Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0B03179g92791341550.0
Scas_675.2413193444761e-48
CAGL0H02783g17853684057e-40
YJL076W (NET1)11893423975e-39
AAL181C12213583887e-38
Kwal_14.242112053283832e-37
Scas_711.389983333369e-32
KLLA0C09394g11842603102e-28
YKR010C (TOF2)7711552367e-20
Scas_691.3372146685.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B03179g
         (913 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...  1605   0.0  
Scas_675.24                                                           187   1e-48
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   160   7e-40
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   157   5e-39
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   154   7e-38
Kwal_14.2421                                                          152   2e-37
Scas_711.38                                                           134   9e-32
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   124   2e-28
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...    96   7e-20
Scas_691.33                                                            31   5.7  

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score = 1605 bits (4155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 825/913 (90%), Positives = 825/913 (90%)

Query: 1   MYKLQVVLIQPQNQLKANGYSIDGDNSDDQTITTIRNGGHIIRDHTRKFLHFTKPENTLL 60
           MYKLQVVLIQPQNQLKANGYSIDGDNSDDQTITTIRNGGHIIRDHTRKFLHFTKPENTLL
Sbjct: 1   MYKLQVVLIQPQNQLKANGYSIDGDNSDDQTITTIRNGGHIIRDHTRKFLHFTKPENTLL 60

Query: 61  QLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDVFSMDNTVLVILKNELE 120
           QLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDVFSMDNTVLVILKNELE
Sbjct: 61  QLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDVFSMDNTVLVILKNELE 120

Query: 121 FIDANGTLNANDLHDAGRISAYSSVRKRRSSKAFGNSSRIEPQILVPKRSKPNNLAPLSN 180
           FIDANGTLNANDLHDAGRISAYSSVRKRRSSKAFGNSSRIEPQILVPKRSKPNNLAPLSN
Sbjct: 121 FIDANGTLNANDLHDAGRISAYSSVRKRRSSKAFGNSSRIEPQILVPKRSKPNNLAPLSN 180

Query: 181 NLRVTSPLANEISNDEINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISS 240
           NLRVTSPLANEISNDEINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISS
Sbjct: 181 NLRVTSPLANEISNDEINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISS 240

Query: 241 GIGDGKRIFSESQNLDVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISES 300
           GIGDGKRIFSESQNLDVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISES
Sbjct: 241 GIGDGKRIFSESQNLDVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISES 300

Query: 301 QPKSLVFSKKRINSPINNHIDVQLENDSNTARGKKLVGAERKILPNTRNSDSPTNRNDKR 360
           QPKSLVFSKKRINSPINNHIDVQLENDSNTARGKKLVGAERKILPNTRNSDSPTNRNDKR
Sbjct: 301 QPKSLVFSKKRINSPINNHIDVQLENDSNTARGKKLVGAERKILPNTRNSDSPTNRNDKR 360

Query: 361 TSSLELKVHNKRVNSTNIPIIEDVLKRIDNFSDTEEGQIVHNPVRSTSLASRQYQVDYGT 420
           TSSLELKVHNKRVNSTNIPIIEDVLKRIDNFSDTEEGQIVHNPVRSTSLASRQYQVDYGT
Sbjct: 361 TSSLELKVHNKRVNSTNIPIIEDVLKRIDNFSDTEEGQIVHNPVRSTSLASRQYQVDYGT 420

Query: 421 NTTDEKDSVRSIIGSDKEQTMCRSEESTKSLGTSLDPTTETEKIALGVINGPSSLPNSKK 480
           NTTDEKDSVRSIIGSDKEQTMCRSEESTKSLGTSLDPTTETEKIALGVINGPSSLPNSKK
Sbjct: 421 NTTDEKDSVRSIIGSDKEQTMCRSEESTKSLGTSLDPTTETEKIALGVINGPSSLPNSKK 480

Query: 481 ENKELAVKLHNTNLNDSPNATEINTKTPKKNTDKAXXXXXXXXXXXXXXXXXXXXXXXXX 540
           ENKELAVKLHNTNLNDSPNATEINTKTPKKNTDKA                         
Sbjct: 481 ENKELAVKLHNTNLNDSPNATEINTKTPKKNTDKASSVSKTSPVKTSSSKVSSPKKTPTL 540

