Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03201g31831315800.0
Scas_675.263193153072e-32
YKR011C3533302425e-23
Kwal_14.24142933001711e-13
AAL180C2973041701e-13
KLLA0C09372g2941081251e-07
KLLA0F05775g30961634.9
KLLA0B01804g324241628.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03201g
         (313 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02...   613   0.0  
Scas_675.26                                                           122   2e-32
YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protei...    98   5e-23
Kwal_14.2414                                                           70   1e-13
AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)...    70   1e-13
KLLA0C09372g 816494..817378 weakly similar to sp|Q02209 Saccharo...    53   1e-07
KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyce...    29   4.9  
KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyce...    28   8.4  

>CAGL0B03201g complement(313239..314195) weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5, hypothetical
           start
          Length = 318

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/313 (94%), Positives = 295/313 (94%)

Query: 1   MSGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVF 60
           MSGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVF
Sbjct: 1   MSGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVF 60

Query: 61  LGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120
           LGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD
Sbjct: 61  LGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120

Query: 121 DWREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHATA 180
           DWREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHATA
Sbjct: 121 DWREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHATA 180

Query: 181 STEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKXXXXXXXXXXXXX 240
           STEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRK             
Sbjct: 181 STEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKDSIMESISEDSCE 240

Query: 241 XXXXXRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVENFEDVYLDKYSK 300
                RVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVENFEDVYLDKYSK
Sbjct: 241 DEEMIRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVENFEDVYLDKYSK 300

Query: 301 YPERKRRKQATNR 313
           YPERKRRKQATNR
Sbjct: 301 YPERKRRKQATNR 313

>Scas_675.26
          Length = 319

 Score =  122 bits (307), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 154/315 (48%), Gaps = 24/315 (7%)

Query: 2   SGETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVF 60
           + ET+Y+  G+N   V+L++V    D  +L+ YF  IQD+ +++F+  ETI +NLK    
Sbjct: 3   TSETIYLYPGDNQPKVKLTRVRQFADFSDLIKYFHSIQDTYLIEFQICETITENLK---- 58

Query: 61  LGNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120
           L +T   +  P +I+E+N+  + F VW+S+G+W   + V Q +    +   +   KTK+ 
Sbjct: 59  LTSTSSLATSPTFIIEYNEIYDSFYVWKSEGKWEMTDIVTQIY----NTQSQPKAKTKTP 114

Query: 121 D-----WR-EFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQA 174
           +     W  +F    R++ H  K  L+ +L  LNVDWS  + + FW ++DN C++D+   
Sbjct: 115 NGATKSWEVQFKNDPRLKSHRKKDILKLALNNLNVDWSMVDINEFWNQLDNICQIDSHMG 174

Query: 175 SKHATASTEGFHHIVLLALIKAELSKNKHVIKNQIDAF--HARMSRKHRFRKSRKXXXXX 232
           ++ +  S       +++AL +  +S+NK +++  I  +    R +               
Sbjct: 175 NESSCKS------FIVMALFRTRISRNKKLLQKLISEYGERCRNNSTEAITSDNSAELAI 228

Query: 233 XXXXXXXXXXXXXRVRSLSPNYTTATHSPRAVEDIDNETSKQIMSNFNMLFKPIVENFED 292
                         +++ S N   + H P +  D  +  +KQ+ SNFN  FK   E++E 
Sbjct: 229 EDSPLADLPIEEEGLKTSSSNQHYSYHQP-STRDSKDIVAKQVFSNFNRHFKVTAEDYEL 287

Query: 293 VYLDKYSKYPERKRR 307
             L   +  P + RR
Sbjct: 288 FDLKTKAGIPRKLRR 302

>YKR011C (YKR011C) [3267] chr11 complement(461278..462339) Protein
           of unknown function [1062 bp, 353 aa]
          Length = 353

 Score = 97.8 bits (242), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 150/330 (45%), Gaps = 36/330 (10%)

Query: 4   ETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFLG 62
           ETVY+  GE    V+L+ +       +++ +   IQ+   ++ + SETI +NLK++    
Sbjct: 5   ETVYLYAGEEQPRVKLTCIKEGLTLTQVIKFVHSIQELYGIELQTSETITENLKIDC--A 62

