Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0A00385g1069105355830.0
Scas_638.101081108228030.0
YGL016W (KAP122)1081108127880.0
KLLA0A04884g1059106621200.0
Kwal_47.1745794796118520.0
AGR166W1013103013211e-165
YOR160W (MTR10)972364780.50
YDR335W (MSN5)1224164770.61
CAGL0L03564g216108750.66
CAGL0D00836g619122750.99
Scas_541.21223160741.5
Kwal_23.6358870133731.9
Kwal_23.506458665722.6
KLLA0D11396g53670703.8
YBL076C (ILS1)107256705.0
Kwal_27.1233548746685.9
CAGL0J01111g811148696.2
KLLA0F10505g812150678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A00385g
         (1053 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A00385g complement(37162..40371) similar to sp|P32767 Sacch...  2155   0.0  
Scas_638.10                                                          1084   0.0  
YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport ...  1078   0.0  
KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces c...   821   0.0  
Kwal_47.17457                                                         717   0.0  
AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH] complemen...   513   e-165
YOR160W (MTR10) [4959] chr15 (633839..636757) Karyopherin-beta, ...    35   0.50 
YDR335W (MSN5) [1164] chr4 (1141158..1144832) Importin-beta fami...    34   0.61 
CAGL0L03564g complement(406704..407354) similar to sp|P40857 Sac...    33   0.66 
CAGL0D00836g complement(99696..101555) similar to tr|Q07395 Sacc...    33   0.99 
Scas_541.2                                                             33   1.5  
Kwal_23.6358                                                           33   1.9  
Kwal_23.5064                                                           32   2.6  
KLLA0D11396g complement(976408..978018) similar to sp|P43621 Sac...    32   3.8  
YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRN...    32   5.0  
Kwal_27.12335                                                          31   5.9  
CAGL0J01111g complement(105760..108195) similar to sp|P47061 Sac...    31   6.2  
KLLA0F10505g complement(966736..969174) some similarities with s...    30   8.9  

>CAGL0A00385g complement(37162..40371) similar to sp|P32767
            Saccharomyces cerevisiae YGL016w PDR6, start by
            similarity
          Length = 1069

 Score = 2155 bits (5583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1053/1053 (100%), Positives = 1053/1053 (100%)

Query: 1    MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSGPYSTNVKYFGA 60
            MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSGPYSTNVKYFGA
Sbjct: 1    MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSGPYSTNVKYFGA 60

Query: 61   LTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNLS 120
            LTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNLS
Sbjct: 61   LTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNLS 120

Query: 121  ILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKIILD 180
            ILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKIILD
Sbjct: 121  ILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKIILD 180

Query: 181  TINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEHLYIS 240
            TINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEHLYIS
Sbjct: 181  TINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEHLYIS 240

Query: 241  TMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVMLQS 300
            TMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVMLQS
Sbjct: 241  TMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVMLQS 300

Query: 301  NENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNADKSQYQWMLAY 360
            NENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNADKSQYQWMLAY
Sbjct: 301  NENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNADKSQYQWMLAY 360

Query: 361  MNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQDQAASDNTQEYIKVLLQL 420
            MNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQDQAASDNTQEYIKVLLQL
Sbjct: 361  MNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQDQAASDNTQEYIKVLLQL 420

Query: 421  TNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPKIS 480
            TNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPKIS
Sbjct: 421  TNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPKIS 480

Query: 481  LSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIASET 540
            LSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIASET
Sbjct: 481  LSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIASET 540

Query: 541  ELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLDNSGPLSIDFV 600
            ELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLDNSGPLSIDFV
Sbjct: 541  ELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLDNSGPLSIDFV 600

Query: 601  RSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESMLVKTISTLC 660
            RSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESMLVKTISTLC
Sbjct: 601  RSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESMLVKTISTLC 660

Query: 661  SVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGPDAQGGNID 720
            SVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGPDAQGGNID
Sbjct: 661  SVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGPDAQGGNID 720

Query: 721  KLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDCISELGNGLVYPQEMDDPKVIQLLPPYR 780
            KLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDCISELGNGLVYPQEMDDPKVIQLLPPYR
Sbjct: 721  KLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDCISELGNGLVYPQEMDDPKVIQLLPPYR 780

Query: 781  EYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTLPEEEPYFLRYSMN 840
            EYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTLPEEEPYFLRYSMN
Sbjct: 781  EYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTLPEEEPYFLRYSMN 840

Query: 841  EIINFVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFERVMISNYHQVIVQ 900
            EIINFVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFERVMISNYHQVIVQ
Sbjct: 841  EIINFVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFERVMISNYHQVIVQ 900

Query: 901  DPDSLQTCVNFVNSILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKFTIVAVTKFWTKVV 960
            DPDSLQTCVNFVNSILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKFTIVAVTKFWTKVV
Sbjct: 901  DPDSLQTCVNFVNSILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKFTIVAVTKFWTKVV 960

Query: 961  NNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELIRTLVAKFPIEFKS 1020
            NNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELIRTLVAKFPIEFKS
Sbjct: 961  NNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELIRTLVAKFPIEFKS 1020

Query: 1021 WLVAVLPQLVDKPQAHEKFINKLFITRGSRAAG 1053
            WLVAVLPQLVDKPQAHEKFINKLFITRGSRAAG
Sbjct: 1021 WLVAVLPQLVDKPQAHEKFINKLFITRGSRAAG 1053

>Scas_638.10
          Length = 1081

 Score = 1084 bits (2803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1082 (51%), Positives = 759/1082 (70%), Gaps = 46/1082 (4%)

Query: 1    MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALL-SGPYSTNVKYFG 59
            M+SV +VV LIEELYSP P+ ++NEIQQ LQ IQKS DG  L + LL  G YS NVKYFG
Sbjct: 1    MNSVVDVVKLIEELYSPNPSHNVNEIQQTLQAIQKSNDGFQLANELLEGGDYSPNVKYFG 60

Query: 60   ALTLAVQINMH---HDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLM 116
            ALTL VQIN++   ++DL      + LFR NL  L +Y  N V++P   +   I IKKLM
Sbjct: 61   ALTLTVQINVNVHSYEDL------WRLFRANLIHLTKYCNNYVSNPQQYTPLMITIKKLM 114

