +
Sbjct: 65  SGLSAAVLRQCTYTTVRFGAYD----LMKENLIPQGHINDMVYLLPCSMFSGAIGGLVGN 120

Query: 127 FIAAPVELAKAKLQVQYDAKTT---KYTGPIDVVQKVFKQGMATNGILGGVRSLYKG--- 180
           F     ++   ++Q     K      Y   ID V K++          GG+++L  G   
Sbjct: 121 F----ADVVNIRMQNDSALKPELRRNYRNAIDGVYKIYMHE-------GGIKTLLTGWKP 169

Query: 181 -LISTLIFRSNFVFWWGSYE--LITQWF----QKNTNLSAPAINFWAGGLSASFGFWTSA 233
            ++  ++  ++ V  +  ++  L+T+      + +T+LSA  +     GL A+    T  
Sbjct: 170 NMVRGVLMTASQVVTYDVFKNYLVTKLSFDPKKNSTHLSASLL----AGLVAT----TIC 221

Query: 234 YPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
            P+DV+K  ++   K +   +S    ++   ++ G    F+G+LP F R  P
Sbjct: 222 SPADVIKTRIMNAHKTES--ESAIKILTSAIKKEGPSFMFRGWLPIFTRLGP 271

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/276 (23%), Positives = 106/276 (38%), Gaps = 38/276 (13%)

Query: 49  QFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK 108
           +F G L+   K  K +G+  L+ G +  L   I  +              ++YV    D+
Sbjct: 109 KFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTG--------YEYV---RDR 157

Query: 109 LPLSGC------IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFK 162
            PL+G       +I G  A    +   AP+EL K KL  Q    ++   G + + + +F 
Sbjct: 158 SPLNGLYPTINPLICGAFARTLAATSVAPLELIKTKL--QSIPSSSMKNGSVIMYRDLFN 215

Query: 163 QGMATNGILGGVRSLYKGLISTLIFRSNF-VFWWGSYE--------LITQWFQKNTNLSA 213
           +  +   + G  ++++KGL  TL     F   +W SYE        L    F KN++   
Sbjct: 216 EIKSEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWF 275

Query: 214 PAINFWAGGLSASFGFWTSAYPSDVVK---QVVLCNDKYD-------GSFKSWRTAVSDI 263
              N + GG  +        +P DV K   Q+ L  DK         GS  +    ++ I
Sbjct: 276 HFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYI 335

Query: 264 YRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
            +  GI   + G  P   +  P        +E   R
Sbjct: 336 RKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKR 371

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 29/74 (39%), Gaps = 13/74 (17%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGS----------GAGIQFKGPLDCVYKTL 61
            F+ G  SG       HPFD  K R Q S V            G+     G L+ + KT 
Sbjct: 280 SFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKT- 338

Query: 62  KNQGIRGLYLGFTP 75
             +GI  LY G  P
Sbjct: 339 --EGIGALYTGLAP 350

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 45/317 (14%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV------RLQTSQVGSGAGI----------QFKGPLDC 56
           F+AG  SGV   T   PFD +KV       L ++ + S   +          + K PL  
Sbjct: 199 FIAGGCSGVISRTCTAPFDRIKVFLIARTDLSSTLLNSKDKVLMKNPNADISKIKSPLIK 258

Query: 57  VYKTLKNQ-GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEH-DKLPLSGC 114
              TL  Q GIR  Y+G    +       +   GS    + L+       H  +L     
Sbjct: 259 AATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMAHLEGVHHTSELSKFST 318

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL--- 171
            I+G M G    F   P++  K ++Q            P+D   K  +  ++T   +   
Sbjct: 319 YIAGGMGGVVAQFSVYPIDTLKYRVQC----------APLDTALKGNELLISTARQMYRD 368

Query: 172 GGVRSLYKGL-ISTLIFRSNFVFWWGSYELITQWF----QKNTNLSAPAI---NFWA--- 220
           GG++  Y+G+ +  +          G++  + +W+     K T +    +   NF     
Sbjct: 369 GGLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPM 428

Query: 221 GGLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
           G  S + G  T  YP ++++  +     Y    ++  +R  +    ++ G  G FKG +P
Sbjct: 429 GAFSGTVG-ATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVP 487

Query: 279 SFLRSFPXXXXXXXXFE 295
           +  +  P        +E
Sbjct: 488 NLAKVCPAVSISYLCYE 504

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 2   VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL 61
           V + T S  +    G FSG    TV +P + ++ RLQ +Q        + G  D ++KT+
Sbjct: 415 VDQVTISNFIVLPMGAFSGTVGATVVYPINLLRTRLQ-AQGTYAHPHTYTGFRDVLWKTV 473

Query: 62  KNQGIRGLYLGFTPPL 77
           + +G +GL+ G  P L
Sbjct: 474 QREGYQGLFKGLVPNL 489

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 80/188 (42%), Gaps = 22/188 (11%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQ 64
           S+   ++AG   GV      +P DT+K R+Q + + +      KG    +    +  ++ 
Sbjct: 314 SKFSTYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTA----LKGNELLISTARQMYRDG 369

Query: 65  GIRGLYLGFTPPLFG---WIMMDSALLGSLHN-YRMLLHKYVYPEHDKLPLSGCII--SG 118
           G++  Y G T  + G   +  +D     +L   Y     K      D++ +S  I+   G
Sbjct: 370 GLKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYIARQAKMTGVPVDQVTISNFIVLPMG 429

Query: 119 VMAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILGGVRSL 177
             +G   + +  P+ L + +LQ Q   A    YTG  DV+ K  ++         G + L
Sbjct: 430 AFSGTVGATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQR--------EGYQGL 481

Query: 178 YKGLISTL 185
           +KGL+  L
Sbjct: 482 FKGLVPNL 489

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
           S    F  G+FS  A   +  P D VK R+Q+    S     ++  L+CVY+T   +G+ 
Sbjct: 245 SEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWS----LYRNSLNCVYRTFIEEGLT 300

Query: 68  GLYLGFTPPLF 78
            L+ G+ P LF
Sbjct: 301 SLWKGWVPRLF 311

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 59/141 (41%), Gaps = 8/141 (5%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           E  S +   VAG  SG+   +V  P DTVK+R Q  Q+ S    ++ G L       + +
Sbjct: 20  EAVSGLHAVVAGSVSGLVARSVTAPMDTVKIRRQL-QLASEH--KYHGILHTFRTVAREE 76

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWT 124
           G+R L+ G  P    +++  S   G+             P     P +  +  G +AG  
Sbjct: 77  GVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLP-----PQAHSLAVGALAGLV 131

Query: 125 VSFIAAPVELAKAKLQVQYDA 145
            S +  P++L + +L     A
Sbjct: 132 SSLLTYPLDLLRTRLVANRSA 152

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 69/165 (41%), Gaps = 18/165 (10%)

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGG 173
            +++G ++G     + AP++  K + Q+Q  A   KY G +   + V ++         G
Sbjct: 27  AVVAGSVSGLVARSVTAPMDTVKIRRQLQL-ASEHKYHGILHTFRTVARE--------EG 77

Query: 174 VRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSA---PAINFWAGGLSASFGFW 230
           VR+L+KG +      S     +GS +  T  +      SA   P  +  A G  A     
Sbjct: 78  VRALWKGNVPA----SAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAVGALAGLVSS 133

Query: 231 TSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
              YP D+++  ++ N      F S R     I+   G  GFF+G
Sbjct: 134 LLTYPLDLLRTRLVANR--SAHFFSLRRQARVIWDTEGPAGFFRG 176

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 123/311 (39%), Gaps = 70/311 (22%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR-GLYLG 72
           V+G   G   ++  H  DTVK R Q    G+    +++  +         +G+R GLY G
Sbjct: 58  VSGGIGGKIGDSAMHSLDTVKTRQQ----GAPNVKKYRNMISAYRTIWLEEGVRRGLYGG 113

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLP---LSGCII---SGVMAGWTVS 126
           +           +A+LGS  +  +    Y Y +   +    ++  I    +G +  +  S
Sbjct: 114 YM----------AAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISS 163

Query: 127 FIAAPVELAKAKLQVQ------YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
           F+  P E+ K +LQ+Q      +      Y+   + ++ V K+         G RSL+ G
Sbjct: 164 FVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEE--------GFRSLFFG 215

Query: 181 LISTLI----FRS-NFVFWWGSYEL---ITQWFQKNTNLSAPA---INFWAGGLSASFGF 229
             +TL     F +  F F+    +L   I Q   ++  LS P        AGGL+   G 
Sbjct: 216 YKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLA---GI 272

Query: 230 WTSAYPSDVVKQVVLCNDKYDGSFKSWRT-------------------AVSDIYRQRGIH 270
            T+  P DVVK  V        S KS+                     ++  +Y+  G+ 
Sbjct: 273 ITT--PMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVL 330

Query: 271 GFFKGFLPSFL 281
           GFF G  P F+
Sbjct: 331 GFFSGVGPRFV 341

>Kwal_26.7972
          Length = 358

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 125/313 (39%), Gaps = 54/313 (17%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQ------VGSGAGIQFKGPLDCVYKTLKNQGIR 67
           +AG  +G    T+  P D +K+  QTS        GS  G+   G          + GIR
Sbjct: 32  LAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGLIRAGA-----HINAHDGIR 86

Query: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
           G Y G +  L   I   +A+      Y  + H ++ P  +    +  + SG MAG    F
Sbjct: 87  GFYQGHSATLI-RIFPYAAI--KFIAYEQIRH-FMIPSKEYETHARRLASGSMAGLCSVF 142

Query: 128 IAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMA--------------------- 166
           +  P++L + +L    D    K    + V+++++ +  +                     
Sbjct: 143 MTYPLDLIRVRLAYVTDRSRIKM---LPVIKQIYTERASESLTSKSYVPRWFAHWCNFYR 199

Query: 167 --TNGILGGVR----SLYKGLISTLIFRSNFVFWWGSYELITQWFQ-KNTNLSAPAINFW 219
             T  +LG +     S +   +   I RS  +  +    +  +    ++   S+  +  W
Sbjct: 200 GFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPISDEELTIRSKKQSSRPLKTW 259

Query: 220 ----AGGLSASFGFWTSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGF 272
               AGGL A     T++YP ++++   QV + +     +F++    +  IY++RG  GF
Sbjct: 260 AELVAGGL-AGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGF 318

Query: 273 FKGFLPSFLRSFP 285
           F G    +++  P
Sbjct: 319 FVGLSIGYIKVTP 331

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            VAG  +G+A  T  +PF+ ++ RLQ S V   +   F+   D +    K +G RG ++G
Sbjct: 262 LVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNFQTIPDMIRIIYKERGWRGFFVG 321

