Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
CAGL0A00275g26626212930.0
YGL019W (CKB1)27827110711e-149
Sklu_1768.432926210351e-142
Scas_638.727026410271e-142
Kwal_47.1744925026510151e-140
KLLA0A04818g27725910031e-138
AGR163W2752669651e-132
Sklu_1979.22732294403e-53
Kwal_55.215702412344357e-53
Scas_699.432562234351e-52
YOR039W (CKB2)2582164184e-50
KLLA0E21967g2602304175e-50
ACR087C2572334132e-49
CAGL0I00946g2592324123e-49
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A00275g
         (262 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomy...   502   0.0  
YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II (Pr...   417   e-149
Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement        403   e-142
Scas_638.7                                                            400   e-142
Kwal_47.17449                                                         395   e-140
KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces c...   390   e-138
AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH] complement(...   376   e-132
Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement        174   3e-53
Kwal_55.21570                                                         172   7e-53
Scas_699.43                                                           172   1e-52
YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II Pr...   165   4e-50
KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces...   165   5e-50
ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH] (514602..51...   163   2e-49
CAGL0I00946g complement(76974..77753) highly similar to sp|P3893...   163   3e-49

>CAGL0A00275g 29069..29869 highly similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1, hypothetical start
          Length = 266

 Score =  502 bits (1293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/262 (91%), Positives = 240/262 (91%)

Query: 1   MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA 60
           MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA
Sbjct: 1   MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA 60

Query: 61  LDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHAR 120
           LDLILDLEMVSDEEDMD                      LVNRNIIGHAAEQLYGLIHAR
Sbjct: 61  LDLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVNRNIIGHAAEQLYGLIHAR 120

Query: 121 YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP 180
           YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP
Sbjct: 121 YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP 180

Query: 181 QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRMK 240
           QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRMK
Sbjct: 181 QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRMK 240

Query: 241 WLRQYPVTEEDWEEFNKCEFEM 262
           WLRQYPVTEEDWEEFNKCEFEM
Sbjct: 241 WLRQYPVTEEDWEEFNKCEFEM 262

>YGL019W (CKB1) [1954] chr7 (458159..458995) Casein kinase II
           (Protein kinase CK2), regulatory (beta) subunit [837 bp,
           278 aa]
          Length = 278

 Score =  417 bits (1071), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/271 (76%), Positives = 226/271 (83%), Gaps = 12/271 (4%)

Query: 3   EYMEDNSHS-----DDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHY 57
           E++ED S +     +DSG YDEWIPSFCSRFGHEYFCQVPT+FIEDDFNMTSL+QEVPHY
Sbjct: 4   EFVEDYSRTGSSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHY 63

Query: 58  RKALDLILDLEMVSDEEDMDXXXXXXXXXXXXXXX-------XXXXXXXLVNRNIIGHAA 110
           RKALDLILDLE +SDEE+ +                             +VN++II HAA
Sbjct: 64  RKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAA 123

Query: 111 EQLYGLIHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLY 170
           EQLYGLIHAR+ILTKPGLQAMAEKFDHK+FGTCPRY+C+GMQLLPCGLSDT+GK  VRLY
Sbjct: 124 EQLYGLIHARFILTKPGLQAMAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLY 183

Query: 171 CPSCQDLYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRIN 230
           CPSCQDLYLPQSSR LCLEGA+WGTSFPGVFLKHFKELEEYVERK+KESYELKVFGFRIN
Sbjct: 184 CPSCQDLYLPQSSRFLCLEGAFWGTSFPGVFLKHFKELEEYVERKSKESYELKVFGFRIN 243

Query: 231 DQAVSGPRMKWLRQYPVTEEDWEEFNKCEFE 261
           D+AVSGPRMKWLRQYP TEEDWEEF KCEFE
Sbjct: 244 DEAVSGPRMKWLRQYPSTEEDWEEFAKCEFE 274

>Sklu_1768.4 YGL019W, Contig c1768 4317-5306 reverse complement
          Length = 329

 Score =  403 bits (1035), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/262 (75%), Positives = 223/262 (85%), Gaps = 11/262 (4%)

Query: 3   EYMEDNSHSDDS--GTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA 60
           E++ED S S+ S  GTYDEWIPSFCSRFGHEYFCQVPT+FIEDDFNMT L+QE+PHYRKA
Sbjct: 73  EFIEDQSSSNSSDSGTYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTGLSQEIPHYRKA 132

Query: 61  LDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHAR 120
           LDLILDLE +SDE+D D                       VNR+I+ HAAEQLYGLIHAR
Sbjct: 133 LDLILDLEAMSDEDDEDDNDGAAEEDGSGEP---------VNRSIMEHAAEQLYGLIHAR 183

Query: 121 YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP 180
           YILTKPGLQ+MAEKFDHK+FGTCPRY+C GMQ+LPCGLSDT+GKQ VRLYCPSCQDLYLP
Sbjct: 184 YILTKPGLQSMAEKFDHKEFGTCPRYYCGGMQMLPCGLSDTLGKQTVRLYCPSCQDLYLP 243

Query: 181 QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRMK 240
           QSSRHLC++GA+WGTSFPGVFLKHFKELE+YVERK+K+ YELKVFGF+IN +AVSGPRMK
Sbjct: 244 QSSRHLCMDGAFWGTSFPGVFLKHFKELEDYVERKSKDVYELKVFGFKINGEAVSGPRMK 303

Query: 241 WLRQYPVTEEDWEEFNKCEFEM 262
           WLRQYP TE +WEEF KCEFE+
Sbjct: 304 WLRQYPATEAEWEEFEKCEFEI 325

>Scas_638.7
          Length = 270

 Score =  400 bits (1027), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/264 (74%), Positives = 218/264 (82%), Gaps = 5/264 (1%)

Query: 3   EYMEDNSHSD----DSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYR 58
           +++E  SH +    DSG Y+EWIPSFC+RFGHEYFC+VPT+FIEDDFN+TSL+QEVPHYR
Sbjct: 4   QFVEVPSHGELSDEDSGNYEEWIPSFCARFGHEYFCEVPTEFIEDDFNLTSLSQEVPHYR 63

Query: 59  KALDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIH 118
           KALDLILDLE +S+EE+ +                       VNR+II HAAEQLYGLIH
Sbjct: 64  KALDLILDLEAISEEEEEEDEDMVGANNGQTDELVKKKAQA-VNRSIIEHAAEQLYGLIH 122

Query: 119 ARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLY 178
           ARYILTKPGLQAMAEKFDHK+FGTCPRY C GMQLLPCGLSDTIGK  VRLYCPSCQDLY
Sbjct: 123 ARYILTKPGLQAMAEKFDHKEFGTCPRYHCGGMQLLPCGLSDTIGKYTVRLYCPSCQDLY 182

Query: 179 LPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPR 238
           LPQSSR LCLEGA+WGTSFPGVFLKHFKELE+YV RK K SYELKVFGF+IND+AVSG R
Sbjct: 183 LPQSSRFLCLEGAFWGTSFPGVFLKHFKELEDYVGRKTKNSYELKVFGFKINDRAVSGQR 242

Query: 239 MKWLRQYPVTEEDWEEFNKCEFEM 262
           MKWLRQYP  EE+WEEF KCEFE+
Sbjct: 243 MKWLRQYPSNEEEWEEFAKCEFEI 266

>Kwal_47.17449
          Length = 250

 Score =  395 bits (1015), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 187/265 (70%), Positives = 217/265 (81%), Gaps = 22/265 (8%)

Query: 1   MSEYMEDNSHS---DDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHY 57
           MSEY+ DNS S   D+SGT+DEWIPSFC+RFGHEYFCQVPT+FIEDDFNMT L QEVPHY
Sbjct: 1   MSEYVGDNSRSGSSDESGTFDEWIPSFCARFGHEYFCQVPTEFIEDDFNMTGLGQEVPHY 60

Query: 58  RKALDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLI 117
           RKALDL+LDLE +SDEE  D                       V+R+I+ HAAEQLYGL+
Sbjct: 61  RKALDLVLDLEAMSDEEGQDSEEP-------------------VSRSIVEHAAEQLYGLV 101

Query: 118 HARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDL 177
           HARYILTKPGLQAMAEKFDHK+FGTCPRY+C GMQ+LPCGL+DT+GK  VRLYCPSCQDL
Sbjct: 102 HARYILTKPGLQAMAEKFDHKEFGTCPRYYCAGMQMLPCGLTDTLGKLTVRLYCPSCQDL 161

Query: 178 YLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGP 237
           YLPQSSRHLCLEGA+WGTSFPGVFLKHFKELE+YV+RK+K++YEL+VFGFRI  +A SG 
Sbjct: 162 YLPQSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVDRKSKDTYELRVFGFRIASEAPSGA 221