Query: 117  SNLSILFVSINNNN-----PSEND--FIASWNNPLNTLINLSIASSQMSTDQKSHWYGTN 169
            SNLS++F +IN +      P+E     I +WNNP++T+I L   S+++S           
Sbjct: 115  SNLSLIFNNINESTFQEVTPTEAAPVVITNWNNPIDTVIFLLSKSNELS--------DLG 166

Query: 170  NNSESDKIILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSI 229
             N  +D+II + IN  +PY QL+ FI S+P  N+L L+FTEI+VEDLTK Q++KHA+  I
Sbjct: 167  MNPHTDEIITEAINCTIPYQQLLLFIGSNPAYNELLLIFTEIIVEDLTKLQSKKHAIAKI 226

Query: 230  HGVVHEHLYISTMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSEL 289
            H  VH +LY+STMALI  NL++       D ++NCIN+WINYIS+S+ VS  G+MDL+E+
Sbjct: 227  HTTVHTYLYVSTMALINANLTSKQNIP-SDTVYNCINSWINYISMSQNVSQDGKMDLTEV 285

Query: 290  LESLLKVMLQSNEN-EQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTN 348
             ++LL +M QS+E  + +  AEK++ IF+++FS DPLLM FELR ++E +FLG+S    N
Sbjct: 286  FQNLLSLMQQSSEQLDNFTMAEKILVIFANVFSQDPLLMGFELREQVEALFLGISRSG-N 344

Query: 349  ADKSQYQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQDQAASD 408
             D ++ QWML YMNYLVTNEM SELKDL+IC+ DFLQINTLD+CNKLFT I + D+    
Sbjct: 345  GDTAKNQWMLQYMNYLVTNEMVSELKDLAICIVDFLQINTLDVCNKLFTNI-SNDKFNEA 403

Query: 409  NTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIF 468
            N+Q+YIKVLLQLTNFPL PV QE FS++M+DFWL+LAE YS L+ E LKPN+ ++S EIF
Sbjct: 404  NSQQYIKVLLQLTNFPLVPVLQEFFSVRMIDFWLELAECYSVLSNEMLKPNAHEISTEIF 463

Query: 469  QQVINIYVPKISLSNK-KLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVL 527
            QQVINIY+ KISL NK K+  +  ED + ++EFEDFR+A +DL Q+LW++LG+E+LTN+L
Sbjct: 464  QQVINIYLAKISLINKQKILQDDTEDISAVHEFEDFRSAASDLAQTLWMILGHEHLTNIL 523

Query: 528  IAGVGSTEIASETE---LFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTL 584
            IAG+G  + +S  +   LF IE+MS+LL  LL+      S W+ +V++   F + N+  L
Sbjct: 524  IAGIGGNDASSSKDMMNLFQIESMSFLLNVLLEGSGDTLSKWICNVIKENAFTIGNILLL 583

Query: 585  LRTGLDN--------SGPLSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCA 636
            L+TG+          +  L +D  R+S  L+   SG++ E+ +Q+G ++E L QGLE C 
Sbjct: 584  LKTGVQKLSENEDMVALSLRLDLARTSCHLLGKCSGYFNEDSQQLGPSLETLFQGLESCT 643

Query: 637  FSTGGANAFT---KVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTR 693
                   A     K+E+++V+TI+ LC  CR++L  +L  F + L SIMSPD   S FTR
Sbjct: 644  APVNSLEATASNQKLETVIVRTITMLCETCRQQLSSFLGYFFTVLTSIMSPDAHVSTFTR 703

Query: 694  RSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQ--ALGSGLSIQEKQNYIQCVL 751
             +L RSIGYIIQ Q + GP+ Q   I +++ + +N IEQ   L  G +  ++  YI C+L
Sbjct: 704  SNLVRSIGYIIQSQTDGGPEQQAKYIIQVIDLISNFIEQNITLKVGQTPDQQHTYIHCLL 763

Query: 752  DCISELGNGLVYPQEMDDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSS 811
            +C+SELG+ L+ P E+ D KV+  L  ++++W  DPL +R KI+ +IEKVL  P F + S
Sbjct: 764  ECLSELGSALLDPDELADSKVLPRLAEFQQFWKNDPLQVRNKILLLIEKVLSVPTFSRKS 823

Query: 812  SLIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFS 871
              IE SCLILGK LTLP++EP+FLRYSM EII F+  H+  C+++ +LP+FVYLLE L  
Sbjct: 824  DFIEVSCLILGKMLTLPDDEPHFLRYSMQEIIEFILRHVGNCELSTSLPYFVYLLEKLVI 883

Query: 872  CYKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSS 931
             +K T+TS EFD +FE++++  Y Q I  DPD LQ  +NFVN+ILDT P I V+S +W+S
Sbjct: 884  HFKQTLTSQEFDFLFEKIILVYYSQFIFPDPDLLQMTINFVNTILDTNPSILVHSNHWNS 943

Query: 932  FILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAG 991
            FI  EF++LL  KEKFTI+AV KFWTKV+NNK+YT+E+LEITR Q+ A+G  L  H+M G
Sbjct: 944  FIFPEFIKLLLSKEKFTIIAVNKFWTKVLNNKRYTKEDLEITRSQIGAIGQDLVYHIMYG 1003

Query: 992  LYHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINKLFITRGSRA 1051
            LYHTQRSDLN+YT+++R LVAKFP+E K WL+ VLPQL D+P  HE+FINKLFITRG+RA
Sbjct: 1004 LYHTQRSDLNSYTDVLRALVAKFPMETKPWLINVLPQLSDQPVVHERFINKLFITRGNRA 1063

Query: 1052 AG 1053
            AG
Sbjct: 1064 AG 1065

>YGL016W (KAP122) [1957] chr7 (461669..464914) Nuclear transport
            factor, member of karyopherin-beta family [3246 bp, 1081
            aa]
          Length = 1081

 Score = 1078 bits (2788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/1081 (51%), Positives = 758/1081 (70%), Gaps = 46/1081 (4%)