Query: 73  FT 74
            +
Sbjct: 322 LS 323

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/321 (21%), Positives = 118/321 (36%), Gaps = 72/321 (22%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTS-------------------------------QV 42
           ++G  +    NTV +P D VK  +QT                                ++
Sbjct: 8   LSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPIKL 67

Query: 43  GSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPL-------FGWIMMDSALLGSLHNYR 95
                +Q+    D +YK  K +GIRGLY G T  +       F +    S +       +
Sbjct: 68  NENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFRVK 127

Query: 96  MLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQ--YDAKTTKYTGP 153
           ++  K     + K      ++ G++A  T      P+ L  A+ Q +   D      T  
Sbjct: 128 LINRK-----NTKFTTIEELLLGIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLT-- 180

Query: 154 IDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYE-LITQWFQKNT-NL 211
             V ++++K+  +  G        +KGL  +L+   N    + SYE L    F  +T NL
Sbjct: 181 --VAKEIYKEQRSIKG-------FWKGLKVSLMLTINPSITYTSYEKLKDALFTTDTMNL 231

Query: 212 S----------APAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVS 261
                      +P  NF  G LS       +  P  + K  +  N     +F S++  + 
Sbjct: 232 KKELVDSSSQLSPYQNFTLGVLSKMISAIITM-PLIISKAWLQRN---GSNFSSFQQVLY 287

Query: 262 DIYRQRGIHGFFKGFLPSFLR 282
            +Y+  G+  ++KG  P   +
Sbjct: 288 YLYKNEGLRSWWKGLSPQLAK 308

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 104/245 (42%), Gaps = 31/245 (12%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYL 71
           F+AG   G+  ++  H  DTVK R    Q G+    ++K  L         +G  RGLY 
Sbjct: 57  FLAGGVGGIIGDSAMHSLDTVKTR----QQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYG 112

Query: 72  GFTPPLFGWIMMDSALLGSLHNY--RMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA 129
           G+   + G     +A+  S + +  R +++ Y    H     S  + +G +  +  SF+ 
Sbjct: 113 GYCAAMLGS-FPSAAIFFSTYEFTKRTMINDY----HLNDTFSH-LTAGFLGDFFSSFVY 166

Query: 130 APVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRS 189
            P E+ K +LQ+Q       +    +   K  +  +AT     GV +L+ G  +TL    
Sbjct: 167 VPSEVLKTRLQLQGCYNNPHFNSGYNY--KSLRNAIATIYRTEGVAALFFGYKATLARDL 224

Query: 190 NF-VFWWGSYELITQW---------FQKNTNLSAPAIN-FWAGGLSASFGFWTSAYPSDV 238
            F    +  YE   QW         ++ + ++S   +    AGGL+   G  T+  P DV
Sbjct: 225 PFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLA---GILTT--PLDV 279

Query: 239 VKQVV 243
           VK  V
Sbjct: 280 VKTRV 284

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 87/197 (44%), Gaps = 28/197 (14%)

Query: 102 VYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVF 161
           ++ +++  P+  C ++G + G  +   +A   L   K + Q      KY   +   + +F
Sbjct: 44  LFDDYEHSPIWHCFLAGGVGG--IIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMF 101

Query: 162 KQGMATNGILGGVRSLYKGLISTLI--FRSNFVFWWGSYELITQWFQKNTNLSAPAINFW 219
            +        G  R LY G  + ++  F S  +F+  +YE     F K T ++   +N  
Sbjct: 102 IEE-------GFRRGLYGGYCAAMLGSFPSAAIFF-STYE-----FTKRTMINDYHLNDT 148

Query: 220 AGGLSASF-GFWTSAY---PSDVVKQVVLCNDKYDG-------SFKSWRTAVSDIYRQRG 268
              L+A F G + S++   PS+V+K  +     Y+        ++KS R A++ IYR  G
Sbjct: 149 FSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEG 208

Query: 269 IHGFFKGFLPSFLRSFP 285
           +   F G+  +  R  P
Sbjct: 209 VAALFFGYKATLARDLP 225

>Kwal_23.3529
          Length = 395

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/283 (24%), Positives = 107/283 (37%), Gaps = 45/283 (15%)

Query: 24  NTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGI-RGLYLGFTPPLFGWIM 82
           ++V H  DTVK R    Q G+    +++  +    K    +GI RGLY G+T  + G   
Sbjct: 100 DSVMHSLDTVKTR----QQGAPNAPKYRNMISAYQKIFMEEGIRRGLYGGYTAAMLGSFP 155

Query: 83  MDSALLGSLH-NYRMLLHKYVYPE---HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAK 138
             +   G+     R L+  +   E   H    LSG ++S V        +  P E+ K +
Sbjct: 156 SAAIFFGTYELTKRKLIDDWGVNETLSHLTAGLSGDLVSSV--------VYVPSEVLKTR 207

Query: 139 LQVQ------YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNF- 191
           LQ+Q      +      Y    D +  + +        L G ++L+ G  +TL     F 
Sbjct: 208 LQLQGCYNNPHFHSGYNYRNLRDAITAIVR--------LEGWQTLFFGYKATLCRDLPFS 259

Query: 192 VFWWGSYELITQWF----QKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCND 247
            F +  YE   QW      K  +     +N    G +A         P DV+K  +    
Sbjct: 260 AFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTGAAAGGLAGIITTPMDVIKTRIQTQM 319

Query: 248 KYDGSFKSWR---------TAVSDIYRQRGIHGFFKGFLPSFL 281
               +  S R           ++ +YR  G  GFF G  P F+
Sbjct: 320 PSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFI 362

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
            F AG  S  A   +  P D +K R+Q+      A   +K  L+C Y+    +G R ++ 
Sbjct: 251 AFAAGALSSAAVVALTQPIDVIKTRMQSKT----AWFTYKSSLNCAYRIFVEEGFRYMWK 306

Query: 72  GFTPPLF 78
           G+ P LF
Sbjct: 307 GWVPRLF 313

 Score = 31.2 bits (69), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 260 VSDIYRQRGIHGFFKGFLPSFLRSF 284
           V +IYR RG+ GF +G +P+  R  
Sbjct: 199 VLEIYRTRGVRGFLQGAMPTIFRQL 223

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 22/188 (11%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ--- 64
           SR+  +VAG   G+      +P DT+K R+Q + + +    + +G L  + KT K+    
Sbjct: 294 SRLSTYVAGGLGGIMAQFSVYPIDTLKFRIQCAPLDT----RCRG-LPLLIKTAKDMYRE 348

Query: 65  -GIRGLYLGFTPPLFG---WIMMDSALLGSLHN-YRMLLHKYVYPEHDKLPLSGCII--S 117
            G+R  Y G    + G   +  +D     +L   Y       +    +++ +S  ++   
Sbjct: 349 GGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPM 408

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSL 177
           G  +G   + +  P+ L + +LQ Q    T  +    D  Q VF++ +   G+ G    L
Sbjct: 409 GAFSGTVGATVVYPINLLRTRLQAQ---GTYAHPHRYDGFQDVFRKTVQREGLPG----L 461

Query: 178 YKGLISTL 185
           YKGL+ TL
Sbjct: 462 YKGLVPTL 469

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK 62
           +E   S ++    G FSG    TV +P + ++ RLQ +Q       ++ G  D   KT++
Sbjct: 396 NEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQ-AQGTYAHPHRYDGFQDVFRKTVQ 454

Query: 63  NQGIRGLYLGFTPPL 77
            +G+ GLY G  P L
Sbjct: 455 REGLPGLYKGLVPTL 469

 Score = 31.6 bits (70), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 61/316 (19%), Positives = 113/316 (35%), Gaps = 49/316 (15%)

Query: 21  VAKNTVGHPFDTVKVRLQTSQVGSGAGI----------------QFKGPLDCVYKTLKNQ 64
           V   T   PFD +KV L      S   +                + + PL     +L  Q
Sbjct: 187 VVSRTCTAPFDRIKVFLIARTDLSSPLLHTPEQLLHHNPRADPAKIRSPLVKAATSLYRQ 246

Query: 65  -GIRGLYLGFTPPLFGWIMMDSALLGSLH-NYRMLLHKYVYPEHDKLPLSGCIISGVMAG 122
            G+R  YLG    +       +   GS     R+L       E  +L      ++G + G
Sbjct: 247 GGLRAFYLGNGLNVIKVFPESAMKFGSFELAKRVLAGLEGCGETGELSRLSTYVAGGLGG 306

Query: 123 WTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGL 181
               F   P++  K ++Q    D +       I   + ++++        GG+R  Y+GL
Sbjct: 307 IMAQFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYRE--------GGLRLFYRGL 358

Query: 182 -ISTLIFRSNFVFWWGSYELITQWF----------QKNTNLSAPAINFWAGGLSASFGFW 230
            +  L          G++  + +W+           +N  + +  +    G  S + G  
Sbjct: 359 GVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLPMGAFSGTVG-A 417

Query: 231 TSAYPSDVVKQVVLCN------DKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSF 284
           T  YP ++++  +          +YDG    +R  V    ++ G+ G +KG +P+  +  
Sbjct: 418 TVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTV----QREGLPGLYKGLVPTLAKVC 473

Query: 285 PXXXXXXXXFEFVLRT 300
           P        +E + R 
Sbjct: 474 PAVAISYLCYENLKRA 489

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/295 (21%), Positives = 104/295 (35%), Gaps = 46/295 (15%)

Query: 25  TVGHPFDTVKVRLQTS-QVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMM 83
           T  +P +TVK RLQ   ++ +G    + GP   V    + +G+RGL  G        I++
Sbjct: 27  TFTNPIETVKTRLQLQGELVAGVSRLYSGPAQAVSLIYRTEGLRGLQQGLACAYAYQILL 86

Query: 84  DSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSF---------------- 127
           + + LG     R               L GC++S      T +                 
Sbjct: 87  NGSRLGLYDPLRA-------------ALGGCVLSDRRTYGTAALAVNATAGAAAGMIGAA 133

Query: 128 IAAPVELAKAKLQVQYDAKTTKYTGPI-DVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
           + +P++L K ++Q     +     G +   +  +FK          GVR LY+G+ + L+
Sbjct: 134 LGSPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKD--------RGVRGLYQGVDAALL 185

Query: 187 FRSNF--VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244
            R+          Y    +   ++      A+   A  LS S     +  P DV   +  
Sbjct: 186 -RTGVGSAVQLAVYSHAKEALSRHVP-DGMALYTLASALS-SVAVCIAMNPFDVA--MTR 240

Query: 245 CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
                 G ++     +    RQ G    +KG L   LR  P         E  LR
Sbjct: 241 MYHHRGGLYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALR 295

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           +A   S VA     +PFD    R+   + G      ++GPLDC+ KT++ +G   LY G
Sbjct: 218 LASALSSVAVCIAMNPFDVAMTRMYHHRGG-----LYRGPLDCLCKTVRQEGFSALYKG 271