Query: 63  NTHIKSG-MP-FYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120
             ++K   +P FYI+E+ +  + F +W+SDG+W  ++     + D        A   K+ 
Sbjct: 63  PAYLKPNCIPHFYILEYEEISDTFFIWKSDGRWQLNKLSALLYVDN------DANVVKNT 116

Query: 121 DWRE-FVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHAT 179
            W+E F   +R + +  +  L+N L+K+N D S  N   FW + D  C+  AKQ  K   
Sbjct: 117 SWKEVFQNDQRFKNYDKRAWLQNCLEKMNRDLSKLNVEQFWSQYDKICQSIAKQKKKQEQ 176

Query: 180 ASTE---GFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFR-KSRKXXXXXXXX 235
            + E    F +IV +A+IK ++  NK ++   +  +H  M +K+  + ++ K        
Sbjct: 177 FNMEVFDNFKNIVSIAIIKTKVLSNKRLLTTTLKNYHNSMKKKYNIQEQNLKENSLASCS 236

Query: 236 XXXXXXXXXXRVRSLSPNYTTATHS----------------PRAVEDID----NETSKQI 275
                       R  SP  + +  S                P +  +++    + T+  I
Sbjct: 237 NNEPSASLESESRHFSPVNSLSPSSLSTDDEAVSTDYIYKGPESKPNVNFMHSSATNDLI 296

Query: 276 MSNFNMLFKPIVENFEDVYLDKYSKYPERK 305
            SNF   FK + E++E   L  +S+   RK
Sbjct: 297 KSNFESYFKLMAEDYETFDLRAWSRQRPRK 326

>Kwal_14.2414
          Length = 293

 Score = 70.5 bits (171), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 133/300 (44%), Gaps = 36/300 (12%)

Query: 2   SGETVYVRGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFL 61
           + + +YV   + + V+L+ V   ++  ++  +   +QD+  V+  C  TI DNLK++   
Sbjct: 8   AAQEIYVPIGDDQSVKLTLVSLFQNISQVRRFLHSVQDTFSVELNCCVTITDNLKIQCV- 66

Query: 62  GNTHIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNHRSAKKTKSDD 121
            +    +  P YI+EF+D  + +++W+S G W A   ++   Y T +G  R     K+  
Sbjct: 67  -SHRACNSCPLYILEFDDVSQGYALWKSPGDW-ALGIMLTSLYATKNGARRVHPTLKA-- 122

Query: 122 WREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWK------EIDNHCRVDAKQAS 175
               V  +   +H     +E +L+KLNVDW N +    +       E      +  +  S
Sbjct: 123 ---LVAEQVSSKHDAPFLME-TLQKLNVDWDNIDTRFDFTLFLKLLEEALELEIGTRDYS 178

Query: 176 KHATASTE-GFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKXXXXXXX 234
            +    T   +  ++ +A+++ +++ +K +++  +  + +RM         R        
Sbjct: 179 SYLDIVTRLQYKSLMTMAVLRTKVAVSKRLLEKSLCDYDSRM---------RAADDACKE 229

Query: 235 XXXXXXXXXXXRVRSLSPNYTTATHSPRAVEDIDNE---TSKQIMSNFNMLFKPIVENFE 291
                       V S SP    +T +P      D+E   +SKQ+++NF   F+ + E FE
Sbjct: 230 ASREASVLSDSIVHSRSP----STSAPVP----DDEYLLSSKQLVTNFQNHFRNMAETFE 281

>AAL180C [7] [Homologous to ScYKR011C (TOS5) - SH] (23977..24870)
           [894 bp, 297 aa]
          Length = 297

 Score = 70.1 bits (170), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/304 (23%), Positives = 128/304 (42%), Gaps = 63/304 (20%)

Query: 4   ETVYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEVFLG 62
           E +YV  GEN   VRL  +      +E+  Y   +QD   ++    ETI  NLK+     
Sbjct: 10  EELYVYSGENMPRVRLCLLRRYSCVEEVEAYVGRVQDRYTLRLGTVETITGNLKIGC--- 66

