Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03861g29429015490.0
Scas_647.4270105910.001
YJR011C261105820.019
KLLA0F12540g12555710.22
KLLA0B13585g146776730.37
CAGL0J08459g801135710.67
Scas_670.11432131690.88
KLLA0C02431g289107652.9
Kwal_27.108521046116644.7
AGR169W77637619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03861g
         (290 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03861g complement(382452..383336) no similarity, hypotheti...   601   0.0  
Scas_647.4                                                             40   0.001
YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protei...    36   0.019
KLLA0F12540g 1162739..1163116 similar to sp|P38204 Saccharomyces...    32   0.22 
KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces...    33   0.37 
CAGL0J08459g complement(839245..841650) similar to sp|P50896 Sac...    32   0.67 
Scas_670.11                                                            31   0.88 
KLLA0C02431g complement(215644..216513) similar to sp|P53843 Sac...    30   2.9  
Kwal_27.10852                                                          29   4.7  
AGR169W [4480] [Homologous to ScYGL009C (LEU1) - SH] complement(...    28   9.9  

>CAGL0B03861g complement(382452..383336) no similarity, hypothetical
           start
          Length = 294

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/290 (100%), Positives = 290/290 (100%)

Query: 1   MEAVCGKELRSDLLQSVERVRDGDKRELLDVMLEFMFDTVSFIRELSSDIFRMEQELDDE 60
           MEAVCGKELRSDLLQSVERVRDGDKRELLDVMLEFMFDTVSFIRELSSDIFRMEQELDDE
Sbjct: 1   MEAVCGKELRSDLLQSVERVRDGDKRELLDVMLEFMFDTVSFIRELSSDIFRMEQELDDE 60

Query: 61  MAQLCVFYRTAIAGVFVLSPDECVTIRKALIDPDPAIPEAVLKRVVSPLYKKAAYYLWYF 120
           MAQLCVFYRTAIAGVFVLSPDECVTIRKALIDPDPAIPEAVLKRVVSPLYKKAAYYLWYF
Sbjct: 61  MAQLCVFYRTAIAGVFVLSPDECVTIRKALIDPDPAIPEAVLKRVVSPLYKKAAYYLWYF 120

Query: 121 IMHCCYAKYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTL 180
           IMHCCYAKYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTL
Sbjct: 121 IMHCCYAKYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTL 180

Query: 181 LHCIKNELLPSWRKVLEDYKAACFDAVMQSRKLKDLFVTVDKSVSDSNFEDTESMHTYLN 240
           LHCIKNELLPSWRKVLEDYKAACFDAVMQSRKLKDLFVTVDKSVSDSNFEDTESMHTYLN
Sbjct: 181 LHCIKNELLPSWRKVLEDYKAACFDAVMQSRKLKDLFVTVDKSVSDSNFEDTESMHTYLN 240

Query: 241 WIDNMLKKFILDSKTDLHVTESDLCSPMPLTLAELKKFSEEKHITDQLEK 290
           WIDNMLKKFILDSKTDLHVTESDLCSPMPLTLAELKKFSEEKHITDQLEK
Sbjct: 241 WIDNMLKKFILDSKTDLHVTESDLCSPMPLTLAELKKFSEEKHITDQLEK 290

>Scas_647.4
          Length = 270

 Score = 39.7 bits (91), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 54/105 (51%), Gaps = 12/105 (11%)

Query: 140 MNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTLLHCIKNELLPSWRKVLEDY 199
           + N + G  N+ N+ +KM +         Q  + +++   L+  ++N+LLP+W+  L+  
Sbjct: 166 LQNCFNGFGNLFNFVKKMPL-------QRQYKVTSLQLDVLITVVRNDLLPTWKTQLDLL 218

Query: 200 KAACFDAVMQSRKLKDLF--VTVDKSVSDSNFEDTESMHTYLNWI 242
               FD + +++ +   +   T D+   DS+ ++ ES   ++NW+
Sbjct: 219 NCKLFDDLSRNQNVVSRYREATNDR---DSDVKEGESFVKFVNWL 260

>YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protein
           of unknown function [786 bp, 261 aa]
          Length = 261

 Score = 36.2 bits (82), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 51/105 (48%), Gaps = 11/105 (10%)

Query: 140 MNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTLLHCIKNELLPSWRKVLEDY 199
           M N   G  N+  +  K+ +        +Q  ++ ++ K L++ ++NELLP W+  L+  
Sbjct: 156 MQNCLSGFVNLYKFLNKIPM------SKQQSQMNDLQMKILVNVLQNELLPIWKFQLDLL 209

Query: 200 KAACFDAVMQSRKLKDLFVTVDKSVSDS--NFEDTESMHTYLNWI 242
               F+ + + + L +++    K+ +DS  +    E    Y+NW+
Sbjct: 210 NCKLFNELSKDKGLINIY---RKATNDSVIDVSKGEPFIRYVNWL 251

>KLLA0F12540g 1162739..1163116 similar to sp|P38204 Saccharomyces
           cerevisiae YBL025w RRN10 RNA polymerase I-specific
           transcription initiation factor singleton, start by
           similarity
          Length = 125

 Score = 32.0 bits (71), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 77  VLSPDECVTIRKALIDPDPAIPEAVLKRVVSPLYKKAAYYLWYFIMHCCYAKYPH 131
           +LSPDEC+ +R   I P P +    L+  +  +  K  +   YF+      +YPH
Sbjct: 20  ILSPDECLGLRLNHIVPIPLLTRDELQTRLPTIDTKVVH---YFLTQLILQRYPH 71