>Kwal_23.3042
          Length = 542

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 81/187 (43%), Gaps = 20/187 (10%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKTLKNQGI 66
           SR   ++AG   GV      +P DT+K R+Q + + + + G Q    +       K  G+
Sbjct: 343 SRFSTYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLL--ISTAKDMYKEGGL 400

Query: 67  RGLYLGFTPPLFG---WIMMDSALLGSLHNYRMLLHKYV--YPEHDKLPLSG--CIISGV 119
           R  Y G T  + G   +  MD     +L  + +     +   PE D++ +S    ++ G 
Sbjct: 401 RIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPE-DQVTMSNMFVLLMGA 459

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYD-AKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLY 178
            +G   +    PV L + +LQ Q   A   +Y G  DV+ K  ++         G + L+
Sbjct: 460 FSGTVGATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQR--------EGYQGLF 511

Query: 179 KGLISTL 185
           KGL+  L
Sbjct: 512 KGLVPNL 518

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 64/320 (20%), Positives = 120/320 (37%), Gaps = 43/320 (13%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKV------RLQTSQVGSGAGI----------QFKGPLDC 56
           F+AG  SGV   T   PFD +KV       L ++ + S   I          + K PL  
Sbjct: 228 FIAGGVSGVVSRTCTAPFDRIKVFLIARTDLSSTFLKSKDIILEKNPNADLSKIKSPLVK 287

Query: 57  VYKTLKNQ-GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLS--G 113
              TL  Q GIR  Y+G            +   GS    + L+ + +    D   LS   
Sbjct: 288 AATTLYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMAQ-LEGVQDTAGLSRFS 346

Query: 114 CIISGVMAGWTVSFIAAPVELAKAKLQVQ-YDAKTTKYTGPIDVVQKVFKQGMATNGILG 172
             ++G + G        P++  K ++Q    + ++      I   + ++K+        G
Sbjct: 347 TYLAGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKE--------G 398

Query: 173 GVRSLYKGL-ISTLIFRSNFVFWWGSYELITQWF----QKNTNLSAPAIN------FWAG 221
           G+R  Y+G+ +  +          G++  + +W+     + T L    +          G
Sbjct: 399 GLRIFYRGITVGIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMG 458

Query: 222 GLSASFGFWTSAYPSDVVKQVVLCNDKY--DGSFKSWRTAVSDIYRQRGIHGFFKGFLPS 279
             S + G  T+ YP ++++  +     +     +  +R  +    ++ G  G FKG +P+
Sbjct: 459 AFSGTVG-ATAVYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTVQREGYQGLFKGLVPN 517

Query: 280 FLRSFPXXXXXXXXFEFVLR 299
             +  P        +E + R
Sbjct: 518 LAKVCPAVSISYLCYENLKR 537

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 6   TYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65
           T S +   + G FSG    T  +P + ++ RLQ +Q       ++ G  D + KT++ +G
Sbjct: 448 TMSNMFVLLMGAFSGTVGATAVYPVNLLRTRLQ-AQGTFAHPHRYNGFRDVLLKTVQREG 506

Query: 66  IRGLYLGFTPPL 77
            +GL+ G  P L
Sbjct: 507 YQGLFKGLVPNL 518

>Kwal_14.2210
          Length = 315

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 115/301 (38%), Gaps = 25/301 (8%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F AG  +G    TV  PF+ VK+ LQ   V S       G    V +    +G+ GL 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQ---VQSSTHAYNHGLFRAVKQVYLEEGVPGLL 75

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLS-GCIISGVMAGWTVSFIA 129
            G        I +          Y     ++     D + L+   ++SG + G       
Sbjct: 76  RGNG---LNCIRIFPYSAVQFLVYEFCKKQWFQQNPDTVVLNWHRLVSGALCGGCSVLAT 132

Query: 130 APVELAKAKLQVQ-------YDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLI 182
            P++L + +L +Q       + AK      P  V + + K      GI G  R ++   I
Sbjct: 133 YPLDLVRTRLSIQTANLARLHKAKAASAAKPPGVWELLRKTYTQEGGIFGLYRGVWPTSI 192

Query: 183 STLIFRS-NFVFWWGSYELITQWFQ-KNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
             + + + NF  +    E I   F   + +L   +I   +GG++      T  YP D+++
Sbjct: 193 GVVPYVALNFAVYEQLREYIPASFDPASASLYKLSIGAISGGVAQ-----TITYPFDLLR 247

Query: 241 Q----VVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEF 296
           +    + +   +    +KS   A+  I R  G  G++KG   +  +  P        +E 
Sbjct: 248 RRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYET 307

Query: 297 V 297
           V
Sbjct: 308 V 308

>Scas_687.15*
          Length = 328

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 4/71 (5%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
           + V  F  G+FS  A   +  P D VK R+Q+      A   +K  L+C Y+    +G+ 
Sbjct: 232 NEVYAFGIGLFSSCAVVALTQPIDVVKTRMQS----KTAHYFYKNSLNCAYRVFVEEGMV 287

Query: 68  GLYLGFTPPLF 78
            L+ G+ P LF
Sbjct: 288 SLWKGWLPRLF 298

>Scas_613.24
          Length = 177

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 20/179 (11%)

Query: 107 DKLPLSGC-IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKV-FKQG 164
           DK P +   ++SG + G + +    P++L K ++Q    A  T ++   D+   + F +G
Sbjct: 3   DKSPKTSVHLVSGFIGGLSSAVTLQPLDLLKTRIQQHKGA--TLWSAIKDIKDPIQFWRG 60

Query: 165 MATNGILGGVRS-LYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGL 223
              + +   + S LY   ++  I R+  V          +    + + S P +  +   L
Sbjct: 61  TLPSALRTSIGSALYLSCLN--IMRTQLVH-------GKKGSAASKSSSLPQLTMYENLL 111

Query: 224 SASFGFWTSAYPSDVVKQVVLCNDKYDG---SFKSWRTAVSDIYRQRGIHGFFKGFLPS 279
           + +       Y   +   + +   +Y+    S+KS   A+ DIY+  GI GFFKGF P+
Sbjct: 112 TGAMARGLVGY---ITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPT 167

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 8/82 (9%)

Query: 207 KNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGS---FKSWRTAVSDI 263
           K++NL  P ++ +   ++ +F   T  Y   +   + +   +Y+ +   +KS   A   I
Sbjct: 98  KSSNL--PQLSMYENLVTGAFARGTVGY---ITMPITIIKVRYESTLYNYKSIAEAAKSI 152

Query: 264 YRQRGIHGFFKGFLPSFLRSFP 285
             Q GI GFF+GF P+ LR  P
Sbjct: 153 AAQEGIRGFFRGFGPTCLRDAP 174

>KLLA0D04312g 367160..367471 highly similar to sgd|S0006215
          Saccharomyces cerevisiae YPR011c, hypothetical start
          Length = 103

 Score = 37.4 bits (85), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 2  VSEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGA-GIQFKGPLDCVYKT 60
          V++   + +     G  SG    T+ +PFD ++ R Q   +G    G ++K   D +   
Sbjct: 3  VTDPNLANLYKLAMGAISGGVAQTLVYPFDLLRRRFQVLAMGGNELGFRYKSVSDALITI 62

Query: 61 LKNQGIRGLYLGFTPPLF 78
           K +G +G Y G T  LF
Sbjct: 63 GKTEGPKGYYKGLTANLF 80

>Scas_715.45
          Length = 305

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 80/198 (40%), Gaps = 27/198 (13%)

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           + C + G++A         P++L K +LQV      +  +G I +++K            
Sbjct: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK------------ 64

Query: 172 GGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW 230
            G+  L+ G+ +T I +       +G YEL  + +  +T+L       +    S    + 
Sbjct: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY--STHLVKDEATAYKYRTSI---YL 119

Query: 231 TSAYPSDVVKQVVLC-----NDKYDGSFKSWRTAVSD----IYRQRGIHGFFKGFLPSFL 281
            S+  ++    ++LC       K   +   W   V +    +Y + G++GF+KG  P + 
Sbjct: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWC 179

Query: 282 RSFPXXXXXXXXFEFVLR 299
           R  P        FE ++ 
Sbjct: 180 RQIPYTMCKFTSFERIVE 197

>Scas_669.6
          Length = 373

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 69/169 (40%), Gaps = 22/169 (13%)

Query: 15  AGMFSGVAKNTVGHPFDTVKVRLQTS-QVGS---GAGIQFKGPLDCVYKTLKNQGIRGLY 70
           AG+      + V  P + +K RLQ   +V +    +G  ++     +   +  +G++ L+
Sbjct: 152 AGLLGDFVSSFVYVPSEVLKTRLQLQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALF 211

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRML---LHKYVYPEHDKLPLSGCIISGVMAGWTVSF 127
            G+   L   +   +   G    +R     L K    +H+ L +   I +G +AG     
Sbjct: 212 FGYKATLARDLPFSALQFGFYEKFRQTAFKLEKKDITKHN-LSIPNEIFTGAIAGGLAGI 270

Query: 128 IAAPVELAKAKLQVQ--------------YDAKTTKYTGPIDVVQKVFK 162
           I  P+++ K +LQ Q                AKT K + PI +   +F+
Sbjct: 271 ITTPMDVIKTRLQTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFR 319

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 118/296 (39%), Gaps = 65/296 (21%)

Query: 28  HPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL-KNQGI-RGLYLGFTPPLFGWIMMDS 85
           H  DTVK R    Q G+    ++K  +   Y+T+   +GI RGLY G+           +
Sbjct: 70  HSLDTVKTR----QQGAPMTPKYKN-MTTAYRTIFLEEGIARGLYGGYF----------A 114

Query: 86  ALLGSLHNYRMLLHKYVYPEHDKLPLSG------CIISGVMAGWTVSFIAAPVELAKAKL 139
           A+LGS  +  +    Y + +   +   G       + +G++  +  SF+  P E+ K +L
Sbjct: 115 AMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSHLSAGLLGDFVSSFVYVPSEVLKTRL 174

Query: 140 QVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNF-VFWWGSY 198
           Q+Q       +    +   +  +  +       GV++L+ G  +TL     F    +G Y
Sbjct: 175 QLQGRVNNPFFQSGYNY--RSLRTAIRIIVNTEGVKALFFGYKATLARDLPFSALQFGFY 232

Query: 199 ELITQWFQK-------NTNLSAPAINFW---AGGLSASFGFWTSAYPSDVVKQVVLCNDK 248
           E   Q   K         NLS P   F    AGGL+   G  T+  P DV+K   L   +
Sbjct: 233 EKFRQTAFKLEKKDITKHNLSIPNEIFTGAIAGGLA---GIITT--PMDVIK-TRLQTQQ 286