Query: 541 XXXXQAIVDHEYPDESKKRKSPIAKEVRNITDNKKSSNVRTPSKSLKVNNMELSLKSLIS 600
               QAIVDHEYPDESKKRKSPIAKEVRNITDNKKSSNVRTPSKSLKVNNMELSLKSLIS
Sbjct: 541 SKKLQAIVDHEYPDESKKRKSPIAKEVRNITDNKKSSNVRTPSKSLKVNNMELSLKSLIS 600

Query: 601 QQSTPNNLERSATKEKTDYDTMKDNLRETLSALKQIXXXXXXXXXXXXXXXXXXXEIKEK 660
           QQSTPNNLERSATKEKTDYDTMKDNLRETLSALKQI                   EIKEK
Sbjct: 601 QQSTPNNLERSATKEKTDYDTMKDNLRETLSALKQIKSVASPTSAKSKTAAEKITEIKEK 660

Query: 661 VLKTITNAEKPLTVKLANGNISAGKNEKVDNEQIAKGIPVKISKISSQPHVATTPRKENR 720
           VLKTITNAEKPLTVKLANGNISAGKNEKVDNEQIAKGIPVKISKISSQPHVATTPRKENR
Sbjct: 661 VLKTITNAEKPLTVKLANGNISAGKNEKVDNEQIAKGIPVKISKISSQPHVATTPRKENR 720

Query: 721 AQPSTSALRKSPRISSQSNKTNTKSISATPNKSANEKPLSTSRDTIRSSQNGSSKETVSN 780
           AQPSTSALRKSPRISSQSNKTNTKSISATPNKSANEKPLSTSRDTIRSSQNGSSKETVSN
Sbjct: 721 AQPSTSALRKSPRISSQSNKTNTKSISATPNKSANEKPLSTSRDTIRSSQNGSSKETVSN 780

Query: 781 DQSSSHNIQNXXXXXXXXXXXXQPVHNSNRLQQQDNSISEPSSAKKHGMASRYEKAGLIK 840
           DQSSSHNIQN            QPVHNSNRLQQQDNSISEPSSAKKHGMASRYEKAGLIK
Sbjct: 781 DQSSSHNIQNSKSTKSAVVSSSQPVHNSNRLQQQDNSISEPSSAKKHGMASRYEKAGLIK 840

Query: 841 KVKLLRKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKQKLVGNSQTESNGTDKGTSGRQ 900
           KVKLLRKE                            PKQKLVGNSQTESNGTDKGTSGRQ
Sbjct: 841 KVKLLRKESDSDSDSSDSSNDDSNRSFRSSQLRLSQPKQKLVGNSQTESNGTDKGTSGRQ 900

Query: 901 GKKSEKQYLSKEF 913
           GKKSEKQYLSKEF
Sbjct: 901 GKKSEKQYLSKEF 913

>Scas_675.24
          Length = 1319

 Score =  187 bits (476), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 134/344 (38%), Positives = 187/344 (54%), Gaps = 66/344 (19%)

Query: 1   MYKLQVVLIQPQ------------NQLKANGYSIDGDNSD-----------DQTITTIRN 37
           MYKLQVVL+ P             NQ  ++ +  DG+ S+           D ++    N
Sbjct: 1   MYKLQVVLVPPSARDSLVPLSYPANQPDSSQFMNDGNGSNILPKSMINGTGDMSMQFSNN 60

Query: 38  G----GHIIRDH------TRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSL 87
                G IIR +      T+KFLHFTKP N+LL L+DE+  +  K+Y NLN E  EIL+L
Sbjct: 61  NTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLN-EDLEILTL 119

Query: 88  QDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRK 147
           QDIN CDLD  + VKD+F++DN V+V++KNEL            D+  AG  S Y + ++
Sbjct: 120 QDINGCDLDPDFTVKDIFNIDNVVMVLIKNEL------------DVSSAGSTSIYRNFKR 167

Query: 148 RRSSKAFGNSSRIEPQI-----LVPKRSKPNNLAPLSN-------NLRVTSPLANEISND 195
           ++ +       +  P+      L  ++ +P+  + + N        LR+++PLAN+I   
Sbjct: 168 QKLNNGGAQQLKTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPS 227

Query: 196 EINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNL 255
            I          ++      R  + +RSFLPPP+QPQSP IRISSGI   KRI S     
Sbjct: 228 PI--------MKMTNNSDDERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEE 279

