Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03839g50749925950.0
Scas_647.251150322010.0
YJR010W (MET3)51150321520.0
Sklu_2014.150650120470.0
Kwal_33.1543450550020170.0
KLLA0E09812g50250120050.0
AGR322W50049917990.0
KLLA0B02827g94242720.98
Scas_704.9309112692.1
Scas_709.1068147692.3
KLLA0E03553g52766664.6
YKL079W (SMY1)65649649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03839g
         (499 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...  1004   0.0  
Scas_647.2                                                            852   0.0  
YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...   833   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            793   0.0  
Kwal_33.15434                                                         781   0.0  
KLLA0E09812g complement(870664..872172) highly similar to sp|P08...   776   0.0  
AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...   697   0.0  
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    32   0.98 
Scas_704.9                                                             31   2.1  
Scas_709.10                                                            31   2.3  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    30   4.6  
YKL079W (SMY1) [3182] chr11 (286248..288218) Protein of the kine...    29   9.7  

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/499 (97%), Positives = 488/499 (97%)

Query: 1   MPAPHGGVLQDLVARDASKRDXXXXXXXXXXXWTLTARQICDIELILNGGFSPLTGFLAQ 60
           MPAPHGGVLQDLVARDASKRD           WTLTARQICDIELILNGGFSPLTGFLAQ
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLLSESQQLSQWTLTARQICDIELILNGGFSPLTGFLAQ 60

Query: 61  EDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIYK 120
           EDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIYK
Sbjct: 61  EDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIYK 120

Query: 121 PDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRLE 180
           PDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRLE
Sbjct: 121 PDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRLE 180

Query: 181 FQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRVY 240
           FQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRVY
Sbjct: 181 FQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRVY 240

Query: 241 QEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKGV 300
           QEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKGV
Sbjct: 241 QEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKGV 300

Query: 301 DFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTELR 360
           DFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTELR
Sbjct: 301 DFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTELR 360

Query: 361 KRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQF 420
           KRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQF
Sbjct: 361 KRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQF 420

Query: 421 GGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADIK 480
           GGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADIK
Sbjct: 421 GGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADIK 480

Query: 481 LASTEETIFHIVQKVVLFL 499
           LASTEETIFHIVQKVVLFL
Sbjct: 481 LASTEETIFHIVQKVVLFL 499

>Scas_647.2
          Length = 511

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/503 (81%), Positives = 445/503 (88%), Gaps = 4/503 (0%)

Query: 1   MPAPHGGVLQDLVARDASKRDXXXXXXXX--XXXWTLTARQICDIELILNGGFSPLTGFL 58
           MPAPHGG+LQDLVARDASK+              WTLTARQICDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118
            ++DY  VV NSRL+DGTLWTMPITLDV E FA SV PN RI LLQDG IP+AILTV D+
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178
           Y+PDK++EA++VFRGDPEHPAI YL N AG+YYIGG+L+AIQLPQHYDYPGLRK PAQLR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238
           LEFQSRQWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298
           VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPGSNSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358
           GVDFYGPYDAQELVESYKNELDI VVPFRMVTYLPDEDRYAPID+IDTSKTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418
           LRKRLR GGEIPEWFSYPEVVKILRESNPPRPKQGFA+V  D +     QL+IALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSA--NVYTIGHAKD 476
           QFGGGRHYK+++H +  + LELI DF+QAGSGLI+P+ W++ N    A  NVYT+G + +
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 477 ADIKLASTEETIFHIVQKVVLFL 499
           +DIKL S +ETIFHIVQKVVLFL
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLFL 503

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/503 (79%), Positives = 442/503 (87%), Gaps = 4/503 (0%)