Query: 249 YDGSFKSWRT--AVSD---------------------IYRQRGIHGFFKGFLPSFL 281
            D +  S  T  A+S                      +Y+  G+ GFF G  P F+
Sbjct: 287 ADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFV 342

>Kwal_23.4354
          Length = 343

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTL----KNQG 65
           V  FV G F G     + HPFD  K R+Q + + S      K P   ++K L    K++G
Sbjct: 252 VNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLE---KKPSKNMFKYLNQMRKSEG 308

Query: 66  IRGLYLGFTP 75
           +  LY G  P
Sbjct: 309 LAALYTGLVP 318

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 62/286 (21%), Positives = 114/286 (39%), Gaps = 42/286 (14%)

Query: 35  VRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNY 94
           VR +TS V      ++    D   K  K +G++ L+ G +  L   +M   A +     Y
Sbjct: 75  VRCKTSPV------RYNSTWDAFGKIAKIEGVQSLWRGLSITL---LMAAPANMVYFIGY 125

Query: 95  RMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPI 154
             L  K      DK P    ++ G +A    +   AP+EL + +LQ      + K T  +
Sbjct: 126 ESLRDKSRL--QDKYPTLNPLMCGALARVLAATTVAPLELFRTRLQ-SIPRSSPKSTTAM 182

Query: 155 DVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNF-VFWWGSYELITQWFQKNTNLSA 213
            +   + +     + +  G ++L++GL  TL     F   +WG YE    +++ N ++ +
Sbjct: 183 MIKDLIKESRYEISKV--GYKALFRGLEITLWRDVPFSSIYWGCYE----FYKSNVSIDS 236

Query: 214 PA-------------INFWAGGLSASFGFWTSA---YPSDVVK---QVVLCNDKYDGS-F 253
                          +N + GG   SFG   +A   +P DV K   Q+   N   +    
Sbjct: 237 EKSIVNSSNSNWNHFVNSFVGG---SFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPS 293

Query: 254 KSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
           K+    ++ + +  G+   + G +P  ++  P        +E   R
Sbjct: 294 KNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMISTYEVCKR 339

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
            FV G  S  A   V  P D +K R+Q+      A   +K  L+C Y+    +GI   + 
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQSKY----AWANYKNSLNCAYRIFVEEGIPKFWK 381

Query: 72  GFTPPL 77
           G+ P L
Sbjct: 382 GWAPRL 387

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 104/263 (39%), Gaps = 44/263 (16%)

Query: 29  PFDTVKVRLQTSQVGSGAGIQ-FKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSAL 87
           P D VK RLQ +     + +Q F+       K + N+G + +Y GF     G+ +  +  
Sbjct: 38  PLDLVKCRLQVNPKLYTSNLQGFR-------KIIANEGWKKVYTGFGATFVGYSLQGAGK 90

Query: 88  LGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIA----APVELAKAKLQVQY 143
            G    ++ L   ++ P          +   +MA  T  F+A     P E  K K Q   
Sbjct: 91  YGGYEYFKHLYSSWLSPG---------VTVYLMASATAEFLADIMLCPFEAIKVKQQTTM 141

Query: 144 DAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNFVFW-WGSYELIT 202
                     +D  +K++ +        GG+++ YKG++     +  +    + S+E I 
Sbjct: 142 PPFCNNV---VDGWKKMYAES-------GGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIV 191

Query: 203 QWF--------QKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK 254
           Q          ++   L   +++F  GG  A       ++P+DV+   +    K +   +
Sbjct: 192 QKIYSVLPKKKEEMNALQQISVSF-VGGYLAGILCAAVSHPADVMVSKINSERKAN---E 247

Query: 255 SWRTAVSDIYRQRGIHGFFKGFL 277
           S   A   IY++ G  G + G +
Sbjct: 248 SMSVASKRIYQKIGFTGLWNGLM 270

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 21/126 (16%)

Query: 24  NTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR-GLYLGFTPPLFGWIM 82
           ++  H  DTVK R    Q G+ + +++K  +      +  +G+R GLY G++        
Sbjct: 70  DSAMHSLDTVKTR----QQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS-------- 117

Query: 83  MDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC------IISGVMAGWTVSFIAAPVELAK 136
              A+LGS  +  +    Y Y +   +   G       + +G +  +  SF+  P E+ K
Sbjct: 118 --GAMLGSFPSAAIFFATYEYTKRKMIGEWGINETFSHLTAGFLGDFISSFVYVPSEVLK 175

Query: 137 AKLQVQ 142
            +LQ+Q
Sbjct: 176 TRLQLQ 181

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 108/271 (39%), Gaps = 46/271 (16%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            V+G F G+A      P D +K RLQ +Q  S         L  V + ++    R L+ G
Sbjct: 12  LVSGFFGGLASVCALQPLDLLKTRLQQAQASS---------LRSVLREVRT--TRELWRG 60

Query: 73  FTPPLFGWIMMDSALLGSLHNY-RMLLHK--YVYPEHDKLPLSGC---IISGVMAGWTVS 126
             P       + SAL  SL NY R  L +          LP       +++G ++   V 
Sbjct: 61  TLPSAL-RTSIGSALYLSLLNYSRSALARGSEARTRSSLLPRLQSYQNLLTGALSRAAVG 119

Query: 127 FIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLI 186
            +  P+ + K    V+Y++    Y G  +  + +++          G R  +KG  +T +
Sbjct: 120 LVTMPITVIK----VRYESTLYAYNGLAEATRHIWRS--------EGARGFFKGAAATTL 167

Query: 187 FRSNF-----VFWWGSYELITQWF-------QKNTNLSAPA---INFWAGGLSASFGFWT 231
             + +     + +  + E++ +          ++  L+APA   +N  +  LSAS     
Sbjct: 168 RDAPYAGLYVLLYEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTL 227

Query: 232 SAYPSDVVKQVVLCNDKYDGSFKSWRTAVSD 262
           +A P D +K  +       G  ++ R  V +
Sbjct: 228 TA-PFDTIKTRMQLQSHPVGFVQTLRHIVCE 257

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/284 (21%), Positives = 108/284 (38%), Gaps = 46/284 (16%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           +AG   G A   V +P  T+   LQT +       + +  L+ + +     GI G +LG 
Sbjct: 16  IAGSLGGAASIAVTYPLVTITTNLQTKEN------EARPKLETIKEIYNKNGIIGYFLGL 69

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDK----------LPLSGCIISGVMAGW 123
              ++G    +             ++ Y Y    K          L     I++  +AG 
Sbjct: 70  ESAVYGMATTN------------FVYYYFYEWCAKTARTLTTKQYLSTWESILASTIAGS 117

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
             +  + P+ +A  ++ V     +T  T  ID+V+        T+G L    +L  GL  
Sbjct: 118 MTAVASNPIWVANTRMTVAKSNHSTLRT-VIDIVK--------TDGPL----TLLNGLKP 164

Query: 184 TLIFRSNFVFWWGSYELITQW---FQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVK 240
            L+  SN +  +  YE +       Q+   LS P+  F  G +       T+ YP   +K
Sbjct: 165 ALVLVSNPIIQYTVYEQLKNLVLRLQRKKVLS-PSWAFLLGAIGKLAATGTT-YPYITLK 222

Query: 241 QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSF 284
             +          KS  + + +I ++ G+ G + G     ++S 
Sbjct: 223 TRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVKLVQSI 266

>Kwal_55.21338
          Length = 323

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 70/157 (44%), Gaps = 24/157 (15%)

Query: 131 PVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSN 190
           P+ +   KLQ Q DAK  K +   D ++ ++++    +G +G    L   L  T +  SN
Sbjct: 42  PLIVVTTKLQTQ-DAKGEKLSLA-DTIKDIYRK----DGAMGFFAGLESALFGTTL--SN 93

Query: 191 FVFWWGSYE------LITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVL 244
           FV+++  YE      L  +  Q+ T   +  +   AG L+A     T+A P  V    + 
Sbjct: 94  FVYYY-CYEASSRCVLRARHTQRLTTAESMLVGSIAGSLNA-----TAANPLWVANTRMT 147

Query: 245 CNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL 281
                 G+  +    + DI +  GI G FKG  P+ +
Sbjct: 148 VQKSDRGTLST----IFDIVKDEGISGLFKGLNPALI 180

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 87/212 (41%), Gaps = 28/212 (13%)

Query: 8   SRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
           S ++G +AG  +  A N    P      R+   +         +G L  ++  +K++GI 
Sbjct: 121 SMLVGSIAGSLNATAAN----PLWVANTRMTVQKSD-------RGTLSTIFDIVKDEGIS 169

Query: 68  GLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSG--CIISGVMAGWTV 125
           GL+ G  P L   ++++  +  +++     L  ++        LS     I G +     
Sbjct: 170 GLFKGLNPALI--LVINPIIQYTVYEQ---LKNWILSSRQTRTLSPSWAFILGAVGKLAA 224

Query: 126 SFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTL 185
           +    P    KA++ +  + K++    P  ++  +  + +  +GILG  R +   L+ ++
Sbjct: 225 TGSTYPYVTMKARMHLLGEHKSSTAAPPRSLLS-LMAEIIKKDGILGLYRGIGIKLVQSI 283

Query: 186 I-------FRSNFVFWWGSYELITQWFQKNTN 210
           +       F+   V W  S  ++  W + NT 
Sbjct: 284 LTAAFLFFFKEGLVIW--SMRVLRAWSRFNTK 313

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 61/137 (44%), Gaps = 10/137 (7%)

Query: 6   TYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQG 65
           T+  +   V+G+ + VA + + +PFDT+K RLQ     S + +         +   KN+G
Sbjct: 131 THQPLKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDSSM-----WRMAFNIYKNEG 185

Query: 66  IRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTV 125
               +  + P      +  +AL   ++       K+  P +   P   C+  G+ AG T 
Sbjct: 186 PMAFFYSY-PTTLAMNIPFAALNFVIYESST---KFFNPTNAYNPWIHCLCGGI-AGATC 240

Query: 126 SFIAAPVELAKAKLQVQ 142
           + +  P++  K  LQ++
Sbjct: 241 AAVTTPLDCIKTVLQIR 257

 Score = 35.4 bits (80), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 65/307 (21%), Positives = 120/307 (39%), Gaps = 38/307 (12%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQT-SQVGSGAGIQFKGP-------------LDCVY 58
            +AG F+G+ ++++  P D +K R+Q  S++ + A     G              L  + 
Sbjct: 24  LIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQIS 83

Query: 59  KTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYR-MLLHKYVYPEHDKLPLSGCIIS 117
           +    +G   L+ G    + G     +    +    +  L+    +  H  L  +   +S
Sbjct: 84  RISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQPLKTA---VS 140