Query: 1    MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSG-PYSTNVKYFG 59
            MSS+ EVV LIEELYSP P  D+N+IQQ LQ IQKS  G  L + LLS   YS NVKYFG
Sbjct: 1    MSSIHEVVALIEELYSPHPKHDVNQIQQSLQSIQKSEQGFHLANELLSDDKYSANVKYFG 60

Query: 60   ALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNL 119
            ALTL VQ+N   ++    E  + +FR NL +L ++    V++P+      I+IKKLMSNL
Sbjct: 61   ALTLTVQLNTRGEN--DYETLWNVFRSNLLYLTKFSTLYVSNPNMYGQSLIIIKKLMSNL 118

Query: 120  SILFVSINN---NNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDK 176
            S++F  IN+   NN    + I  WNNP+NT I L      MS          N N  +D+
Sbjct: 119  SLIFTKINDPQLNNAGNENMIKQWNNPINTFIQL------MSVQ--------NQNINADQ 164

Query: 177  IILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEH 236
            ++LD+IN  + Y QL +F+S S   N+L+L FTE++VEDLTKFQT++H+M+ IH VVHEH
Sbjct: 165  LLLDSINCSLTYEQLSQFVSLSQKHNELALTFTEVIVEDLTKFQTKRHSMSQIHEVVHEH 224

Query: 237  LYISTMALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKV 296
            LYISTMALI  NL+       +  +F+CI AWINYIS++R VS  GRMDLSE+ ++L+ +
Sbjct: 225  LYISTMALINLNLT--AQAVFNPTVFDCITAWINYISLTRSVSSSGRMDLSEIFQNLIDL 282

Query: 297  MLQSNE-NEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNAD--KSQ 353
            M QS E ++ Y +AEK+++IF ++F+NDPLLM+++LR ++E IFLGV   D+      ++
Sbjct: 283  MYQSTEGSDGYENAEKILTIFGNVFANDPLLMSYDLRQQIECIFLGVVRPDSGITDISNK 342

Query: 354  YQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQD--QAASDNTQ 411
              WML YMNYLVTN+ +SELK+L+IC+ DFLQINTL +CNKLFT IQ  D  Q   +  Q
Sbjct: 343  NSWMLQYMNYLVTNDFFSELKELAICIVDFLQINTLSVCNKLFTNIQAADNGQVQDEYIQ 402

Query: 412  EYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQV 471
            EYIKVLLQ+TNFPL PV QE FS++MVDFWLDL++ Y+NLA E+L+PNS +LS +IFQQ+
Sbjct: 403  EYIKVLLQMTNFPLTPVLQEFFSVRMVDFWLDLSDAYTNLASETLRPNSIELSTQIFQQL 462

Query: 472  INIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGV 531
            INIY+PKISLS K+  +E   + T +NEFEDFRNAV+DL QSLW +LGN+NLTNVLI G+
Sbjct: 463  INIYLPKISLSVKQRIIEEEGESTSVNEFEDFRNAVSDLAQSLWSILGNDNLTNVLIDGM 522

Query: 532  GSTEIASETEL--------FNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQT 583
            G    AS+  L        F IETM ++L  +L D+ + ES W+ ++++A KF   NV +
Sbjct: 523  GQMPAASDETLIIKDTDVLFRIETMCFVLNTILVDMTLSESPWIKNIVDANKFFNQNVIS 582

Query: 584  LLRTGLDNSGP------LSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCA- 636
            + +TG   S        L +DFVR+STTL+ +L+G++K+ P Q+   +E L QGL  C  
Sbjct: 583  VFQTGFQTSASTKVSQILKLDFVRTSTTLIGTLAGYFKQEPFQLNPYVEALFQGLHTCTN 642

Query: 637  FSTGGAN---AFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTR 693
            F++       +  K+E M++KT+STLC  CR+EL PYL +F SFL++++ PD   S FTR
Sbjct: 643  FTSKNEQEKISNDKLEVMVIKTVSTLCETCREELTPYLMHFISFLNTVIMPDSNVSHFTR 702

Query: 694  RSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDC 753
              L RSIGY++Q Q  NGP+ Q   I +L  + +  IE  L S + +QE+Q+YI C+L C
Sbjct: 703  TKLVRSIGYVVQCQVSNGPEEQAKYILQLTNLLSGSIEHCLASSVQLQEQQDYINCLLYC 762

Query: 754  ISELGNGLVYPQEM-DDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSS 812
            ISEL   L+ P E+ ++  ++Q L  ++ +W++DPL IR+KIM  I+KVL N  + K+S+
Sbjct: 763  ISELATSLIQPTEIIENDALLQRLSEFQSFWSSDPLQIRSKIMCTIDKVLDNSIYCKNSA 822

Query: 813  LIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFSC 872
             +E  CLI+GK L LP+ EPYFL+Y+M+E++NFV  H+  C++A  LP+FVYLLE L S 
Sbjct: 823  FVEIGCLIVGKGLNLPDGEPYFLKYNMSEVMNFVLRHVPNCELATCLPYFVYLLEKLISE 882

Query: 873  YKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSF 932
            ++  +T  EFD +FE++++  Y   I+ DPD LQ  + FVN++LD KPG+A+ S++W+SF
Sbjct: 883  FRKELTPQEFDFMFEKILLVYYDAYIINDPDLLQMTIGFVNNVLDVKPGLAIGSKHWTSF 942

Query: 933  ILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGL 992
            IL +FL+L+  +EKFTIVAV KFWTK++NNKKY +EEL   RQQV+++G  L   +M GL
Sbjct: 943  ILPQFLKLIPSREKFTIVAVAKFWTKLINNKKYNQEELTTVRQQVSSIGGDLVYQIMYGL 1002

Query: 993  YHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINKLFITRGSRAA 1052
            +HTQRSDLN+YT+L+R LVAKFPIE + WLVAVLPQ+ + P  HEKFINKL ITRGSRAA
Sbjct: 1003 FHTQRSDLNSYTDLLRALVAKFPIEAREWLVAVLPQICNNPAGHEKFINKLLITRGSRAA 1062

Query: 1053 G 1053
            G
Sbjct: 1063 G 1063

>KLLA0A04884g 433581..436760 similar to sp|P32767 Saccharomyces
            cerevisiae YGL016w PDR6 Member of the karyopherin-beta
            family, nuclear import singleton, start by similarity
          Length = 1059