Query: 1   MPAPHGGVLQDLVARDASKRDXXXXXXXXX--XXWTLTARQICDIELILNGGFSPLTGFL 58
           MPAPHGG+LQDL+ARDA K++             W LT RQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118
            + DY+ VV +SRL+DGTLWT+PITLDV E FAN +KP+ RIAL QD  IP+AILTV+D+
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178
           YKP+K++EAEKVFRGDPEHPAI+YLFN AGDYY+GG+L+AIQLPQHYDYPGLRKTPAQLR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238
           LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298
           VYQEIIKRYPNGIAFLSLLPLAMRM GDREAVWHAIIRKNYGASHFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358
           GVDFYGPYDAQELVESYK+ELDI+VVPFRMVTYLPDEDRYAPID+IDT+KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418
           LR+RLR GGEIPEWFSYPEVVKILRESNPPRPKQGF++V  + + V R+QLSIALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWS--ASNKVNSANVYTIGHAKD 476
           QFGGGR+YKI++HN+K E L LI DF+ +GSGLIIP+ W     + V   NVY +  +  
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 477 ADIKLASTEETIFHIVQKVVLFL 499
           ADI+L S +E I HIVQKVVLFL
Sbjct: 481 ADIQLESADEPISHIVQKVVLFL 503

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/501 (75%), Positives = 437/501 (87%), Gaps = 5/501 (0%)

Query: 1   MPAPHGGVLQDLVARDAS-KRDXXXXXXXXXXXWTLTARQICDIELILNGGFSPLTGFLA 59
           MPAPHGGVLQDL+ARDAS K             W+LT RQICD+ELILNGGFSPLTGFL 
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSKLTWSLTGRQICDLELILNGGFSPLTGFLN 60

Query: 60  QEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIY 119
           ++DY  VV++SRLS+G +WTMPITLDV  +FA+ ++ + RI LLQ+  IP+A LTV D+Y
Sbjct: 61  EKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDVY 120

Query: 120 KPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRL 179
           KPDKSVEA+KVFRGDPEHPAI+YL N AG+YY+GG L AIQLPQHYDYPGLR+TPAQLRL
Sbjct: 121 KPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLRL 180

Query: 180 EFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRV 239
           EF S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAK+LIHPVVGLTKPGDIDHHTRVRV
Sbjct: 181 EFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVRV 240

Query: 240 YQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKG 299
           YQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSKG
Sbjct: 241 YQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSKG 300

Query: 300 VDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTEL 359
           VDFYG YDAQELVESYKNEL+I+VVPFRMVTYLPDEDRYAPID+ID + T+TLNISGTEL
Sbjct: 301 VDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTEL 360

Query: 360 RKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQ 419
           R RLRDGGEIP WFSYPEVVKILRES+PPRP QGFA+V +D +K ++ QLSIALLSTFLQ
Sbjct: 361 RNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLKNNK-QLSIALLSTFLQ 419

Query: 420 FGGGRHYKIYDH-NDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDAD 478
           FGGGRHYKI++H N+  E +ELI DF+++G+GLI+P  ++ S+  ++ NV+T+G A DA+
Sbjct: 420 FGGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSS--DATNVFTVGVADDAE 477

Query: 479 IKLASTEETIFHIVQKVVLFL 499
           IKL S +E I H+VQKVVLFL
Sbjct: 478 IKLESEDEPILHVVQKVVLFL 498

>Kwal_33.15434
          Length = 505

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/500 (74%), Positives = 422/500 (84%), Gaps = 4/500 (0%)

Query: 1   MPAPHGGVLQDLVARDAS-KRDXXXXXXXXXXXWTLTARQICDIELILNGGFSPLTGFLA 59
           MPAPHGG+LQDL+ARDA  K             W LTARQICD+ELI NGGFSPL+GFL 
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60

Query: 60  QEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIY 119
           Q+DY  VVHNSRLS+  +WT+PITLDV  +FA  +KP  R+ LLQD  IPVAILTV D+Y
Sbjct: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120

Query: 120 KPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRL 179
           KPDK VEA+KVFRGDPEHPA+ YL  TAG+YY+GG + AIQ P HYDYPGLRKTPAQLRL
Sbjct: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180