Query: 118 GVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSL 177
           GV A      +  P +  K +LQ+Q  +  +       +   ++K      G +    S 
Sbjct: 141 GVAATVAADALMNPFDTIKQRLQLQSKSSDSSM---WRMAFNIYKN----EGPMAFFYSY 193

Query: 178 YKGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSAYPS 236
              L   + F + NFV     YE  T++F   TN   P I+   GG++ +     +  P 
Sbjct: 194 PTTLAMNIPFAALNFVI----YESSTKFFNP-TNAYNPWIHCLCGGIAGATCAAVTT-PL 247

Query: 237 DVVKQVVL---CNDKYDGSFKSWRT---AVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXX 290
           D +K V+     +  +  SFK+  T   A   I++  G  GF++G  P  + + P     
Sbjct: 248 DCIKTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAIS 307

Query: 291 XXXFEFV 297
              +EF 
Sbjct: 308 WTSYEFA 314

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 71/190 (37%), Gaps = 14/190 (7%)

Query: 107 DKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAK--------TTKYTGPIDVVQ 158
           D  PLS  +I+G  AG     I  P++  K ++Q   + K                    
Sbjct: 16  DTAPLSYQLIAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGA 75

Query: 159 KVFKQGMATNGILGGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWF--QKNTNLSAPA 215
               Q ++      G  +L++G+ S ++        ++ +YE   +     K+ N   P 
Sbjct: 76  GTLLQQISRISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLIDAKDFNTHQP- 134

Query: 216 INFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
           +     G++A+        P D +KQ +    K   S   WR A  +IY+  G   FF  
Sbjct: 135 LKTAVSGVAATVAADALMNPFDTIKQRLQLQSKSSDS-SMWRMAF-NIYKNEGPMAFFYS 192

Query: 276 FLPSFLRSFP 285
           +  +   + P
Sbjct: 193 YPTTLAMNIP 202

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 66/285 (23%), Positives = 108/285 (37%), Gaps = 58/285 (20%)

Query: 12  GFVAGMFSGVAKNT----VGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIR 67
           GF+  + SG A  T    V  P DT+K RLQ            KG         +N G R
Sbjct: 4   GFLISLLSGAAAGTSTDLVFFPIDTLKTRLQA-----------KGGF------FRNGGYR 46

Query: 68  GLYLGFTPPLFG--------WIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGV 119
           G+Y G    +          +I  D+    +   +R LL     P  +   +   + S  
Sbjct: 47  GVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLL-----PSSNVADVVTHMFSSS 101

Query: 120 MAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYK 179
           M       +  P E+ K + Q      +       + ++++ K     NG  G  R+LY+
Sbjct: 102 MGEIAACMVRVPAEVVKQRSQTHASHSS------WETLREILKN---ENG-EGVRRNLYR 151

Query: 180 GLISTLIFRSNF-VFWWGSYELITQ-WFQKNTNLSAPAINFWAGGLSASFGFWTSA---Y 234
           G  +T++    F    +  YE + + W + +    +  +  W G +  S     +A    
Sbjct: 152 GWSTTIMREIPFTCIQFPLYEYMKKVWAELD---ESDRVEPWKGAVCGSIAGGIAAATTT 208

Query: 235 PSDVVK-QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
           P D +K +++LC            T VS IY++ G   FF G  P
Sbjct: 209 PLDFLKTRLMLCKKSIP-----LGTLVSTIYKEEGFKVFFSGVGP 248

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 123/318 (38%), Gaps = 50/318 (15%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK----NQGIRGL 69
           +AG  +G    T+  P D +K+  QTS        QF G +  + +  K    + G RG 
Sbjct: 24  LAGGIAGSCAKTLVAPLDRIKILFQTSNPQFA---QFAGSMGGLVRASKYIMAHDGPRGF 80

Query: 70  YLGFTPPLFGWIMMDSALLGSLHNYR-MLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
           + G +  L       +    +    R +++  + +  H +      ++SG +AG    F+
Sbjct: 81  FQGHSATLLRIFPYAAIKFIAYEQIRSVVIPTWRHESHWRR-----LLSGSLAGLCSVFV 135

Query: 129 AAPVELAKAKLQV---QYDAKTTKYTG------PIDVVQK-----------VFKQGMATN 168
             P++L + +L     ++DAK  K         P + ++K            F +G  T 
Sbjct: 136 TYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYIPQWFAHWSNFYRGY-TP 194

Query: 169 GILGGVR----SLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFW----A 220
            ++G +     S +   +   IFR   +     Y +++       + + P +  W    A
Sbjct: 195 TVIGMIPYAGVSFFAHDLCQDIFRHPML---EPYSVLSPGGSSAYDRTVP-LKTWAQLVA 250

Query: 221 GGLSASFGFWTSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFL 277
           GGL A     T+AYP ++++   QV    D     F         IY + G  GFF G  
Sbjct: 251 GGL-AGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVGLS 309

Query: 278 PSFLRSFPXXXXXXXXFE 295
             +++  P        +E
Sbjct: 310 IGYIKVTPMVACSFFIYE 327

 Score = 36.2 bits (82), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (46%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            VAG  +G+A  T  +PF+ ++ RLQ S +       F G  +         G RG ++G
Sbjct: 248 LVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTEGGWRGFFVG 307

Query: 73  FT 74
            +
Sbjct: 308 LS 309

>Scas_558.2
          Length = 289

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 106/286 (37%), Gaps = 54/286 (18%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGL 69
           VM  ++G  +G + + V  P DT+K RLQ            KG         +N G  G+
Sbjct: 7   VMSLLSGAAAGTSTDLVFFPIDTLKTRLQA-----------KGGF------FQNGGYHGI 49

Query: 70  YLGFTPPLFGWIMMDSALLGSLH---------NYRMLLHKYVYPEHDKLPLS----GCII 116
           Y G      G  ++ SA   SL            R  + + +     + P S      +I
Sbjct: 50  YRG-----LGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMI 104

Query: 117 SGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRS 176
           +  M       +  P E+ K + QV     +           + F+  +      G +R+
Sbjct: 105 ASSMGELAACLVRVPAEVIKQRTQVHSTNSS----------WQTFRTILKNENQEGIIRN 154

Query: 177 LYKGLISTLIFRSNFV-FWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSA-- 233
           LY+G  +T++    F    +  YE + + +    N     +  W G +  S     +A  
Sbjct: 155 LYRGWSTTIMREIPFTCIQFPLYEFMKKEWALYDN-EVGHLKPWKGAICGSIAGGIAAAT 213

Query: 234 -YPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
             P D +K  ++ N K     KS    + +IY++ G   FF G  P
Sbjct: 214 TTPLDFLKTRLMLN-KDSIPIKSL---IRNIYKEEGFKIFFSGIYP 255

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/195 (18%), Positives = 80/195 (41%), Gaps = 36/195 (18%)

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
           ++SG  AG +   +  P++  K +LQ                     K G   NG   G 
Sbjct: 10  LLSGAAAGTSTDLVFFPIDTLKTRLQA--------------------KGGFFQNG---GY 46

Query: 175 RSLYKGLISTLIFR----SNFVFWWGSYEL-----ITQWFQKNTNLSAPAINFWAGGLSA 225
             +Y+GL S ++      S F   + S ++     + +    +   S  +++     +++
Sbjct: 47  HGIYRGLGSAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIAS 106

Query: 226 SFGFWTSAY---PSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           S G   +     P++V+KQ    +   + S++++RT + +  ++  I   ++G+  + +R
Sbjct: 107 SMGELAACLVRVPAEVIKQRTQVHST-NSSWQTFRTILKNENQEGIIRNLYRGWSTTIMR 165

Query: 283 SFPXXXXXXXXFEFV 297
             P        +EF+
Sbjct: 166 EIPFTCIQFPLYEFM 180

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 37.0 bits (84), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 5/66 (7%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           FV+ +F   A   V  P D +K R+Q+    S      +     V  TLKN+G    + G
Sbjct: 212 FVSSIFGASASLIVSAPLDVIKTRIQSRNFESA-----ESGFTIVKNTLKNEGATAFFKG 266

Query: 73  FTPPLF 78
            TP L 
Sbjct: 267 LTPKLL 272

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 36.2 bits (82), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 81/186 (43%), Gaps = 23/186 (12%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           + F+AG  +G    TV  PF+ VK+ L   QV S       G ++ V +  K +G+ GL+
Sbjct: 13  IAFIAGGVAGAVSRTVVSPFERVKILL---QVQSSTSAYNHGIINAVGQVYKEEGVAGLF 69

Query: 71  LGFTPPLFGWIMMDSALLGSLHNY--RMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFI 128
            G        I   SA+   ++ +  + + H       ++L     + +G + G      
Sbjct: 70  RGNGLNCV-RIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGALCGGMSVLA 128

Query: 129 AAPVELAKAKLQVQYD--AKTTKYT--------GPIDVVQKVFKQGMATNGILGGVRSLY 178
             P++L + +L +Q    AK +K          G  +++ K FK+        GG+R LY
Sbjct: 129 TYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEE-------GGIRGLY 181

Query: 179 KGLIST 184
           +G+  T
Sbjct: 182 RGIYPT 187

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFK 274
           +I F AGG++ +    T   P + VK ++               AV  +Y++ G+ G F+
Sbjct: 12  SIAFIAGGVAGAVS-RTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAGLFR 70

Query: 275 GFLPSFLRSFPXXXXXXXXFE 295
           G   + +R FP        +E
Sbjct: 71  GNGLNCVRIFPYSAVQFVVYE 91

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 77/193 (39%), Gaps = 50/193 (25%)

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYT-GPIDVVQKVFKQGMATNGILGGV 174
           I+G +AG     + +P E  K  LQVQ  + T+ Y  G I+ V +V+K+     G+ G  
Sbjct: 16  IAGGVAGAVSRTVVSPFERVKILLQVQ--SSTSAYNHGIINAVGQVYKE----EGVAGLF 69

Query: 175 RSLYKGLISTLIFRSNFVFWWGSYELITQWFQKN----------------TNLSAPAINF 218
           R    GL    IF  + V +     ++ +W +K+                  LSA A+  
Sbjct: 70  RG--NGLNCVRIFPYSAVQF-----VVYEWCKKHIFHVDGTVGKEQLLNWQRLSAGAL-- 120

Query: 219 WAGGLSASFGFWTSAYPSDVVKQVV---------LCNDKYDGSFKS---WRTAVSDIYRQ 266
             GG+S       + YP D+V+  +         L   K     K    W   V     +
Sbjct: 121 -CGGMSV-----LATYPLDLVRTRLSIQTANLAKLSKSKAKDIAKPPGVWELLVKTFKEE 174