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1066 (41%), Positives = 678/1066 (63%), Gaps = 44/1066 (4%)

Query: 4    VEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGSALLSGPY-STNVKYFGALT 62
            +  +V+LIE   +   ++ +N+IQ VLQ  QKS  G+ L +ALLS    STNVKYFGALT
Sbjct: 3    INHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANALLSQENGSTNVKYFGALT 62

Query: 63   LAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNLSIL 122
              VQ+      L  E   +++F+ NL  L +      ++P+A S+  + I KLMSNLS++
Sbjct: 63   YTVQLTTC---LHTESQLWSIFQGNLVHLTRMMFLFTSNPAAASNLLVTITKLMSNLSLI 119

Query: 123  FVSINNNN-PSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNNNSESDKIILDT 181
            F++IN++   ++++ I +W NP+NT I L     Q   +     + T+N+  +++++   
Sbjct: 120  FLTINSDAIGADSNKIPAWRNPVNTCIKLL----QHCNESNLFEWRTDNSEIAERLVRTC 175

Query: 182  INSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVVHEHLYIST 241
            +N +VPY +LI  ISSS   N+L LLFT+++VED+ K+Q++K ++++++ +VH HLYIST
Sbjct: 176  LNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKSSLSNVYEMVHNHLYIST 235

Query: 242  MALIIFNLSNLDATQLHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVM-LQS 300
            MA++ FNL N+ ++     +F CI +WI+YIS++R VS  G MDL+E+  +++ VM + S
Sbjct: 236  MAILNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHGTMDLTEMFNNMINVMCMAS 295

Query: 301  NENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSHGDTNADKSQYQWMLAY 360
            N ++++  +++VISIF  +FSNDP LM+FE+R++LE IFLGVS    N       WMLAY
Sbjct: 296  NGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIFLGVSRHSMNTSND---WMLAY 352

Query: 361  MNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQ--TQDQAASDNTQEYIKVLL 418
            MN+LVTNE+Y +LK L+ CV DFLQI+ LD+CNKLFT I   T DQ+  D    YI+VLL
Sbjct: 353  MNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIHENTGDQSLED----YIRVLL 408

Query: 419  QLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPK 478
            QLTNFPL P+ QE++S KM++FWLDLAEGY NL  E+LK ++ +++  +F QV+ IY+PK
Sbjct: 409  QLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADANEIAENMFNQVVQIYLPK 468

Query: 479  ISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIAS 538
            ISL NK+  +E  +D+++L+EF+DFR+A  DL + LW +LG+  LT VLI GVG  +  +
Sbjct: 469  ISLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTILGHSKLTIVLIRGVGQAD-TN 527

Query: 539  ETELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLD------NS 592
              +L+ +E MS+LL KLL  +N  +S ++ D +     L+ N+  LL+TG         +
Sbjct: 528  NVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAI-GENHLIDNLLFLLQTGCKQKEHSKTA 586

Query: 593  GPLSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESML 652
              L +DFV+++  L+  ++ ++  + + +G  +E L + LE  +          K+E  L
Sbjct: 587  QVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFECLET-SRQYNPIEYSIKMELQL 645

Query: 653  VKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGP 712
             +TIS +C  CRKEL P+L NF   L SIM P+   S FTR    +SIG IIQ     GP
Sbjct: 646  NRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVSHFTREKFVKSIGNIIQMCVSEGP 705

Query: 713  DAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLDCISELGNGLVYPQEMDD--- 769
            +AQ  +I  +V M   LI+          + ++ +  +L C+SELG+GL      D+   
Sbjct: 706  EAQANHISNMVDMIGGLIQTT--------DAKSDMLSLLACLSELGSGLSQLPNDDEFIE 757

Query: 770  --PKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTL 827
              P  +  LP ++ YW  DP+ ++ K+M +++  L    +      +E SCLI+GK++TL
Sbjct: 758  NNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSK--YGTDPEFVEVSCLIIGKAITL 815

Query: 828  PEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFE 887
            P++ P+FLRY ++E+++F  T +  CD A  LP+  Y LE + + +K  +TS EFD +F+
Sbjct: 816  PDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEKIVAGFKDQLTSHEFDEMFK 875

Query: 888  RVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKF 947
            +  ++ Y   I  DPD +Q+ V++VNS+L+ KP +A+ S+YW+ FI+ EFL+ L  KEKF
Sbjct: 876  QFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKSEYWTQFIVPEFLKYLQAKEKF 935

Query: 948  TIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELI 1007
            TI + TKFW K +NN++YT+E+ EI      ++G QL    M  L+H QRSD+  Y ELI
Sbjct: 936  TISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQLVYQTMFSLHHAQRSDVPQYAELI 995

Query: 1008 RTLVAKFPIEFKSWLVAVLPQLVDKPQA-HEKFINKLFITRGSRAA 1052
            RTL AK+P+  K WL  +LPQ+  K    HE+FINKL +TR SRA 
Sbjct: 996  RTLFAKYPMPMKDWLYELLPQITGKEAIFHERFINKLTVTRASRAT 1041

>Kwal_47.17457
          Length = 947

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/961 (38%), Positives = 592/961 (61%), Gaps = 51/961 (5%)

Query: 111  VIKKLMSNLSILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWYGTNN 170
            VIKKLMSN + +F  +++    EN    +W NPL T +   + +SQ     +        
Sbjct: 3    VIKKLMSNAARIFFQLHDPKHQENSI--TWKNPLETFL---LLTSQEGVRPEV------- 50

Query: 171  NSESDKIILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIH 230
                D  +   +   VPY+ LI+ ++SS   N L LLF+E+++EDL KFQ  K   + +H
Sbjct: 51   ---MDNFLQHILAENVPYDNLIQVVNSSTAFNTLLLLFSEVIIEDLIKFQATKVGSSHLH 107

Query: 231  GVVHEHLYISTMALIIFNLSNLDAT---------QLHDNLFNCINAWINYISISRQVSPQ 281
              V EHLYIS+M+++ +NL  L A+         ++ D +F C+ AWI Y +++R  S Q
Sbjct: 108  NAVREHLYISSMSIVNYNLQQLSASFQTRPHETPEVADTVFRCVRAWIEYATMARSGS-Q 166