Query: 256 DVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISE 299
           D VSRS  VDPDKSKQQ+++P  P  +  TPNRV L+GQRV+SE
Sbjct: 280 DTVSRSGTVDPDKSKQQVMLPGTPANYTMTPNRVTLTGQRVLSE 323

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  160 bits (405), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 134/368 (36%), Positives = 192/368 (52%), Gaps = 80/368 (21%)

Query: 1   MYKLQVVLIQP--QN---------------------QL--KANGY---SIDGDNSDDQTI 32
           MYKLQV+L+ P  QN                     QL  K NG    + +G +  D +I
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60

Query: 33  --------TTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEI 84
                   +++    +  +   +KFLHFTK  NTLL L+DEI ++   +Y +L  +  +I
Sbjct: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEAD-LDI 119

Query: 85  LSLQDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSS 144
           LSLQD N CDLD  ++VKDVF++DN V VIL +EL            D+ +   +S+Y S
Sbjct: 120 LSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDEL------------DISEITPVSSYRS 167

Query: 145 VRKRR----------SSKAFGNSSRIEPQIL--VPKRSKPNNLAPLSNNL--RVTSPLAN 190
           +++RR              FG    +E Q +  V KR   +N+    +N+  R+++PLA 
Sbjct: 168 IKRRRLNPESLADSKDQSDFG----VESQSIKVVKKRGSTSNVIKGQSNINGRISTPLAR 223

Query: 191 EISNDEINSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIG-DGKRIF 249
           ++       S +   +N      ++   + DRSFLPPP QP SP IRISSGI  + ++I 
Sbjct: 224 QL----YPPSAIFEPQN------SDDEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKIT 273

Query: 250 SESQNLDVVSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISESQPKS--LVF 307
           S     D VSRS  VDPDKS+QQ ++   P+    TPNRV L+GQRVISE +P    L F
Sbjct: 274 SRIGEQDTVSRSATVDPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTF 333

Query: 308 SKKRINSP 315
           + + IN P
Sbjct: 334 TNRHINEP 341

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  157 bits (397), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 134/342 (39%), Positives = 177/342 (51%), Gaps = 67/342 (19%)

Query: 1   MYKLQVVLIQPQNQL---------------------KANGYSIDGDNSDDQTITTIRNG- 38
           MYKLQVVL+ P  Q                      + N     GD S       +R+  
Sbjct: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDAS--LQYANLRSAN 58

Query: 39  -----GHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHC 93
                 +  +   RKFL FTKP NTLL L+DEI ++  K+Y +L  E  EILSLQD + C
Sbjct: 59  VSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQ-EDIEILSLQDNSGC 117

Query: 94  DLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSSKA 153
           DLD  +LVKDVF+++N V VILKNE+            DL D+  +S Y SV  +RS   
Sbjct: 118 DLDPDFLVKDVFNVNNIVRVILKNEI------------DLDDSAPVSLYKSV--KRSKLN 163

Query: 154 FGNSSRIEPQILVPKRSKPNNLA----------------PLSNNLRVTSPLANEISNDEI 197
            G+   ++PQ  +P  S    +A                  + ++RV++PLA +I     
Sbjct: 164 NGSPQSVQPQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPP- 222

Query: 198 NSSTVVINRNVSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDV 257
            SS +V N +           + +RSFLPPP QPQSP IRISSGI  GK+I S     D+
Sbjct: 223 -SSKIVSNNS-----DDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDI 276

Query: 258 VSRSEVVDPDKSKQQLIVPDIPMEFISTPNRVNLSGQRVISE 299
           VSRS  VDPDK+KQQ ++   P+    TPNRV L+GQRV+SE
Sbjct: 277 VSRSATVDPDKTKQQRLLSGTPIMSTMTPNRVTLTGQRVVSE 318

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  154 bits (388), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 127/358 (35%), Positives = 179/358 (50%), Gaps = 70/358 (19%)

Query: 1   MYKLQVVLIQP--QNQLKANGY---SID----------------------------GDNS 27
           MYKLQVVL+ P  + +L   G    S+D                            G+ S
Sbjct: 1   MYKLQVVLVPPSIETELPVVGLPAGSLDNSGFAQGHAQPISTSSIAGGRGEFSSGIGNTS 60

Query: 28  DDQTITTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSL 87
            +    +   G HI R   RKFLHFTKP N+L +LADEI  +  K+Y  L  E  EI++L
Sbjct: 61  ANAVYLSGLVGAHIRRARGRKFLHFTKPTNSLYELADEIVEKCAKMYPGL-AEEPEIVTL 119