Query: 267 RGIHGFFKGFLPS 279
            GI G ++G  P+
Sbjct: 175 GGIRGLYRGIYPT 187

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 214 PAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGS---FKSWRTAVSDIYRQRGIH 270
           P +N +    S   G  T A    +   + +   +Y+ +   + S R A S I+R  G+ 
Sbjct: 100 PQLNMYENMFS---GAVTRALTGLITMPITVIKVRYESTLYQYTSLRYATSHIFRTEGLR 156

Query: 271 GFFKGFLPSFLRSFP 285
           GFF+GF  + LR  P
Sbjct: 157 GFFRGFGATALRDAP 171

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 57/279 (20%), Positives = 107/279 (38%), Gaps = 52/279 (18%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            V+G  +G + + V  P DT+K RLQ            KG          N G RG+Y G
Sbjct: 9   LVSGAAAGTSTDVVFFPIDTLKTRLQA-----------KGGF------FHNGGYRGIYRG 51

Query: 73  FTPPLFGWIMMDSALLGSL---------HNYRMLLHKYVYPEHDKLPLSGCIISGVMAGW 123
                 G  ++ SA   SL            R ++ ++   E     L+  ++S  +   
Sbjct: 52  -----LGSAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTH-MLSSSLGEM 105

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
           +   +  P E+ K + Q  +   +      +  ++ + +         G VR LY+G  +
Sbjct: 106 SACLVRVPAEVIKQRTQTHHTNSS------LQTLRLILRDPTGE----GVVRGLYRGWWT 155

Query: 184 TLIFRSNF-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASF---GFWTSAYPSDVV 239
           T++    F    +  YE + + +     +    ++ W G +  S        +  P DV+
Sbjct: 156 TIMREIPFTCIQFPLYEYLKKKWAAYAEIE--RVSAWQGAVCGSLAGGIAAAATTPLDVL 213

Query: 240 KQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
           K  ++ +++        RT    ++R+ G   FF+G  P
Sbjct: 214 KTRMMLHERRVPMLHLART----LFREEGARVFFRGIGP 248

 Score = 32.0 bits (71), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 78/197 (39%), Gaps = 45/197 (22%)

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGV 174
           ++SG  AG +   +  P++  K +LQ                     K G   N   GG 
Sbjct: 9   LVSGAAAGTSTDVVFFPIDTLKTRLQA--------------------KGGFFHN---GGY 45

Query: 175 RSLYKGLISTLIFRS-NFVFWWGSYELITQWFQKNTNLSAPAINFWAGG----------L 223
           R +Y+GL S ++  +     ++ +Y+ + Q  +       P +  W             L
Sbjct: 46  RGIYRGLGSAVVASAPGASLFFVTYDSMKQQLR-------PVMGRWTASEQLAEVLTHML 98

Query: 224 SASFGFWTSAY---PSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSF 280
           S+S G  ++     P++V+KQ    +   + S ++ R  + D   +  + G ++G+  + 
Sbjct: 99  SSSLGEMSACLVRVPAEVIKQRTQTHHT-NSSLQTLRLILRDPTGEGVVRGLYRGWWTTI 157

Query: 281 LRSFPXXXXXXXXFEFV 297
           +R  P        +E++
Sbjct: 158 MREIPFTCIQFPLYEYL 174

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 58/299 (19%), Positives = 126/299 (42%), Gaps = 37/299 (12%)

Query: 14  VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
           ++G+ +G       HP D +K+RLQ S  G+ A   + G +  +++  + Q  R LY G 
Sbjct: 13  ISGLTAGTITTIASHPLDLLKLRLQLS-AGNRANTTYTGLIRDIFE--RQQWGRELYRGL 69

Query: 74  TPPLFGWIMMDSALLGSLHNYRMLLHKYVYPE------HDKLPLSGCIISGVMAGWTVSF 127
              L G  +  +   G     + +  +++  E        +LP    +++   +G   + 
Sbjct: 70  GVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAV 129

Query: 128 IAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIF 187
           +  P+ + K ++     ++   Y    D V K+++    T G+L    + ++G++ +L+ 
Sbjct: 130 LTNPIWVIKTRIMA--TSRAGPYKSTFDGVYKLYQ----TEGVL----AFWRGVVPSLLG 179

Query: 188 RSNFVFWWGSYELIT-QWFQKNTNLSAPAINFWAGGLSASFGFW--------TSAYPSDV 238
            S    ++  Y+ +   +   +T+ +   ++     +S   G          TS YP  +
Sbjct: 180 VSQGAIYFALYDTLKFHYLHSSTDKAERRLS-----VSEIIGITCISKMISVTSVYPFQL 234

Query: 239 VKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFV 297
           +K  +    +  G+       V  +Y + GI GF++G   + LR+ P        +E +
Sbjct: 235 LKSKL----QDFGAPSGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

 Score = 32.3 bits (72), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 82/187 (43%), Gaps = 22/187 (11%)

Query: 106 HDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQY-DAKTTKYTGPIDVVQKVFKQG 164
           H+   L   +ISG+ AG   +  + P++L K +LQ+   +   T YTG   +++ +F++ 
Sbjct: 3   HELTSLQREVISGLTAGTITTIASHPLDLLKLRLQLSAGNRANTTYTG---LIRDIFERQ 59

Query: 165 MATNGILGGVRSLYKGLISTLIFRS-NFVFWWGSYELITQWFQKNT-NLSA--------P 214
                     R LY+GL   L+  S  +  ++G Y        ++  N SA        P
Sbjct: 60  QWG-------RELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNESATGIMDRRLP 112

Query: 215 AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFK 274
           A  +     S+         P  V+K  ++   +  G +KS    V  +Y+  G+  F++
Sbjct: 113 AHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSR-AGPYKSTFDGVYKLYQTEGVLAFWR 171

Query: 275 GFLPSFL 281
           G +PS L
Sbjct: 172 GVVPSLL 178

>Kwal_47.19228
          Length = 281

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 4/67 (5%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYL 71
            F  G  S  A   V  P D +K R+Q+    S     +K  L+C Y+    +G    + 
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSN----YKNSLNCAYRIFVEEGFTKFWK 242

Query: 72  GFTPPLF 78
           G+ P L 
Sbjct: 243 GWAPRLM 249

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 20/29 (68%)

Query: 254 KSWRTAVSDIYRQRGIHGFFKGFLPSFLR 282
           + + T V +IYR RGI GF +G +P+ +R
Sbjct: 129 RQFLTTVQEIYRSRGIRGFLQGTMPTIIR 157

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 35.8 bits (81), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 13/79 (16%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYK 59
           S+ T+S+   F++ +    +   V  P D +K R+Q           F  P   L  V  
Sbjct: 206 SQATWSQ--NFISSIVGACSSLIVSAPLDVIKTRIQNRN--------FDNPESGLRIVKN 255

Query: 60  TLKNQGIRGLYLGFTPPLF 78
           TLKN+G+   + G TP L 
Sbjct: 256 TLKNEGVTAFFKGLTPKLL 274

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 35.8 bits (81), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 106/287 (36%), Gaps = 62/287 (21%)

Query: 11  MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLY 70
           +  ++G  +G + + V  P DT+K RLQ            KG          N G +G+Y
Sbjct: 6   LSLLSGAAAGTSTDLVFFPIDTIKTRLQA-----------KGGF------FANGGYKGIY 48

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVY------PEHDKLPLSGC---------I 115
            G          + SA++ S     +    Y Y      P   KL   G          +
Sbjct: 49  RG----------LGSAVVASAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHM 98

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR 175
           +S  +       +  P E+ K + QV   +  + +     +++   K+G+  N       
Sbjct: 99  LSSSIGEICACLVRVPAEVVKQRTQVH--STNSSWQTLQSILRNDNKEGLRKN------- 149

Query: 176 SLYKGLISTLIFRSNF-VFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWTSA- 233
            LY+G  +T++    F    +  YE + + + K    S   +  W G +  S     +A 
Sbjct: 150 -LYRGWSTTIMREIPFTCIQFPLYEYLKKTWAKANGQS--QVEPWKGAICGSIAGGIAAA 206

Query: 234 --YPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
              P D +K  ++ N     +  S  + +  IYR+ G   FF G  P
Sbjct: 207 TTTPLDFLKTRLMLNK----TTASLGSVIIRIYREEGPAVFFSGVGP 249

>Kwal_27.11626
          Length = 299

 Score = 35.4 bits (80), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 28/69 (40%), Gaps = 11/69 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQGIRGL 69
           FV+ +    A   V  P D +K R+Q           F  P      V  TLKN+GI   
Sbjct: 212 FVSSIVGASASLIVSAPLDVIKTRIQNRH--------FDNPESGFRIVQNTLKNEGITAF 263

Query: 70  YLGFTPPLF 78
           + G TP L 
Sbjct: 264 FKGLTPKLL 272

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 217 NFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGF 276
           NF +  + AS     SA P DV+K  +  N  +D     +R  V +  +  GI  FFKG 
Sbjct: 211 NFVSSIVGASASLIVSA-PLDVIKTRI-QNRHFDNPESGFRI-VQNTLKNEGITAFFKGL 267

Query: 277 LPSFLRSFP 285
            P  L + P
Sbjct: 268 TPKLLTTGP 276

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 35.4 bits (80), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 79/189 (41%), Gaps = 37/189 (19%)

Query: 7   YSRVMGF---VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---------- 53
           + R+ G+   +AG  +G+ ++    PF+ +K  L  S +     ++   P          
Sbjct: 70  FQRLTGYNLLIAGTLTGIVESLFIIPFENIKTTLIQSAMIDHKKLEKNQPVVNAKATFHK 129

Query: 54  --------------LDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLH 99
                         L  V    + +G      G T  +F  I   S    +   ++ LL 
Sbjct: 130 VATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAYTAFKRLLQ 189

Query: 100 KYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQK 159
                 +DK   +  +I+G+   +T+  +  P+++ K ++  Q +AK T+Y   ++ + +
Sbjct: 190 ----ARNDK---ASSVITGLATSFTLVAMTQPIDVVKTRMMSQ-NAK-TEYKNTLNCMYR 240

Query: 160 VF-KQGMAT 167
           +F ++GMAT
Sbjct: 241 IFVQEGMAT 249

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 35.4 bits (80), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 66/282 (23%), Positives = 105/282 (37%), Gaps = 38/282 (13%)

Query: 45  GAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP 104
            + ++F    +   K  + +G+  L+ G +  L   +M   A +     Y M       P
Sbjct: 92  NSALRFNSTWEAFTKISEVEGLATLWRGLSITL---LMAIPANVVYFSGYEMFRDHS--P 146

Query: 105 EHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQG 164
             D  P    +  G  A    +   AP+EL K +LQ    ++    T      Q +FK  
Sbjct: 147 MRDSYPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTT------QMMFKDL 200