Query: 282  GRMDLSELLESLLKVMLQSNENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLG 341
            G +DL+E  E+L+ +M   N +  +  +E ++SI   IF  DP ++N+ELR+ LE +FLG
Sbjct: 167  GHLDLTENFENLIHLMCLHNPDFGFPYSETIVSILGEIFGTDPTILNYELRTTLEGVFLG 226

Query: 342  VSHGDTNADKSQ-YQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQ 400
            V  G T  +KS+ ++WML YMN+LV N+M+ +LKDL++CV DFLQ++ LD+CNKLFT   
Sbjct: 227  V--GRTAQNKSEGHEWMLQYMNHLVVNQMFDDLKDLALCVVDFLQVSNLDVCNKLFTV-- 282

Query: 401  TQDQAASDNTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNS 460
                  S N  +YIKVLLQ+TNF L PV +E FS++MVDFWLDL +GY+NL  E+LKP +
Sbjct: 283  -ASDTGSGNLDQYIKVLLQMTNFTLVPVLEEFFSVRMVDFWLDLCDGYNNLVRETLKPET 341

Query: 461  QQLSIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVLGN 520
             +L+  IF QV  IY+PKI+L NK+  +  GE+ ++L+EF+DFR AV DL +S+W VLG+
Sbjct: 342  PELAANIFGQVAQIYLPKINLQNKQKIIREGEEDSLLHEFDDFRGAVLDLIESMWSVLGH 401

Query: 521  ENLTNVLIAGVGSTEIASETELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFLVAN 580
            E LT++L+  +G    +S  +LF +E M + L KLL D+N+ ES  V + L  +K  +AN
Sbjct: 402  EKLTDILVYSIGQIAPSSAEDLFQVEAMCFCLNKLLADMNLAESPSVCESLRNSKGFLAN 461

Query: 581  VQTLLRTGLDNSGP--------LSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQGL 632
            V  L++T               LS DF+++ +++++++S ++K +  ++   ++ L   L
Sbjct: 462  VLLLIQTSCQQKDASNGREAQILSSDFIKTGSSMLATVSDYFKRDEAELRNCMDTLFSSL 521

Query: 633  EKCAFSTGGANAFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDFT 692
            E C+         TK E ++ K  +++C   R EL  YL  FT   H+++ P    S F+
Sbjct: 522  ETCSNKDA---VDTKFELLITKCTTSICEKSRLELGSYLPTFTKIQHAMIQPSSNVSSFS 578

Query: 693  RRSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVLD 752
            ++  TR +GYIIQ    +GP+AQ      L+ + N++  + + +       ++ I C+L 
Sbjct: 579  KQGFTRCLGYIIQAYTRDGPEAQA---QYLLQVINSIKSEVVNAN----NDRDQILCLLS 631

Query: 753  CISELGNGLVYPQEMDDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQKSSS 812
            C+SELG+  +   E +DP  +  L  ++ +W  DPL +R +I+ ++E +L      K   
Sbjct: 632  CLSELGSAFIQSDEFEDPAYLSQLSHFQTFWQEDPLHLRVQILDMLESIL--ALHGKDPE 689

Query: 813  LIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFFVYLLENLFSC 872
             IE +CLI+GK L + ++EP+FL YSM+E+++F+     TC+ +  L F +YLLE +   
Sbjct: 690  FIEVACLIMGKKLNVSDDEPHFLGYSMHELMDFLLRRCDTCEPSSGLSFIIYLLEKVVIQ 749

Query: 873  YKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSF 932
            Y+++++  +F+ +     +  +   +  DPD  Q  V FVNS++D++PG+AV+ + W+ F
Sbjct: 750  YRSSLSPQDFNFMLSSFFLEKHRDAVSADPDLTQLMVTFVNSVMDSRPGLAVHCEQWAVF 809

Query: 933  ILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGL 992
            +L EF++LL+ KE+FTI AVTKFWTKV+NNKKYTR +    R+Q+  +G +LT   M+ L
Sbjct: 810  LLPEFMRLLSSKERFTISAVTKFWTKVINNKKYTRHDEVTVREQIFGLGLELTNGTMSAL 869

Query: 993  YHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINKLFITRGSRAA 1052
               QRS+LN Y++L+R L+A++P++ K WL+  LP L +  +AH+  + KLF+TRGSRAA
Sbjct: 870  LSAQRSELNFYSDLLRALIARYPLQSKQWLLQTLPLLCENHRAHQLLVEKLFVTRGSRAA 929

Query: 1053 G 1053
             
Sbjct: 930  A 930

>AGR166W [4477] [Homologous to ScYGL016W (KAP122) - SH]
            complement(1056332..1059373) [3042 bp, 1013 aa]
          Length = 1013

 Score =  513 bits (1321), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 322/1030 (31%), Positives = 548/1030 (53%), Gaps = 82/1030 (7%)

Query: 55   VKYFGALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKK 114
            + YFGALT  VQ+   + + + E     L   NL    +     +  P     +  V++K
Sbjct: 16   INYFGALTYTVQL---YRNSETETQQAALLEGNLVHFARLLGTYLAAPE--KRFLQVLRK 70

Query: 115  LMSNLSILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTDQKSHWY-GTNNNSE 173
            LMSNL+ LF+ +N       D   +W NP++T++ L  A  Q     +S W+ G    SE
Sbjct: 71   LMSNLARLFIKVNQKTAGSGD--PTWKNPVHTILFLLHAYRQ---GDRSRWHLGDAQLSE 125

Query: 174  SDKIILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTKFQTQKHAMNSIHGVV 233
            +   +  +++ E+P+ +LI F+ SS   N+  LL   +L EDLT  Q+++  ++ ++ +V
Sbjct: 126  T---VRASLHVEIPFEELIGFLDSSAELNRQMLLCVRVLAEDLTSEQSRRSPLHDVNALV 182

Query: 234  HEHLYISTMALIIFNLSNLDATQLHDN---------LFNCINAWINYISISRQVSPQGRM 284
             +HLYI+ MA+I      L+ + L +N         +F  I AWI Y+S+ R  SP   M
Sbjct: 183  RKHLYITAMAMIN---HTLEQSMLPENCLYAAAETVVFEAITAWIEYVSLVRTNSPD-YM 238