Query: 180 EFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRV 239
           EF+S+QWDR+VAFQTRNPMHRAHRELTVRAARE NAKVLIHPVVGLTKPGDIDHHTRVRV
Sbjct: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240

Query: 240 YQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKG 299
           YQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGA+HFIVGRDHAGPG NS G
Sbjct: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300

Query: 300 VDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTEL 359
           VDFYG YDAQELVE+YK+ELDI+VVPFRMVTYLPDEDRYAPID+ID S T+TLNISGTEL
Sbjct: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360

Query: 360 RKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQ 419
           R RLR GG IPEWFSYPEVVKILRESNPPRP+QGFA+V +  +  ++ QL+ ALLSTFLQ
Sbjct: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNK-QLATALLSTFLQ 419

Query: 420 FGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADI 479
           FGGGRHYK+ +H+D+   LEL+ DF+++G+GLIIPS +   N   + N Y +G +  ADI
Sbjct: 420 FGGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEY--KNASATTNAYQVGTSDGADI 477

Query: 480 KLASTEETIFHIVQKVVLFL 499
           KL S +E++ H+VQKVVLFL
Sbjct: 478 KLESNDESVLHVVQKVVLFL 497

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/501 (74%), Positives = 422/501 (84%), Gaps = 9/501 (1%)

Query: 1   MPAPHGGVLQDLVARDASKRDXXXXXXXX--XXXWTLTARQICDIELILNGGFSPLTGFL 58
           MP+PHGGVLQDLVARDASK+              W+LTARQICD+ELILNGGFSPL GFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 59  AQEDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDI 118
            Q+DY  VV  SRL +G +WT+PITLDV  +FA+ + P+QRI LLQD   P+AILTV D+
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 119 YKPDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLR 178
           Y+PDK+VEA+KVFRGDPEHPA+ YLF  AG++Y+GG+L+AIQLP HYDYPG RKTPAQLR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 179 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVR 238
           LEF+S+QWDRVVAFQTRNPMHRAHRELTVRAAR  N+K+LIHPVVGLTKPGDIDHHTRVR
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSK 298
           VYQEIIKRYPNG+A LSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 299 GVDFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTE 358
           GVDFYGPYDAQELVESYKNELDI+VVPFRMVTYLPDEDRYAPIDEIDT KTRTLNISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 359 LRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFL 418
           LR RLRDGGEIP WFSYPEVVKILRESNP RPKQGFALV ++ +     QL  ALLSTFL
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPA---QLKTALLSTFL 417

Query: 419 QFGGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDAD 478
           Q+GGGRHYK+ +H +  E L L+ DFV++G+GLI+ +    ++ +   NV+ IG    +D
Sbjct: 418 QYGGGRHYKVLEHGNNEEILALVPDFVRSGTGLILQN----ASSLKGTNVFKIGEESGSD 473

Query: 479 IKLASTEETIFHIVQKVVLFL 499
           I L + ++ I HIVQ+VVLFL
Sbjct: 474 IPLETEDKNILHIVQRVVLFL 494

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/499 (68%), Positives = 405/499 (81%), Gaps = 7/499 (1%)

Query: 1   MPAPHGGVLQDLVARDASKRDXXXXXXXXXXXWTLTARQICDIELILNGGFSPLTGFLAQ 60
           M +PHGG+LQDLVARDA K+D           W LTARQ+CDIELILNGGFSPLTGFL +
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQGLPQWNLTARQLCDIELILNGGFSPLTGFLGK 60

Query: 61  EDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIYK 120
           EDY  VV NSRL+ G LWT+PITLDV E+FA SV   +RIALLQD  I VAI+TV DIY 
Sbjct: 61  EDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIYT 120

Query: 121 PDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRLE 180
           PDK VEA+KVFRGD EHPAI YL  TAGD Y+GG L+AIQLP HYDY  LRK+PA LR +
Sbjct: 121 PDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRAD 180