Query: 165 M--ATNGIL-GGVRSLYKGLISTLIFRSNF-VFWWGSYELITQ--WFQKNT-----NLSA 213
           +    N I  GG + L+KGL  TL     F   +WGSYE   +  W   +      NLS 
Sbjct: 201 LKETRNEIRSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSP 260

Query: 214 P---AINFWAGGLSASFGFWTSAYPSDVVK---QVVL-CNDKYDGSFKSWRTAVS----- 261
                IN + GG  +        +P DV K   Q+ +   +K   +  S +  VS     
Sbjct: 261 NWDFFINSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMF 320

Query: 262 ----DIYRQRGIHGFFKGFLPSFLRSFPXXXXXXXXFEFVLR 299
               +I +  G    + G +P  ++  P        +E   R
Sbjct: 321 KFLYNIKQTEGYGALYTGLIPRVMKIAPSCAIMISTYELSKR 362

 Score = 32.7 bits (73), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 10/76 (13%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQ----------VGSGAGIQFKGPLDCVYK 59
           +  F+ G  SG +   + HPFD  K R+Q +           V     +  +G    +Y 
Sbjct: 266 INSFIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

Query: 60  TLKNQGIRGLYLGFTP 75
             + +G   LY G  P
Sbjct: 326 IKQTEGYGALYTGLIP 341

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 34.7 bits (78), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 13/79 (16%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYK 59
           S+ T+S+   FV+ +    A   +  P D +K R+Q           F+ P      V  
Sbjct: 204 SQATWSQ--NFVSSIVGASASLIISAPLDVIKTRIQNKN--------FENPESGFTIVKN 253

Query: 60  TLKNQGIRGLYLGFTPPLF 78
           TLKN+G    + G TP L 
Sbjct: 254 TLKNEGFSAFFKGLTPKLL 272

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 3/69 (4%)

Query: 217 NFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGF 276
           NF +  + AS     SA P DV+K  +  N  ++   +S  T V +  +  G   FFKG 
Sbjct: 211 NFVSSIVGASASLIISA-PLDVIKTRI-QNKNFENP-ESGFTIVKNTLKNEGFSAFFKGL 267

Query: 277 LPSFLRSFP 285
            P  L + P
Sbjct: 268 TPKLLTTGP 276

>Kwal_27.11419
          Length = 298

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 73/176 (41%), Gaps = 18/176 (10%)

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVR 175
           I G + G T + I  P +L K +LQ        K +  +DVV+ +   G    G L    
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQ------QNKSSNLLDVVRSIETPGQLWKGTLP--- 62

Query: 176 SLYKGLISTLIFRS--NFVFWWGSYELITQWFQKNTNLS-APAINFWAGGLSASFGFWTS 232
           S  +  + + +F S  N V    + + +     KN + S  P ++ +   +S   G  T 
Sbjct: 63  SALRTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLIS---GAITR 119

Query: 233 AYPSDVVKQVVLCNDKYDGS---FKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
           A        + +   +++ +   +KS   A + IYR  GI G F G   + +R  P
Sbjct: 120 AAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATVMRDAP 175

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 34.3 bits (77), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 13/79 (16%)

Query: 3   SEETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYK 59
           S+ T+S+   F++ +    A   V  P D +K R+Q           F  P      V  
Sbjct: 206 SQATWSQ--NFISSIVGASASLIVSAPLDVIKTRIQNRN--------FDNPESGFKIVKN 255

Query: 60  TLKNQGIRGLYLGFTPPLF 78
           TLKN+G    + G TP L 
Sbjct: 256 TLKNEGFTAFFKGLTPKLL 274

>Scas_562.12
          Length = 300

 Score = 33.9 bits (76), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 14/80 (17%)

Query: 5   ETYSRV---MGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVY 58
           E YS+      F++ +        V  P D +K R+Q           F  P   L  V 
Sbjct: 203 EDYSQASWSQNFISSIVGASCSLIVSAPLDVIKTRIQNRS--------FDNPETGLTIVK 254

Query: 59  KTLKNQGIRGLYLGFTPPLF 78
            T KN+GI   + G TP L 
Sbjct: 255 NTFKNEGITAFFKGLTPKLL 274

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 217 NFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGF 276
           NF +  + AS     SA P DV+K  +  N  +D   ++  T V + ++  GI  FFKG 
Sbjct: 213 NFISSIVGASCSLIVSA-PLDVIKTRI-QNRSFDNP-ETGLTIVKNTFKNEGITAFFKGL 269

Query: 277 LPSFLRSFP 285
            P  L + P
Sbjct: 270 TPKLLTTGP 278

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 30/62 (48%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
            +AG  +G+A  T  +PF+ ++ RLQ   V +    +F    +        +G RG ++G
Sbjct: 294 LLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERGWRGFFVG 353

Query: 73  FT 74
            +
Sbjct: 354 LS 355

 Score = 32.7 bits (73), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 38/87 (43%), Gaps = 8/87 (9%)

Query: 216 INFWA----GGLSASFGFWTSAYPSDVVK---QVVLCNDKYDGSFKSWRTAVSDIYRQRG 268
           +N WA    GGL A     T+AYP ++++   QV    +  +  F S       I+ +RG
Sbjct: 288 LNTWAELLAGGL-AGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEMAKIIFHERG 346

Query: 269 IHGFFKGFLPSFLRSFPXXXXXXXXFE 295
             GFF G    +++  P        +E
Sbjct: 347 WRGFFVGLSIGYIKVTPMVACSFFVYE 373

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 220 AGGLSASFGFWTSAYPSDVVKQVVLCND----KYDGSFKSWRTAVSDIYRQRGIHGFFKG 275
           AGG++ S    T   P D +K +   ++    KY GSF+    A   I+ +  + G F+G
Sbjct: 59  AGGVAGSCA-KTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDRLRGVFQG 117

Query: 276 FLPSFLRSFPXXXXXXXXFE 295
              + LR FP        +E
Sbjct: 118 HSATLLRIFPYAAVKFIAYE 137

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 68/177 (38%), Gaps = 15/177 (8%)

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           S  +I G + G T + +  P +L K +LQ   D         I   +++++  + +    
Sbjct: 8   SSHLIGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLWGTLKEIRSPKQLWRGALPS---- 63

Query: 172 GGVRSLYKGLISTLIFRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFWT 231
               SL   + S L   +  VF     +  TQ     ++   P +  +    S +F   T
Sbjct: 64  ----SLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSF-LPQLTMYENLASGAF---T 115

Query: 232 SAYPSDVVKQVVLCNDKYDG---SFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRSFP 285
                 +   + +   +Y+    S+KS   A   IY   GI GFF G   + +R  P
Sbjct: 116 RGVVGFITMPITIIKVRYESTMYSYKSLGEATRHIYSTEGIRGFFNGCGATVMRDAP 172

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 57/274 (20%), Positives = 108/274 (39%), Gaps = 53/274 (19%)

Query: 12  GFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKN-QGIRGLY 70
           GFV G+ S +    V  PFD +K RLQ ++               ++ TLK  +  + L+
Sbjct: 14  GFVGGLTSAI----VLQPFDLLKTRLQQNKD------------TTLWGTLKEIRSPKQLW 57

Query: 71  LGFTPPLFGWIMMDSALLGSLHNYRMLLHK----YVYPEHDKLP---LSGCIISGVMAGW 123
            G  P      +  +  L +L+ +R  + K     + P    LP   +   + SG     
Sbjct: 58  RGALPSSLRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRG 117

Query: 124 TVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLIS 183
            V FI  P+ + K    V+Y++    Y    +  + ++           G+R  + G  +
Sbjct: 118 VVGFITMPITIIK----VRYESTMYSYKSLGEATRHIYST--------EGIRGFFNGCGA 165

Query: 184 TLI----FRSNFVFWWGSYELITQWFQKNTNLS-----------APAINFWAGGLSASFG 228
           T++    +   +V  +   +L+      ++ +S           +  +N  +  +SAS  
Sbjct: 166 TVMRDAPYAGLYVLLYEKAKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLA 225

Query: 229 FWTSAYPSDVVK-QVVLCNDKYDGSFKSWRTAVS 261
             T   P D +K ++ L   K+ G +K+    VS
Sbjct: 226 -TTITSPFDTIKTRMQLDPTKFSGFYKTLVLIVS 258

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 10/25 (40%), Positives = 18/25 (72%)

Query: 258 TAVSDIYRQRGIHGFFKGFLPSFLR 282
           T  +++YRQ G+  +FKG +P+ +R
Sbjct: 183 TTAAELYRQHGLRAYFKGTMPTLMR 207

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 62/284 (21%), Positives = 109/284 (38%), Gaps = 45/284 (15%)

Query: 5   ETYSRVMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQ 64
           ++ S ++   +G  +G + +    P DT+K RLQ            KG          N 
Sbjct: 2   DSSSFLVSLASGAAAGTSTDLAFFPIDTLKTRLQA-----------KGGF------FANG 44

Query: 65  GIRGLYLGFTPPLFGWIMMDSALLGSLHNYRM----LLHKYVYPEHDKLPLSGCIISGVM 120
           G +G+Y G    +       S    S  + ++    ++ KYV   +        + S  +
Sbjct: 45  GYKGVYRGLGSAVIASAPSASLFFVSYDSMKVYSKPVISKYVTSNNQMADTLSHMFSSSI 104

Query: 121 AGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKG 180
              +   +  P E+ K + Q      T K         K+ +     NG  G +R+LY+G
Sbjct: 105 GEVSACLVRVPAEVIKQRTQ------THKTNSSWQTFTKILQN---ENG-EGVLRNLYRG 154

Query: 181 LISTLIFRSNFV-FWWGSYELITQ-WFQKN-TNLSAPAINFWAGGLSASF---GFWTSAY 234
             +T++    F    +  YE + + W ++N  +  AP    W G +  S        +  
Sbjct: 155 WNTTIMREIPFTCIQFPLYEFLKKTWAKRNGQDHVAP----WQGSVCGSVAGAIAAATTT 210

Query: 235 PSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLP 278
           P DV+K  ++ + K   S    + A  +IY + G   FF G  P
Sbjct: 211 PLDVLKTRLMLSHK---SIPVAQLA-KNIYAEEGFKVFFSGVGP 250

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 33.1 bits (74), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 27/69 (39%), Gaps = 11/69 (15%)

Query: 13  FVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGP---LDCVYKTLKNQGIRGL 69
           FV+ +    A   V  P D +K R+Q           F  P      +  TLKN+G    
Sbjct: 213 FVSSIVGASASLIVSAPLDVIKTRIQNRN--------FDNPESGFKIIKNTLKNEGFTAF 264