Query: 285  DLSELLESLLKVMLQSNENEQYGSAEKVISIFSHIFSNDPLLMNFELRSRLETIFLGVSH 344
            DL++L E L+++M  S +   +  A+ VI I S + S+ P LMN +LR +LE+IFLGV+ 
Sbjct: 239  DLTDLFEHLIRLMCISCDGS-FPFADTVIRILSSVLSHHPELMNVDLRVQLESIFLGVTR 297

Query: 345  GD-TNADKSQYQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQTQD 403
             D     +  ++WML YMN+LV    Y  L DL+ CV  FL +N LD+ ++LFT      
Sbjct: 298  SDDQQVSRQSHEWMLLYMNHLVAAGAYDGLSDLATCVVGFLNLNCLDISSRLFTRAHND- 356

Query: 404  QAASDNTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNSQQL 463
               +   Q+YIKVLLQLTNFP  PV QE +S+ M  FW DL + Y  L+ + L+P+   +
Sbjct: 357  ---TSQIQQYIKVLLQLTNFPAAPVLQEVYSVHMTTFWQDLCDSYYGLSADVLRPDGPAI 413

Query: 464  SIEIFQQVINIYVPKISLSNKKLFLE--MG---EDKTVLNEFEDFRNAVADLTQSLWLVL 518
            + ++F Q+++IY+PK+SL NK   ++  +G   + +  +++FE FRN VA L    W++L
Sbjct: 414  AEDVFGQLVDIYLPKVSLINKLKIIDGTIGDAEQTRGSISKFEYFRNEVATLVAQSWMIL 473

Query: 519  GNENLTNVLIAGVGSTEIAS-ETELFNIETMSYLLEKLLKDINIPESLWVLDVLEAAKFL 577
            GN  LTN LI  V   +  S   +LF +E M++LLE+LL+ +++ E+  + +++  ++ L
Sbjct: 474  GNSKLTNQLILKVCEQQRQSGSVDLFQVECMAFLLERLLEGVDLEETPQLCELIRESE-L 532

Query: 578  VANVQTLLRTG----LDNSG--PLSIDFVRSSTTLMSSLSGFYKENPEQIGGTIEILVQG 631
            +  +  LL  G    +   G   L + FV + + L+ +L  ++K N + +   +  +   
Sbjct: 533  MEYIMYLLNAGCKQHMHTEGLEKLKLQFVDTGSALLRNLLTYFKVNQDSLIHVVGNIFSC 592

Query: 632  LEKCAFSTGGANAFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIMSPDKQSSDF 691
            + +C+      +    +E+ L++T + LC+ CR E+ P   +    +  ++SP   +S  
Sbjct: 593  MAECS-RFNSPDDTNDIEASLMQTFTALCNQCRHEMVPLFPSLLGIMEQMLSPASNTSKS 651

Query: 692  TRRSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSIQEKQNYIQCVL 751
             RR + RS+ +IIQ      P + G +I+ ++ +F    + A          +     +L
Sbjct: 652  VRRDMVRSVSFIIQAGSSQDPISLGKDINNMLDLFCATTDVA---------DKKSTNALL 702

Query: 752  DCISELGNGLVYPQ----EMDDPKVIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPY- 806
              I ELG GL        ++   KV++               ++A + QI +KVL   Y 
Sbjct: 703  TYILELGQGLEDCSGGGIDVAGHKVLE-------------KHVQADLQQIHDKVLSVIYA 749

Query: 807  ----FQKSSSLIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIAPALPFF 862
                    ++LI+ SCLILG  L +  + P+  R+++ +I++F+F  L  C++   LP  
Sbjct: 750  GCKQHNGDTNLIQTSCLILG--LNVQSKPPHLFRFTVPQILDFLFAQLALCNLGACLPHM 807

Query: 863  VYLLENLFSCYKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGI 922
            + LLE L        +  +FD +     + +Y  +I +DPD + +   F  + L  KP  
Sbjct: 808  IRLLERLLVHQLDAFSQEQFDHLLLSFFVQHY-ALIAEDPDLIHSMGTFFVTALQKKPAF 866

Query: 923  AVYSQYWSSFILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEITRQQVAAVGA 982
             + S +  SF+L  FL  +  +E  TI A  +FW+  + N+    +   +T   ++ +G 
Sbjct: 867  VLRSAHMHSFVLPRFLDYIAAQESLTIRAAVRFWSLFLKNRYLPDDRAAVT-ACMSLIGP 925

Query: 983  QLTAHVMAGLYHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLVDKPQAHEKFINK 1042
            QL ++ M  L+H +RS++N+YT+++R LVA +PI+ K+WL A + +L  +P+ H +FI  
Sbjct: 926  QLVSNTMRALFHVRRSEINSYTDILRALVASYPIQTKAWLSATMAKLDGRPEVHARFIES 985

Query: 1043 LFITRGSRAA 1052
            + +TRGS AA
Sbjct: 986  ILVTRGSHAA 995

>YOR160W (MTR10) [4959] chr15 (633839..636757) Karyopherin-beta,
           involved in nuclear protein import and indirectly in
           mRNA transport from nucleus to cytoplasm [2919 bp, 972
           aa]
          Length = 972

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 77/364 (21%), Positives = 145/364 (39%), Gaps = 71/364 (19%)

Query: 440 FWLDLAEGYSNLALESLKPNSQQLSIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNE 499
           FW +  +    L L   + + +  S +IF ++IN  +  +   + +   +  EDK     
Sbjct: 353 FWFNFKQS---LVLPRYQESRKAYS-DIFVKLINGIITHLQYPSGQFSSKEEEDK----- 403

Query: 500 FEDFRNAVADLTQSLWLVLG-NENLTNVLIAGVGSTEIAS-----ETELFNIETMSYLLE 553
           F+DFR  + D+ +    V+G +E L+  LI    + E  +     E  LF++ TM+    
Sbjct: 404 FKDFRYHMGDVLKDCTAVVGTSEALSQPLIRIKSAIENNNSWQIMEAPLFSLRTMA---- 459