>KLLA0B13585g 1186427..1190830 similar to sp|P33202 Saccharomyces
            cerevisiae YKL010c SOS1, start by similarity
          Length = 1467

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 5/76 (6%)

Query: 129  YPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIK--TKTLLHCIKN 186
            +P E RM  N++ N   G+  ++ YW +  + +    +P +  L  +   T+  L   ++
Sbjct: 1043 FPFETRM--NFLQNTSYGYGRLIQYWRE-KLADQHHSNPTENPLHQLGRLTRHKLRVSRD 1099

Query: 187  ELLPSWRKVLEDYKAA 202
             L  S  K+L+ Y ++
Sbjct: 1100 SLFLSGIKILKKYGSS 1115

>CAGL0J08459g complement(839245..841650) similar to sp|P50896
           Saccharomyces cerevisiae YDR505c PSP1, start by
           similarity
          Length = 801

 Score = 32.0 bits (71), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 60/135 (44%), Gaps = 11/135 (8%)

Query: 126 YAKYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRDQDPEQEALDAIKTKTLLHCIK 185
           Y + P++   ++N M   Y    NI+     +++  + + +P+  +L+  +         
Sbjct: 261 YGQMPNQTATVQNTMPYGYKNTSNIIPLLNNLNLKGENNYNPQNRSLNNQR-------FP 313

Query: 186 NELLPSWRKVLEDYKAACFDAVMQSRKLKDLFVT-VDKSVSDSNFEDTESMHTYLNWIDN 244
           ++  P  R+  +D +   ++A   S++ +D + +  +   + SNFE+ +S H       N
Sbjct: 314 HQNNPGSRQGQKDIQQYPYNA---SKQQQDQYNSRFNHYNNGSNFENVKSSHLNDGAHQN 370

Query: 245 MLKKFILDSKTDLHV 259
             K  I +S  D  +
Sbjct: 371 TSKNHISESSLDFSI 385

>Scas_670.11
          Length = 432

 Score = 31.2 bits (69), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 53/131 (40%), Gaps = 33/131 (25%)

Query: 64  LCVFYRTAIAGVFVLSPDECVTIRKALIDPDPAIPEAVLKRVV--SPLYK---------- 111
           LC+F  T +      S DE VT+ K  + P  +I E +   V+  S L K          
Sbjct: 296 LCIFQNTQLFS----SDDEMVTLDKTKLTPT-SIYEGITLSVIKKSTLQKLELGTEDDYT 350

Query: 112 ----KAAYYLW--YFIMHCCYA-KYPHEQRMIRNYMNNAYLGHRNIVNYWEKMSIVNDRD 164
               +  YYL   Y I +  Y    PH            Y G  +I+NY   + +VN ++
Sbjct: 351 FFNARLGYYLLFIYVIANKIYKISLPHSLH---------YCGSTSIINYERPLHLVNSKN 401

Query: 165 QDPEQEALDAI 175
           +   +E  DAI
Sbjct: 402 RKILKETEDAI 412

>KLLA0C02431g complement(215644..216513) similar to sp|P53843
           Saccharomyces cerevisiae YNL265c IST1 singleton, start
           by similarity
          Length = 289

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 20/107 (18%)

Query: 27  ELLDVMLEFMFDTVSFIRELSSDIFRMEQELDD---EMAQLCVFYRTAIAGVFVLSPDEC 83
           E+L++  E +   V+    +S+++  +E  +DD   E A+  V+     A +++    E 
Sbjct: 70  EILELYCELLHARVAIFNTVSNEVTLIESHVDDGINEAARAIVY-----AAIYIPEIKEL 124

Query: 84  VTIR------------KALIDPDPAIPEAVLKRVVSPLYKKAAYYLW 118
           V I+            KA+I+    +PE VL++    L KK    L+
Sbjct: 125 VQIKDMLGLKFGNEFVKAIIEDKIGVPEKVLQKCSPRLPKKELVELY 171

>Kwal_27.10852
          Length = 1046

 Score = 29.3 bits (64), Expect = 4.7,   Method: Composition-based stats.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 19/116 (16%)

Query: 51  FRMEQELDDEMAQLCVFYRTAIAGVFVLSPDECVTIRK---ALIDPDPAIPEAVLKRVVS 107
           FR    L +  A+LC      + G  ++SPD  +  R+   AL     AI E  LKR+  
Sbjct: 535 FRQLICLANFQAKLC-----NMMGSSIVSPDGLMDARERAGAL-----AILERELKRLNI 584

Query: 108 PL-YKKAA----YYLWYFIMHCCYAKYPHEQRMIRN-YMNNAYLGHRNIVNYWEKM 157
            L ++K      YYL+  +M CC+A  P      ++ Y+  AYL    +V    K+
Sbjct: 585 KLNFEKDTVVEMYYLYVKLMICCFAFLPGTPTEDQSKYVTEAYLSSTKVVTLLTKL 640

>AGR169W [4480] [Homologous to ScYGL009C (LEU1) - SH]
           complement(1064322..1066652) [2331 bp, 776 aa]
          Length = 776

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 18/37 (48%)

Query: 88  KALIDPDPAIPEAVLKRVVSPLYKKAAYYLWYFIMHC 124
           KA +D D  IP+  LK +     K+  +Y W F  H 
Sbjct: 561 KANVDTDAIIPKQFLKTIKRTGLKEGLFYDWRFAKHA 597

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,633,911
Number of extensions: 416038
Number of successful extensions: 1395
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1394
Number of HSP's successfully gapped: 16
Length of query: 290
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 189
Effective length of database: 13,099,691
Effective search space: 2475841599
Effective search space used: 2475841599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)