Query: 238 RMKWLRQYPVTEEDWEEFNKCEFEM 262
           RM+WLRQ+P T ++  E  +CEF +
Sbjct: 222 RMRWLRQHPKTPQELRELQECEFHI 246

>KLLA0A04818g 429275..430108 similar to sp|P43639 Saccharomyces
           cerevisiae YGL019w CKB1 casein kinase II, beta subunit,
           start by similarity
          Length = 277

 Score =  390 bits (1003), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 182/259 (70%), Positives = 210/259 (81%), Gaps = 9/259 (3%)

Query: 4   YMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDL 63
           ++E ++ S DSG Y+EWIP+FCSRFGHEYFCQVPTDFIEDDFN+T L+QEV +YRKALD 
Sbjct: 3   FIEPSNDSSDSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDFNLTGLSQEVAYYRKALDT 62

Query: 64  ILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARYIL 123
           ILDLE  SDEE+                         V R+I+ H+AEQLYGLIHAR+IL
Sbjct: 63  ILDLESTSDEEEEKNDASSNSKKDNDAH---------VTRSIVEHSAEQLYGLIHARFIL 113

Query: 124 TKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSS 183
           TK GLQAMAEKFD K+FGTCPRY C  +QLLPCGLSDT+GKQ VRLYCPSCQDLY+PQSS
Sbjct: 114 TKAGLQAMAEKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLYCPSCQDLYIPQSS 173

Query: 184 RHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSGPRMKWLR 243
           RHL LEGAYWGTSFPGVFLKHFKELE+YVE+KNKE+YELK+FGF I  +A+ GPRM+WLR
Sbjct: 174 RHLSLEGAYWGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFSIAKEAICGPRMQWLR 233

Query: 244 QYPVTEEDWEEFNKCEFEM 262
           QYP T+E+WEEF KCEFE+
Sbjct: 234 QYPKTDEEWEEFKKCEFEI 252

>AGR163W [4474] [Homologous to ScYGL019W (CKB1) - SH]
           complement(1052587..1053414) [828 bp, 275 aa]
          Length = 275

 Score =  376 bits (965), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 176/266 (66%), Positives = 207/266 (77%), Gaps = 7/266 (2%)

Query: 4   YMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDL 63
           +MED S   +S  YDEWI SFCSRFGHE+FCQVPT+FIEDDFN+T L+ EVPHYR+ALDL
Sbjct: 3   FMEDVSDVSESSNYDEWITSFCSRFGHEFFCQVPTEFIEDDFNLTGLSAEVPHYRRALDL 62

Query: 64  ILDLEMVSDEED-------MDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGL 116
           ILDLE +S+E++                                +N++II H AEQLYGL
Sbjct: 63  ILDLESLSEEDEDGVAASAGAASNGGDHSNGTSVRQAAHADGQPINKSIIDHCAEQLYGL 122

Query: 117 IHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQD 176
           IHARYILTK GLQAMAEKFDHK+FGTCPRY+C GMQLLPCGLSDT+GK  VRLYC SCQD
Sbjct: 123 IHARYILTKQGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGLSDTLGKNTVRLYCASCQD 182

Query: 177 LYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQAVSG 236
           LYLP SSRHLCLEGA+WGTSFPGVFLKHFKELE+YVE+KNK  Y L++FGF +  +++SG
Sbjct: 183 LYLPHSSRHLCLEGAFWGTSFPGVFLKHFKELEDYVEQKNKNVYRLRIFGFPVAKESISG 242

Query: 237 PRMKWLRQYPVTEEDWEEFNKCEFEM 262
           PRM+WLRQYP TE +W+EF KCE+E+
Sbjct: 243 PRMEWLRQYPSTEAEWQEFEKCEYEI 268

>Sklu_1979.2 YOR039W, Contig c1979 3847-4668 reverse complement
          Length = 273

 Score =  174 bits (440), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 95/229 (41%), Positives = 128/229 (55%), Gaps = 26/229 (11%)

Query: 6   EDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLI 64
           E N  + DS  Y E WI  F  R GHEYFC V TD+I D FN+ +L + V  + + +  I
Sbjct: 38  EANHDTTDSSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVSRFTQVIQYI 97

Query: 65  LDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARYILT 124
           +D    +  E M                             +   A +LYGLIHARYI+T
Sbjct: 98  VDELDDTALEQMSRSRLEQ----------------------LESDARKLYGLIHARYIIT 135

Query: 125 KPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSR 184
             GLQ M +K+   DFG CPR +C+   LLP GL D  G   V+LYCPSC+DLY+P+SSR
Sbjct: 136 VKGLQKMLQKYRDADFGRCPRVYCNFQALLPVGLHDVPGIDCVKLYCPSCEDLYIPKSSR 195