Query: 88  QDINHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRK 147
           QD+N CDLD  ++VKDVF+MDNTV V+L+N+L+               AG  + Y   RK
Sbjct: 120 QDVNECDLDPDFVVKDVFNMDNTVRVLLRNDLD-------------EAAGDRTIYMKKRK 166

Query: 148 RRSSKAFGNSSRIEPQILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRN 207
             +  A   ++    Q  V   +K    +  ++ LRV++PLAN+I           +N +
Sbjct: 167 LNTGAAGVPAAGGSVQAAVLNVAK-KRASIKTSALRVSTPLANQIYPPPTKKQ---VNSD 222

Query: 208 VSTAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPD 267
                 A++S L            QSP IRISSG+ D KRI   + N + VS+SE VDP+
Sbjct: 223 FEDDDVADKSILPPPPP-------QSPPIRISSGM-DQKRI---NMNDNAVSKSETVDPN 271

Query: 268 KSKQQLI---VPDIPMEFISTPNRVNLSGQRVISESQPKSLVFSKKRINSPINNHIDV 322
           KS+QQ +    P  P+  + TPNRV+L+G  V+SES       S+K   +PI  +I +
Sbjct: 272 KSRQQRLPSGTPMRPVSMVETPNRVSLTGPTVLSES-----TVSQKSTATPIITNIRI 324

>Kwal_14.2421
          Length = 1205

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 169/328 (51%), Gaps = 67/328 (20%)

Query: 1   MYKLQVVLIQPQ----------------------NQLKANGYSIDGDN---------SDD 29
           MYKLQVVL+ P                         + +NG +I G N         S +
Sbjct: 1   MYKLQVVLVPPGFSGVTFALPTNPPTADNSQVLPPNIVSNGSTILGANRPELGQQTGSSN 60

Query: 30  QTITTIRNGGHIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQD 89
               +     H      RK LHFTKP NTL  LA+EI  R  K+Y NL     E+L+LQD
Sbjct: 61  NLFMSSFASTHGSTPKLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNL-TRPVEVLTLQD 119

Query: 90  INHCDLDATYLVKDVFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRR 149
            N CDLD  YLVKDVF++DN V  +L+N++E            L D    + YS+ R+R 
Sbjct: 120 SNECDLDPDYLVKDVFNVDNVVRAVLRNDIE------------LSDDQSQTLYSAKRRRL 167

Query: 150 SSKAFGNSSRIEPQILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNVS 209
           +S +  N S  +P +L   + +P+ L   S+ +RV++PLAN+I             R V+
Sbjct: 168 NS-SLPNPSG-QPNVLHIAKKRPHMLR-NSSAMRVSTPLANQI-------YPPATGRQVN 217

Query: 210 TAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRI-FSESQNLDVVSRSEVVDPDK 268
           + +  +   + DRS L PP QPQS  IRISSG+G  K+I F+E    D VSRSE VDPDK
Sbjct: 218 SDYEDD--DVGDRSVL-PPPQPQSQPIRISSGVGSAKKINFNE----DTVSRSEAVDPDK 270

Query: 269 SKQQLIVPDIPMEFI-----STPNRVNL 291
           S+QQ +    PM  I     +TPNR+N+
Sbjct: 271 SRQQRLPSGTPMRHINNGTATTPNRLNV 298

>Scas_711.38
          Length = 998

 Score =  134 bits (336), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 170/333 (51%), Gaps = 63/333 (18%)

Query: 1   MYKLQVVLIQPQNQLKANGYSIDGD--NSDDQTITTIRNGGHI---------------IR 43
           M++LQV L+ PQN   A   SI+    N     I +  N                   I 
Sbjct: 3   MFRLQVELV-PQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSFGLPLNFSIP 61

Query: 44  DHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKD 103
              +KFL FTKP N L  L+ EI  +   +Y +L+ E  EI +L+D   CDLD  ++V++
Sbjct: 62  TKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLS-EELEIETLRDSTDCDLDPDFIVEE 120

Query: 104 VFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSS------------ 151
           VFS  N V VILKN+++F                ++S Y S+++R+S+            
Sbjct: 121 VFSSSNLVKVILKNDIDF------------QSLEQVSNYKSIKRRKSNTGSYQPLSNKVS 168