Query: 554 KLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLDNSGPLSIDFVRSSTTLMSSLSGF 613
              K+I++ E+  + ++++    ++ N+            P       +ST ++   + +
Sbjct: 460 ---KEISLTENTILPEIIK----IICNL------------PEQAKIRYASTLVLGRYTEW 500

Query: 614 YKENPEQIGGTIEILVQGLEKCAFSTGGANAFTKVESMLVKTISTLCSVCRKELYPYLDN 673
             ++PE +   ++ +  G +    S+   +  T     L+      CS C K L  Y+D 
Sbjct: 501 TAKHPELLEVQLQYIFNGFQLHEGSSDMQSIITASSHALM----FFCSDCSKLLVGYIDQ 556

Query: 674 FTSFLHSIMSPDKQSSDFTRRSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQA 733
             +F  ++ S     S F    L + +  +I  Q    P+A      K+ ++F  L++  
Sbjct: 557 LINFFLNVQSSIDIESQF---ELCQGLSAVINNQ----PEA------KVSVIFQKLVDDN 603

Query: 734 LG--SGLSIQEKQN----------YIQCVLDCISELGNGLVYPQEMDDPKVIQLLPPYRE 781
           L     L  Q K N           I  +     EL     YPQ+  +P    LLP    
Sbjct: 604 LRQIEALIPQWKANPTLLAPQIADKIDLLYALFEELKPRYNYPQQGSEP----LLPRIEF 659

Query: 782 YWNT 785
            W  
Sbjct: 660 IWKA 663

>YDR335W (MSN5) [1164] chr4 (1141158..1144832) Importin-beta family
           member required for nuclear export of Pho4p and involved
           in pheromone response pathway [3675 bp, 1224 aa]
          Length = 1224

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 73/164 (44%), Gaps = 14/164 (8%)

Query: 2   SSVEEVVNLIEELYSPKPNRD-LNEIQQVLQGIQKSGDGLILGSAL-LSGPYSTNVKYFG 59
           +   ++V+ ++ +YSPK N     E Q+ L  ++   +    G  + L  P ++ +KYFG
Sbjct: 4   TGASQIVSALDVIYSPKSNNSQRQEAQKFLDEVKLCSESPFWGYEIALQNPTNSILKYFG 63

Query: 60  A--LTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMS 117
              L  AV+ N +  D  K       + + L F VQ ++         + +  V K+   
Sbjct: 64  LGLLDHAVKKNWNDYDEGKR-VALRKWVMELNFGVQDYDTRYIKEKLATLWVEVAKRTWG 122

Query: 118 NLSILFVSINNNNPSENDFIASW---NNPLNTLINLSIASSQMS 158
                  ++   NP+E   + SW   +N L  L N++ +S +++
Sbjct: 123 E------ALKQTNPTEEQLLTSWVDMDNNLFELWNINQSSRELA 160

>CAGL0L03564g complement(406704..407354) similar to sp|P40857
           Saccharomyces cerevisiae YJL097w, start by similarity
          Length = 216

 Score = 33.5 bits (75), Expect = 0.66,   Method: Composition-based stats.
 Identities = 24/108 (22%), Positives = 48/108 (44%), Gaps = 8/108 (7%)

Query: 793 KIMQIIEKVLQNPYFQKSSSLIEASCLILGKSLTLPEEE--------PYFLRYSMNEIIN 844
           +I+  +  ++++P    ++ ++    ++LG    LPE             L +S+ EII 
Sbjct: 60  EILNSLFGIVRSPLLTTAAQVLSRLVVVLGIFQYLPEARNAHGIVYITLLLSWSITEIIR 119

Query: 845 FVFTHLQTCDIAPALPFFVYLLENLFSCYKATMTSAEFDVIFERVMIS 892
           ++F          A  F VYL  NLF     T  ++E  +I+  + ++
Sbjct: 120 YMFYFFTLIGSRGAPTFLVYLRYNLFLVLYPTGVASELLIIYSALPVA 167

>CAGL0D00836g complement(99696..101555) similar to tr|Q07395
           Saccharomyces cerevisiae YDL063c, start by similarity
          Length = 619

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 3/122 (2%)

Query: 341 GVSHGDTNADKSQYQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLCNKLFTTIQ 400
           G+S  D N  + + Q ++  +N +V NE    L   ++ +C+   +  L L  KL  T+ 
Sbjct: 25  GISKKDANLIERKLQPLIKNLNSVVPNERSMALSSATV-LCEDAHMRKLLLKEKLIPTVT 83

Query: 401 TQDQAASDNTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSNLALESLKPNS 460
           T+   + +NT+  ++    L N  L      +  L   D W  +  G+  L+ +SL+  +
Sbjct: 84  TK-LLSDENTEIVVEAYGLLRNLCLEEGYDVAVHLWRSDIWTSILSGFEKLS-DSLRALA 141

Query: 461 QQ 462
            Q
Sbjct: 142 AQ 143

>Scas_541.2
          Length = 1223

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 67/160 (41%), Gaps = 25/160 (15%)

Query: 2   SSVEEVVNLIEELYSPKP-NRDLNEIQQVLQGIQKSGDGLILGSAL-LSGPYSTNVKYFG 59
           S   ++V+++E +YSPK  N D  + QQ L  ++   +    G  + L+ P +  VK++G
Sbjct: 4   SGANQIVSVLETIYSPKSTNSDRLKSQQFLDEVKLQDESPYWGYEMALNNPMNYIVKHYG 63

Query: 60  ALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDPSALSSYSIVIKKLMSNL 119
              L   I     D  +++      R+ L   V      V+D           + +   L
Sbjct: 64  LGLLHNAIKRKWKDYDQQK------RITLRKWVMELNYRVHDQDP--------RYIKEKL 109

Query: 120 SILFVSI---------NNNNPSENDFIASWNNPLNTLINL 150
           ++L+V I            NP+E+  + SW +  N L  L
Sbjct: 110 ALLWVEIAKRSWGEALRGGNPTEDLLVESWVDMDNNLTEL 149

>Kwal_23.6358
          Length = 870

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 56/133 (42%), Gaps = 24/133 (18%)