Query: 185 HLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           H  ++GAY+GTSFPG+FL+ F E+   V +   + Y  ++FGF ++ QA
Sbjct: 196 HSSIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPRIFGFELHKQA 241

>Kwal_55.21570
          Length = 241

 Score =  172 bits (435), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 93/234 (39%), Positives = 128/234 (54%), Gaps = 26/234 (11%)

Query: 1   MSEYMEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRK 59
           M E   D +   DS  Y E WI  F  R GHEYFC + T++I D FN+ +L + V  + +
Sbjct: 6   MVEARPDTAEGSDSSEYAEFWIDLFLGRKGHEYFCDIDTEYITDRFNLINLQKSVNKFTQ 65

Query: 60  ALDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHA 119
            +  ++D       E M                             + H A +LYGLIHA
Sbjct: 66  VIQYMVDELDDGILEQMSSTRLEQ----------------------LEHDARKLYGLIHA 103

Query: 120 RYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYL 179
           RY++T  GLQ M +K+   DFG CPR +C+   LLP GL D  GK  V+LYC  C+DLY+
Sbjct: 104 RYVITIKGLQKMLQKYKEADFGRCPRVYCNFQPLLPVGLHDVPGKDCVKLYCACCEDLYI 163

Query: 180 PQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           P+SSRH  ++GAY+GTSFPG+FL+ F E+   V +   + Y  K+FGF ++ QA
Sbjct: 164 PKSSRHSAIDGAYFGTSFPGMFLQAFPEM---VPKHPVKRYVPKIFGFELHKQA 214

>Scas_699.43
          Length = 256

 Score =  172 bits (435), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 125/223 (56%), Gaps = 25/223 (11%)

Query: 11  SDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLILDLEMV 70
           +D S   DEWI  F  + GHEYFC +  D+I D FN+ +L + V  + + +  I+D    
Sbjct: 27  TDSSEYVDEWIDLFLGKKGHEYFCDIDPDYITDRFNLINLQKTVSKFSQVVQYIVDELDE 86

Query: 71  SDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARYILTKPGLQA 130
           S  E M                             + + A + YGLIHARYI+T  GLQ 
Sbjct: 87  SILETMSNARLEQ----------------------LENDARKFYGLIHARYIITVKGLQK 124

Query: 131 MAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSRHLCLEG 190
           M +KF   DFG CPR +C+   LLP GL DT G   V+LYC SC+DLY+P+S RH C++G
Sbjct: 125 MLDKFKDADFGRCPRVYCNYQPLLPVGLHDTPGMDCVKLYCASCEDLYIPKSMRHSCIDG 184

Query: 191 AYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           A++GTSFPG+FL+ F E+   V +   + Y  K+FGF ++ QA
Sbjct: 185 AFFGTSFPGMFLQAFPEM---VPKHPTKKYVPKIFGFELHKQA 224

>YOR039W (CKB2) [4851] chr15 (405767..406543) Casein kinase II
           Protein kinase CK2, regulatory (beta-prime) subunit [777
           bp, 258 aa]
          Length = 258

 Score =  165 bits (418), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 89/216 (41%), Positives = 121/216 (56%), Gaps = 25/216 (11%)

Query: 18  DEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDLILDLEMVSDEEDMD 77
           D WI  F  R GHEYFC V  ++I D FN+ +L + V  +   +  I+D    S  E+M 
Sbjct: 36  DMWIDLFLGRKGHEYFCDVDPEYITDRFNLMNLQKTVSKFSYVVQYIVDDLDDSILENMT 95

Query: 78  XXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARYILTKPGLQAMAEKFDH 137
                                       +   + +LYGLIHARYI+T  GLQ M  K+  
Sbjct: 96  HARLEQ----------------------LESDSRKLYGLIHARYIITIKGLQKMYAKYKE 133

Query: 138 KDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSSRHLCLEGAYWGTSF 197
            DFG CPR +C+  QLLP GL D  G   V+LYCPSC+DLY+P+SSRH  ++GAY+GTSF
Sbjct: 134 ADFGRCPRVYCNLQQLLPVGLHDIPGIDCVKLYCPSCEDLYIPKSSRHSSIDGAYFGTSF 193

Query: 198 PGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           PG+FL+ F ++   V +   + Y  K+FGF ++ QA
Sbjct: 194 PGMFLQAFPDM---VPKHPTKRYVPKIFGFELHKQA 226