Query: 63  NTHIKS-GMPFYIVEFNDSDEEFSVWR-SDGQWGADEAVVQGWYDTLHGNHRSAKKTKSD 120
           +TH      PFYI+E+N+   E+S+W+ +D  W  D  V      T++       + +  
Sbjct: 67  DTHADCEACPFYILEYNEVTTEYSLWKAADADWRLDSIVA-----TMYTGAGGPARERGG 121

Query: 121 DWREFVGTKRMQEHPNKIELENSLKKLNVDWSNCNASVFWKEIDNHCRVDAKQASKHATA 180
             RE  G   ++E  +   + + L++LN+     + + F + +++   + AK+ +     
Sbjct: 122 LPRELQG---LREGLDMEYVWDCLRRLNLPLEQIDWAEFRELLESM--LAAKRVADDDCV 176

Query: 181 STEGFHHIVLLALIKAELSKNKHVIKNQIDAFHARMSRKHRFRKSRKXXXXXXXXXXXXX 240
           +  G   +V LA ++A +  +K  +++Q+ A+                            
Sbjct: 177 TLRG---VVALAALQATVQTSKRAVRSQLRAYD--------------------------- 206

Query: 241 XXXXXRVRSLSPNYTTATHSPRAVEDIDNETSK-------------QIMSNFNMLFKPIV 287
                RVR+ S   +T T SP ++   D+  S              Q+ +NF   F+ + 
Sbjct: 207 ----RRVRAASTPASTRTSSPESLLPADSRESSVSSVHYTYGLPATQLDANFKTYFRSMA 262

Query: 288 ENFE 291
           ENFE
Sbjct: 263 ENFE 266

>KLLA0C09372g 816494..817378 weakly similar to sp|Q02209
           Saccharomyces cerevisiae YKR011c TOS5 hypothetical
           protein singleton, start by similarity
          Length = 294

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 57/108 (52%), Gaps = 7/108 (6%)

Query: 6   VYV-RGENGEVVRLSQVLACEDSKELVNYFWGIQDSRMVKFKCSETIADNLKVEV-FLGN 63
           +YV  GEN   V L+++      +E++ Y   +QD   ++ +  ETI  NLK++     +
Sbjct: 4   IYVYAGENKPKVELTKIKNVPRIEEIIRYLHRMQDVFQLQLRAVETITGNLKIKSNSHSD 63

Query: 64  THIKSGMPFYIVEFNDSDEEFSVWRSDGQWGADEAVVQGWYDTLHGNH 111
                  PFYI+E+  +++ +S+W+S  +W    A+      TL+G++
Sbjct: 64  DTDDHDKPFYILEYCVAEDTYSLWKSRSEWKLSSAIA-----TLYGSN 106

>KLLA0F05775g 560270..561199 similar to sgd|S0002282 Saccharomyces
           cerevisiae YDL124w, start by similarity
          Length = 309

 Score = 28.9 bits (63), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 96  DEAVVQGWYDTLHGNHRSAKKTKSDDW--REFVGTKRMQEHPNKIELENSLKKLNVDWSN 153
           D A +   Y  L    +  KK + + +   ++   K++ E+P K+ LE SLKKL VD+ +
Sbjct: 59  DAAEIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENP-KVALETSLKKLGVDYVD 117

Query: 154 C 154
            
Sbjct: 118 L 118

>KLLA0B01804g 144223..153951 similar to sgd|S0002865 Saccharomyces
           cerevisiae YDR457w TOM1 E3 ubiqitin ligase required for
           G2/M transition, start by similarity
          Length = 3242

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 264 VEDIDNETSKQIMSNFNMLFKPIVENFEDVYLDKYSKYPER 304
           V  +D +T +  +   N+L + IV     VY+D++S +PER
Sbjct: 832 VLSLDPDTVENTLRKVNIL-QVIVSTITSVYIDRFSLFPER 871

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.130    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,051,875
Number of extensions: 412907
Number of successful extensions: 1392
Number of sequences better than 10.0: 20
Number of HSP's gapped: 1381
Number of HSP's successfully gapped: 22
Length of query: 313
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 212
Effective length of database: 13,099,691
Effective search space: 2777134492
Effective search space used: 2777134492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)