Query: 152 --KAFGNSSRIEPQILVPKRSK-PNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNV 208
             +A G       Q L    +K P+N+       R+++PLA +I  D        I+  +
Sbjct: 169 QQQANGVYGIPRKQYLAISSTKTPSNVG-----RRISTPLAQQIYPD--------IDEQL 215

Query: 209 STAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPDK 268
                 N +   DRSFLPPPAQPQSP IR+SSGI   K+I   +++ D VSRSEVVDPDK
Sbjct: 216 ENEEDRNAA---DRSFLPPPAQPQSPQIRVSSGIDRSKKIDGIAKD-DSVSRSEVVDPDK 271

Query: 269 SKQQLIVPDIPMEFISTPNRVNLSGQRVISESQ 301
           SKQQ ++   P+    TPNRV L+GQRV+SES 
Sbjct: 272 SKQQRLLLGTPIMTTMTPNRVTLTGQRVVSESH 304

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  124 bits (310), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 103/260 (39%), Positives = 150/260 (57%), Gaps = 32/260 (12%)

Query: 40  HIIRDHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATY 99
           HI R   +KFL FTKP NTL QL+ EI ++  K+Y NL+ E  EI +LQD++ CDLD  +
Sbjct: 80  HITRPKLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTE-LEIDTLQDVDECDLDPDF 138

Query: 100 LVKDVFSMDNTVLVILKNELEFIDANGTLNAN-DLHDAGRISAYSSVRKRRSSKAFGNSS 158
           +VKDVF++ NTV VIL+N+++       L +N D  +    S YSS R++ ++   GNS 
Sbjct: 139 VVKDVFNVYNTVRVILRNDVD-------LESNPDRQE----SLYSSKRRKLNN---GNSQ 184

Query: 159 R-------IEPQILVPKRSKPNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNVSTA 211
           +       ++  + V KR +P  L   ++ LR+++PLA++I       +   +N +    
Sbjct: 185 QNTSTGATLDQPVTVAKR-RPQALK--NSALRISTPLAHQIYPPPSQRNPKQVNSDYEED 241

Query: 212 FAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPDKSKQ 271
              +   + D+S LPPP  PQSP IRISS I   +   + S+  D VS+SE VDP K+KQ
Sbjct: 242 EYGD-DEIGDKSILPPPTVPQSPPIRISSSIAQKRLKINGSE--DTVSKSETVDPSKAKQ 298

Query: 272 QLI---VPDIPMEFISTPNR 288
           Q +    P  PM  I TPNR
Sbjct: 299 QRLPSGTPMKPMNVIETPNR 318

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 63/155 (40%), Positives = 88/155 (56%), Gaps = 13/155 (8%)

Query: 46  TRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKDVF 105
            +KFLHFT  +NTLLQL++EI  +  +LY N   ES EI+SLQD + CDLD+ +++KDVF
Sbjct: 82  CKKFLHFTDGDNTLLQLSNEILTKFDRLYPNFK-ESIEIVSLQDRHGCDLDSEFIIKDVF 140

Query: 106 SMDNTVLVILKNELEFIDANGTLNANDLHDAGR--------ISAYSSVRKRRSSKAFGNS 157
             D  VLVILK+EL++   N  ++   L    R         S  +  RK+ S +   + 
Sbjct: 141 ENDGVVLVILKDELDW-SRNQHISLLQLARQRRRQDNKPSTKSIVTEKRKKISKEDLSSI 199

Query: 158 SRIEPQILVPKRSKPNNLAPLSNNLRVTSPLANEI 192
           S  +   L+ K S  NN     N  RV++PL NEI
Sbjct: 200 SNKDTMHLIAKSSLKNNFI---NKSRVSTPLMNEI 231

>Scas_691.33
          Length = 721

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%)

Query: 307 FSKKRINSPINNHIDVQLENDSNTARGKKLVGAERKILPNTRNSDS 352
           FS  +I+SP  +HID+       T  G  +VG E++IL +  +S S
Sbjct: 394 FSNLKISSPTQHHIDIDF-----TLTGNLIVGDEKEILQHDDDSHS 434

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.306    0.123    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,680,858
Number of extensions: 1207159
Number of successful extensions: 5532
Number of sequences better than 10.0: 275
Number of HSP's gapped: 5461
Number of HSP's successfully gapped: 369
Length of query: 913
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 802
Effective length of database: 12,753,511
Effective search space: 10228315822
Effective search space used: 10228315822
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 66 (30.0 bits)