Query: 734 LGSG-LSIQEKQNYIQCVLDCI--SELGNGLVY-------------------PQEMDDPK 771
           LG+G LS QE Q   Q +   +  S  G+G  Y                   PQ+   P+
Sbjct: 255 LGAGTLSRQEMQQSPQVIQQPLQASSSGDGSAYATPPPQVPISQEAQGQVRLPQQTGSPR 314

Query: 772 VIQLLPPYREYWNTDPLGIRAKIMQIIEKVLQNPYFQK-SSSLIEASCLILGKSLTLPEE 830
             Q+L P +E   + P GIR   M+  ++ L    F++      +   ++    +  P +
Sbjct: 315 P-QILSPSQELKESTPRGIRRSSMRKHQEPLSQDDFKRLQVRQAKVDKILRHSGVMTPRD 373

Query: 831 EPYFLRYSMNEII 843
           + +  RY +++I+
Sbjct: 374 KDFITRYQLSQIV 386

>Kwal_23.5064
          Length = 586

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 941 LTHKEKFTIVAVT-----KFWTKVVNNKKYTREELEITRQQVAAVGAQLTAHVMAGLYHT 995
           + H+ KF    VT     K + K++N ++  ++E+   RQQV A+  QLT   +  +  T
Sbjct: 324 VNHRLKFDTSIVTFEEEFKSYEKLINERRKAQKEVRERRQQVTALIPQLTEDSLNDVRKT 383

Query: 996 -QRSD 999
            QR D
Sbjct: 384 LQRGD 388

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)

Query: 552 LEKLLKDINIPESLWVLDVLEAAKFLVANVQTLLRTGLDNSGPLSI 597
           LEK+   IN+ +S W L V++ +K  ++ V +L      +SGPL+I
Sbjct: 466 LEKVFAPINLSQSHWALGVIDISKKEISYVDSL------SSGPLAI 505

>KLLA0D11396g complement(976408..978018) similar to sp|P43621
           Saccharomyces cerevisiae YFR051c RET2 coatomer complex
           delta chain singleton, start by similarity
          Length = 536

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 889 VMISNYHQVIVQDPDSLQTCVNFVNSILDTKPGIAVYSQYWSSF-ILKEFLQLLT--HKE 945
           ++I+N H  I+QD D+L   V  V+S L    G++    + S+F IL  F +++T  +KE
Sbjct: 68  ILITNLHSNIIQDMDTLNIFVQTVDSTL---KGLSEEDVFDSAFDILNSFDEIITMGYKE 124

Query: 946 KFTIVAVTKF 955
             ++  +  F
Sbjct: 125 NLSLTQIKTF 134

>YBL076C (ILS1) [123] chr2 complement(81041..84259) Isoleucyl-tRNA
           synthetase, cytoplasmic, member of the class I aminoacyl
           tRNA synthetase family [3219 bp, 1072 aa]
          Length = 1072

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 257 LHDNLFNCINAWINYISISRQVSPQGRMDLSELLESLLKVMLQSNENEQYGSAEKV 312
           L  NL  C+NA   Y+ I  +   +  +    LLESL+K + +  +NE+Y   EK+
Sbjct: 229 LPSNLSLCVNADFEYVKIYDETRDRYFI----LLESLIKTLYKKPKNEKYKIVEKI 280

>Kwal_27.12335
          Length = 487

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 464 SIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVAD 509
           S+E F+ ++  Y+P+I+   +K       D  VLNE  DF+  + D
Sbjct: 322 SVETFRDLMQTYMPRIARQKEKY------DTDVLNELYDFKTIIYD 361

>CAGL0J01111g complement(105760..108195) similar to sp|P47061
           Saccharomyces cerevisiae YJL029c VPS53, start by
           similarity
          Length = 811

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 69/148 (46%), Gaps = 22/148 (14%)

Query: 446 EGYSNLALESLKPNSQQLSIEIFQQVINIYVP-KISLSNKKLFLEMGEDKTVLNEFEDF- 503
           E Y N+       +  +LS   FQ  ++++V  +  L +KKL   M + K   N  + F 
Sbjct: 322 ENYINVRFSKKLNDKPKLST-CFQPYLSVWVSHQDKLMDKKLLSYMSDPKFPENSTDSFI 380

Query: 504 --------RNAVADLTQSLWLVLGNENLTNVLIAGVGSTEIASETELFNIETMSYLLEKL 555
                   RN  A LTQSL LV  +EN T VL A      +A+    F  + +     K+
Sbjct: 381 VPSSADLFRNYRAILTQSLELVQESEN-TAVLTA------LAT----FFTKWLGLYANKI 429

Query: 556 LKDINIPESLWVLDVLEAAKFLVANVQT 583
           L+ + +P+++ V D  E AK+ V  + T
Sbjct: 430 LEPLILPDNVEVEDKRECAKYTVLVINT 457

>KLLA0F10505g complement(966736..969174) some similarities with
           sp|P21372 Saccharomyces cerevisiae YBR237w PRP5 pre-mRNA
           processing RNA-helicase, hypothetical start
          Length = 812

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 70/150 (46%), Gaps = 12/150 (8%)

Query: 459 NSQQLSIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVADLTQSLWLVL 518
           NS+ L  E  QQ + I+  +      +  L+   D+  L+  ED +  +   +Q L  +L
Sbjct: 459 NSKSLINENIQQRVQIFDEE--HVKFEFLLKRLSDRLALHRGEDEKTIIFVGSQQLCDLL 516

Query: 519 GNENLTNVLI-----AGVGSTEIASETELFNIETMSYLL---EKLLKDINIPESLWVLDV 570
            +E L N +      AG  S E     + F  ET + +L   E L + +N+PE   V+ +
Sbjct: 517 YDELLLNGITTFPIHAGKPSAERLRNLQKFK-ETDNGILICTEVLSRGLNVPEVSLVI-I 574

Query: 571 LEAAKFLVANVQTLLRTGLDNSGPLSIDFV 600
             AAK +   V T+ RTG   +  +++ FV
Sbjct: 575 YNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 34,006,618
Number of extensions: 1495312
Number of successful extensions: 5316
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5439
Number of HSP's successfully gapped: 54
Length of query: 1053
Length of database: 16,596,109
Length adjustment: 112
Effective length of query: 941
Effective length of database: 12,718,893
Effective search space: 11968478313
Effective search space used: 11968478313
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)