>KLLA0E21967g 1951763..1952545 similar to sp|P38930 Saccharomyces
           cerevisiae YOR039w CKB2 casein kinase II beta chain,
           start by similarity
          Length = 260

 Score =  165 bits (417), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 122/230 (53%), Gaps = 26/230 (11%)

Query: 5   MEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKALDL 63
           + D     DSG Y E WI  F  + GHEYFC + T++I D FN+ +L + V  +   +  
Sbjct: 24  VNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQY 83

Query: 64  ILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARYIL 123
           ++D       E M                                   +LYGLIHARYI+
Sbjct: 84  MVDDLEEGIIESMSPARLEQLETD----------------------TRKLYGLIHARYII 121

Query: 124 TKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQSS 183
           T  GLQ M +K+   DFG CPRY C+   LLP GL D  G   V+LYCPSC+DLY P+SS
Sbjct: 122 TAKGLQKMLQKYKAADFGRCPRYHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSS 181

Query: 184 RHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           RH  ++GAY+GTSFPG+FL+ F E+     +   + Y  KVFGF ++ QA
Sbjct: 182 RHSAIDGAYFGTSFPGMFLQGFPEM---CPKHPTKRYVPKVFGFDLHKQA 228

>ACR087C [1134] [Homologous to ScYOR039W (CKB2) - SH]
           (514602..515375) [774 bp, 257 aa]
          Length = 257

 Score =  163 bits (413), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 129/233 (55%), Gaps = 26/233 (11%)

Query: 1   MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKA 60
           M++ +E NS +  S   + WI  F  + GHEYFC V T++I D FN+ +L + V  + + 
Sbjct: 19  MADAVETNS-TGSSDYVELWIDLFLGKKGHEYFCDVDTEYITDRFNLINLQKTVSKFTQV 77

Query: 61  LDLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHAR 120
           +  ++D    +  E M                             +   A +LYGLIHAR
Sbjct: 78  IQYMVDELDDTTLEAMSRTKLTQ----------------------LEADARKLYGLIHAR 115

Query: 121 YILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLP 180
           YI+T  GLQ M +K+   DF  CPR  C+   LLP GL D  G   V+LYCPSC+DLY+P
Sbjct: 116 YIITIKGLQKMLQKYRDADFCRCPRVHCNFQPLLPVGLHDVPGIDCVKLYCPSCEDLYIP 175

Query: 181 QSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           +SSRH  ++GAY+GTSFPG+FL+ F E+   V +   + Y  KVFGF ++ QA
Sbjct: 176 KSSRHSSIDGAYFGTSFPGMFLQAFPEV---VPKHPTKRYVPKVFGFDLHKQA 225

>CAGL0I00946g complement(76974..77753) highly similar to sp|P38930
           Saccharomyces cerevisiae YOR039w CKB2 casein kinase II
           beta chain, start by similarity
          Length = 259

 Score =  163 bits (412), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 92/232 (39%), Positives = 127/232 (54%), Gaps = 29/232 (12%)

Query: 3   EYMEDNSHSDDSGTYDE-WIPSFCSRFGHEYFCQVPTDFIEDDFNMTSLAQEVPHYRKAL 61
           E M+D +   DS  Y + WI  F  R GHEYFC V  ++I D FN+ +L + V  + + +
Sbjct: 24  EVMDDAT---DSSEYAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVV 80

Query: 62  DLILDLEMVSDEEDMDXXXXXXXXXXXXXXXXXXXXXXLVNRNIIGHAAEQLYGLIHARY 121
             I+D    S  E+M                             + + A + YGLIHARY
Sbjct: 81  QYIVDELDDSIVENMSKARLEQ----------------------LENDARKFYGLIHARY 118

Query: 122 ILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSDTIGKQAVRLYCPSCQDLYLPQ 181
           I+T  GLQ M  K+   DFG C R +C+   LLP GL D  G  +V+LYCPSC+DLY P+
Sbjct: 119 IITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPK 178

Query: 182 SSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKESYELKVFGFRINDQA 233
           SSRH  ++GAY+GTSFPG+FL+ F ++   V +     Y  K+FGF ++ QA
Sbjct: 179 SSRHSSIDGAYFGTSFPGMFLQAFPDM---VPKHPTARYVPKIFGFELHKQA 227

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.139    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,818,395
Number of extensions: 360673
Number of successful extensions: 824
Number of sequences better than 10.0: 15
Number of HSP's gapped: 814
Number of HSP's successfully gapped: 23
Length of query: 262
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 162
Effective length of database: 13,134,309
Effective search space: 2127758058
Effective search space used: 2127758058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)