Query: 70  YLGFTPPLF 78
           + G TP L 
Sbjct: 265 FKGLTPKLL 273

>Sklu_1982.3 YDL238C, Contig c1982 3793-5223
          Length = 476

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 249 YDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFLRS 283
           YD S K W   V D +R++G   FF GF+ + + +
Sbjct: 60  YDASLKPWEIGVVDTFREQGSTFFFPGFVDTHVHA 94

>Scas_667.29*
          Length = 189

 Score = 32.0 bits (71), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 10/92 (10%)

Query: 21  VAKN--------TVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLG 72
           VAKN        T G+ F   K +L+ + V         G +  +Y  L   G   LY+ 
Sbjct: 55  VAKNDLTTIKYVTPGNSFLGEKEKLEVTTVRDYDLKDIDGSIKSIYTGLAMMGFMHLYMK 114

Query: 73  FTPPLFGWIMMDSALLGSLHNYRMLLHKYVYP 104
           +T PLF  I+  S + G+  N ++ +H +  P
Sbjct: 115 YTNPLFMQII--SPVKGAFENNQVKIHLFGKP 144

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 32.3 bits (72), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 82/192 (42%), Gaps = 30/192 (15%)

Query: 24  NTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLK-NQGI-RGLYLGFTPPLFGWI 81
           ++V H  DTVK R Q    G+   ++++  +   Y+TL   +G+ RGLY G+   + G  
Sbjct: 68  DSVMHSLDTVKTRQQ----GAPGEVKYRH-MISAYRTLALEEGVRRGLYGGYGAAMLGSF 122

Query: 82  MMDSALLGSLH--NYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKL 139
              +   G+      +M+    ++  +  L       +G +     S +  P E+ K +L
Sbjct: 123 PSAAVFFGTYEWVKRQMINEWQIHETYSHL------AAGFLGDLFSSVVYVPSEVLKTRL 176

Query: 140 QVQ--YDAKTTK----YTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFRSNF-V 192
           Q+Q  Y+ +  +    Y G  D V+ + +          GV +L+ G  +TL     F  
Sbjct: 177 QLQGCYNNRHFQSGYNYRGLSDAVRTIVRT--------EGVSALFFGYKATLSRDLPFSA 228

Query: 193 FWWGSYELITQW 204
             +  YE   +W
Sbjct: 229 LQFAFYERFRKW 240

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 12/86 (13%)

Query: 10  VMGFVAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLD---CVYKT----LK 62
           V G  AG  +G+    +  P D VK R+QT   GS        P      ++++    L+
Sbjct: 260 VTGASAGGLAGI----ITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLR 315

Query: 63  NQGIRGLYLGFTPPLFGWIMMDSALL 88
            +G+ G + G   P F W  + S+++
Sbjct: 316 YEGLGGAFSGVG-PRFIWTSIQSSIM 340

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 76/194 (39%), Gaps = 28/194 (14%)

Query: 46  AGIQFKGPLDCVYKTLKNQGIRGLYLGF-TPPLFGWIMMDSAL----LGSLHNYRMLLHK 100
           A  Q+KG LD + +    +G+ GLY G  +  + G+I   S      L   H +R+   K
Sbjct: 68  AAEQYKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHYFRL---K 124

Query: 101 YVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKV 160
                  +      ++ G++A  T      P+ +   + Q +  A      G  D ++ V
Sbjct: 125 QARGGDARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQA-----AGAAD-MRTV 178

Query: 161 FKQGMATNGILGGVRSLYKGLISTLIFRSNFVFWWGSYELITQ----------WFQKNTN 210
            ++  A NG     R  + GL  +L+   N    + +YE + +              +  
Sbjct: 179 AREVHAENGW----RGFWAGLKVSLVLTVNPSITYATYERLREALFPTPAAASHLVDSAA 234

Query: 211 LSAPAINFWAGGLS 224
           L +P  NF  G LS
Sbjct: 235 LLSPGQNFVMGVLS 248

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 50/117 (42%), Gaps = 13/117 (11%)

Query: 29  PFDTVKVRLQTSQVGSGAGIQF-KGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMDSAL 87
           P +  ++RL +         QF  G +    + LK +GI   Y GFTP LF  I  + A 
Sbjct: 135 PLEATRIRLVSQP-------QFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAK 187

Query: 88  LGSLHNYRMLLHKYVYPEHDKLPLSGC----IISGVMAGWTVSFIAAPVELAKAKLQ 140
                      + +  P+ +KL  +      ++SG+ AG   + ++ P +   +K+ 
Sbjct: 188 FLVFERASEFYYGFAGPK-EKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVN 243

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 69/198 (34%), Gaps = 29/198 (14%)

Query: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171
           + C + GV+A         P++L K +LQV      +   G   +V+             
Sbjct: 16  AACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVRS------------ 63

Query: 172 GGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAIN-------FWAGGL 223
            G+  ++ G+ +T I +       +G YE   Q +   +NL +P          +     
Sbjct: 64  EGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTY---SNLLSPETAHRHRTAVYLCASA 120

Query: 224 SASF--GFWTSAYPSDVVKQVVLCNDKYDGSFKSWRTAVSDIYRQRGIHGFFKGFLPSFL 281
           SA F        + +  VKQ            + W    S I    G+ G +KG  P + 
Sbjct: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGW----SKITAAEGLSGLYKGITPLWC 176

Query: 282 RSFPXXXXXXXXFEFVLR 299
           R  P        FE ++ 
Sbjct: 177 RQIPYTMCKFTSFERIVE 194

>Scas_673.17
          Length = 314

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 50/110 (45%), Gaps = 10/110 (9%)

Query: 59  KTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---I 115
           + LK +G+   Y GFTP LF  I  + A          + +  V  +     ++     +
Sbjct: 162 RILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASEVYYGIVGAKETLSDMTNTGINL 221

Query: 116 ISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTG--PIDVVQKVFKQ 163
           +SG+ AG+  +F++ P +   +K+      KT K  G   I ++ ++ KQ
Sbjct: 222 LSGLTAGFAAAFVSQPADTLLSKVN-----KTKKAPGQSTIGLLAQLAKQ 266

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 59  KTLKNQGIRGLYLGFTPPLFGWIMMDSALLGSLHNYRMLLHKYVYPEHDKLPLSGC---- 114
           + LK +G+   Y GFTP LF  I  + A          L    + P  D L  +      
Sbjct: 155 RILKEEGVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFS-LAPPKDTLSQTSLTAIN 213

Query: 115 IISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTG 152
           ++SG+ AG   + ++ P +   +K+      KT+K  G
Sbjct: 214 LLSGLTAGLAAAIVSQPADTLLSKVN-----KTSKAPG 246

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 50/264 (18%), Positives = 94/264 (35%), Gaps = 30/264 (11%)

Query: 25  TVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMD 84
           T+G P +  K  +  ++       QF G    V       G+ G Y G  P    W  ++
Sbjct: 33  TLGQPLEVTKTTMAANR-------QF-GFSQAVRHVWSRGGVFGFYQGLIP----WAWIE 80

Query: 85  SALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYD 144
           ++  G++  +     +Y +           I+ GV  G   +++          +++   
Sbjct: 81  ASTKGAVLLFVSAEAEYQFRRLGLSNFGAGILGGVSGGVAQAYLTMGFCTCMKTVEITRS 140

Query: 145 AKTTKYTGPIDVVQKVFKQGMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYELITQ 203
              +    P+    +VFKQ  A  G+    R + KG+ +  I + +N+   +G   L+  
Sbjct: 141 KAASAPGVPVPSSLQVFKQIFAAEGL----RGINKGVNAVAIRQMTNWGSRFGLSRLVED 196

Query: 204 WFQKNTN---------LSAPAINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYDGSFK 254
             ++ T+         +     +   GGLSA    W        V+     ND       
Sbjct: 197 GIRRVTHKRSDEKLSAMEKIVASALGGGLSA----WNQPIEVIRVEMQSRTNDPNRPKNL 252

Query: 255 SWRTAVSDIYRQRGIHGFFKGFLP 278
           +       IY   G+ G ++G  P
Sbjct: 253 TVGKTFRYIYENNGLRGLYRGVTP 276

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
          (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 5/82 (6%)

Query: 14 VAGMFSGVAKNTVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGF 73
          +AG     A ++   P D VK R+Q   +   +G+     +    K +  +G   L  GF
Sbjct: 20 LAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGM-----VGSFRKIVGEEGAAALLTGF 74

Query: 74 TPPLFGWIMMDSALLGSLHNYR 95
           P L G+ M  +   G    ++
Sbjct: 75 GPTLLGYSMQGAFKFGGYEVFK 96

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 107/271 (39%), Gaps = 44/271 (16%)

Query: 25  TVGHPFDTVKVRLQTSQVGSGAGIQFKGPLDCVYKTLKNQGIRGLYLGFTPPLFGWIMMD 84
           T+G P + +K  +  ++  S             +  +K+   RG   GF   L  W  ++
Sbjct: 34  TLGQPLEVIKTTMAANRSFS------------FFNAIKHVWSRGGVFGFYQGLIPWAWIE 81

Query: 85  SALLGSLHNYRMLLHKYVYPEHDKLPLSGCIISGVMAGWTVSFIAAPVELAKAKLQVQYD 144
           ++  G++  +     +Y +    ++ LS    SG+M G T     A + +         +
Sbjct: 82  ASTKGAVLLFVSAESEYQF---KRMGLSN-FGSGIMGGVTGGVAQAYLTMGFCTCMKTVE 137

Query: 145 AKTTKYTGPIDVVQK---VFKQGMATNGILGGVRSLYKGLISTLIFR-SNFVFWWGSYEL 200
               K  G   + Q     FK+    +GI G    + KG+ +  I + +N+   +G   L
Sbjct: 138 ITKKKSAGAGAIPQSSWGAFKEIYKKDGIKG----INKGVNAVAIRQMTNWGSRFGFSRL 193

Query: 201 ITQWFQKNTNLSAP----------AINFWAGGLSASFGFWTSAYPSDVVKQVVLCNDKYD 250
           + +  +  T  + P          A +   GGLSA    W    P +V++ V + + K D
Sbjct: 194 VEEGIRNATGKTNPDDKLTALEKIAASAIGGGLSA----WNQ--PIEVIR-VEMQSKKED 246

Query: 251 GSFKSWRTAVSD---IYRQRGIHGFFKGFLP 278
            +     T  S    IY+  GI G ++G  P
Sbjct: 247 PNRPKNLTVSSAFKYIYQSSGIKGLYRGVAP 277

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,225,065
Number of extensions: 375487
Number of successful extensions: 2019
Number of sequences better than 10.0: 203
Number of HSP's gapped: 1417
Number of HSP's successfully gapped: 382
Length of query: 301
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 200
Effective length of database: 13,099,691
Effective search space: 2619938200
Effective search space used: 2619938200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 61 (28.1 bits)