Query: 181 FQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRVY 240
           F ++QWDRVVAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++VY
Sbjct: 181 FATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKVY 240

Query: 241 QEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKGV 300
           +EI+KRYP GIA L+LLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG+NSKG 
Sbjct: 241 KEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKGD 300

Query: 301 DFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTELR 360
           DFYGPYDAQ LVESYKNEL I+VVPF+++TYLPD+D Y P+DEID S  +TL ISGTELR
Sbjct: 301 DFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTELR 359

Query: 361 KRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQF 420
           KRLR+G +IP+WF+YPE+V+ILR+ NPPR +QGF +V N +   +  +++ ALLSTFLQ 
Sbjct: 360 KRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHE---NPKRIANALLSTFLQV 416

Query: 421 GGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADIK 480
           GGGR YKI+DH  +P+ LELI DFV++G+GLI+ S   +S  V++ N+Y +     A IK
Sbjct: 417 GGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSS--VDAHNIYELNTYPSAHIK 474

Query: 481 LASTEETIFHIVQKVVLFL 499
           +++T E +  IVQK V FL
Sbjct: 475 VSAT-EPVTEIVQKTVFFL 492

>KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces
           cerevisiae YLR409c singleton, start by similarity
          Length = 942

 Score = 32.3 bits (72), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 230 DIDHHTRVRVYQEIIKRYPNGIA---FLSLLPLAMRMGGDRE 268
           D+DH +RV+V + I K    G+A   FL+  P+ +  GGD +
Sbjct: 279 DLDHRSRVQVLKGIHKEVNGGVARASFLNGQPIVVTCGGDNQ 320

>Scas_704.9
          Length = 309

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 49/112 (43%), Gaps = 20/112 (17%)

Query: 365 DGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQFGGGR 424
           D  EI  + +YPEV   LRESN PR +      ++  +K+  D   IA L+  L+  G  
Sbjct: 59  DAAEI--YRTYPEVAAALRESNRPRDEIFITDKYSTQLKLSDD--PIAGLNISLKTLGLD 114

Query: 425 HYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKD 476
           +  +Y          L S F++ GS L     W    K     +Y  G AK+
Sbjct: 115 YVDLY---------LLHSPFIKNGSTL--EECWKQMEK-----LYKSGKAKN 150

>Scas_709.10
          Length = 681

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 358 ELRKRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKV 404
           E  KRL    E+PE  +  +++ I+ ++  P  +Q   LVFN D+K 
Sbjct: 278 EFAKRLYSNNEVPE-LTEIQIMDIINKNFAPLEEQKLHLVFNYDVKT 323

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 384 ESNPPRPKQGFALVFNDDIKVDRD--QLSIALLSTFLQFGGGRHYKIYDHNDKPEFLELI 441
           E NP R     A  +  + KVD     +S  + S +L FGGGRH  I +H    +   ++
Sbjct: 426 EFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEHFAYMQLGTIL 485

Query: 442 SDFVQA 447
           S++++ 
Sbjct: 486 SNYIRT 491

>YKL079W (SMY1) [3182] chr11 (286248..288218) Protein of the kinesin
           family, can interact with or substitute for Myo2p [1971
           bp, 656 aa]
          Length = 656

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 10/49 (20%)

Query: 186 WDRVVAFQTRNPMHRAHRE----------LTVRAARETNAKVLIHPVVG 224
           ++  V F+T NP+H   +E              A +E   K L+HP++ 
Sbjct: 52  YENTVLFRTNNPLHETTKETHSTFQFDKVFDANATQEDVQKFLVHPIIN 100

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.138    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,839,540
Number of extensions: 758392
Number of successful extensions: 1685
Number of sequences better than 10.0: 15
Number of HSP's gapped: 1715
Number of HSP's successfully gapped: 15
Length of query: 499
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 393
Effective length of database: 12,926,601
Effective search space: 5080154193
Effective search space used: 5080154193
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)