Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR377C2272239671e-134
KLLA0E09207g2572341801e-15
Sklu_1742.22512231693e-14
YGL146C3111861643e-13
Kwal_23.34542581661173e-07
Scas_669.1627774999e-05
KLLA0B00935g21247680.59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR377C
         (223 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)...   377   e-134
KLLA0E09207g complement(825533..826306) weakly similar to sp|P53...    74   1e-15
Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement         70   3e-14
YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein...    68   3e-13
Kwal_23.3454                                                           50   3e-07
Scas_669.16                                                            43   9e-05
KLLA0B00935g complement(72528..73166) similar to sp|P54837 Sacch...    31   0.59 

>AGR377C [4688] [Homologous to ScYGL146C - SH] (1425385..1426068)
           [684 bp, 227 aa]
          Length = 227

 Score =  377 bits (967), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/223 (86%), Positives = 194/223 (86%)

Query: 1   MKKQVVLGMXXXXXXXGETMRWEVAPRKVGREVYECVRWEAGRAGALSVRVRRTDRVGHA 60
           MKKQVVLGM       GETMRWEVAPRKVGREVYECVRWEAGRAGALSVRVRRTDRVGHA
Sbjct: 1   MKKQVVLGMAAAAAAAGETMRWEVAPRKVGREVYECVRWEAGRAGALSVRVRRTDRVGHA 60

Query: 61  VDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDVCLINV 120
           VDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDVCLINV
Sbjct: 61  VDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDVCLINV 120

Query: 121 SRDASWRAIDTXXXXXXXXXXXXGRVPLTEDDMAVLAAVERDTRAQQTADAVLGSEHVRR 180
           SRDASWRAIDT            GRVPLTEDDMAVLAAVERDTRAQQTADAVLGSEHVRR
Sbjct: 121 SRDASWRAIDTVAAVEVAVHADAGRVPLTEDDMAVLAAVERDTRAQQTADAVLGSEHVRR 180

Query: 181 DLNESTYTWVVVRPXXXXXXXXXXYCMAVPAALLVLARGQRRQ 223
           DLNESTYTWVVVRP          YCMAVPAALLVLARGQRRQ
Sbjct: 181 DLNESTYTWVVVRPAMLALMLLAAYCMAVPAALLVLARGQRRQ 223

>KLLA0E09207g complement(825533..826306) weakly similar to sp|P53117
           Saccharomyces cerevisiae YGL146c hypothetical protein
           singleton, hypothetical start
          Length = 257

 Score = 73.9 bits (180), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 104/234 (44%), Gaps = 33/234 (14%)

Query: 17  GETMRWEVAPRKVGREVYECVRWEAG------------------RAGALSVRVRRTDRVG 58
            ET++  + P ++  +++   +WE                    +A  L   +   +   
Sbjct: 17  SETLKLPINPNRLEFDLWPYKKWEVDGSSDASSYQTCFEMNTNIKAKDLQFLIEIEEFTK 76

Query: 59  HAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRF-SANPAQQVDVCL 117
             V+  RFGPT+   G+Q + ++++D + N LV+ R    +G TV + S    Q   +CL
Sbjct: 77  WKVNVDRFGPTTSSKGKQVVNMDIYDEDQN-LVQSRHGLENGETVLYVSVYEHQNFQICL 135

Query: 118 INVSRDASWRAIDTXXXXXXXXXXXXGRVP-----LTEDDMAVLAAVERDTRAQQTADA- 171
           IN S D+SW AID+                     +T+DD+ +L+    D  +  +AD+ 
Sbjct: 136 INFSLDSSWNAIDSVKQVAISITSNDLIQKQKWDLITDDDLNLLSQGRDDLFSLVSADSG 195

Query: 172 ----VLGSEHVRRDLNESTYTWVVVRPXXXXXXXXXXYCMAVPAALL-VLARGQ 220
                L  +H  R+LNEST+++++ +           + +  P  L  ++++GQ
Sbjct: 196 QELHALDVDH--RNLNESTFSYLLAKVTILFCIIGVCHLLVFPILLYRIVSKGQ 247

>Sklu_1742.2 YGL146C, Contig c1742 1815-2570 reverse complement
          Length = 251

 Score = 69.7 bits (169), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 93/223 (41%), Gaps = 16/223 (7%)

Query: 4   QVVLGMXXXXXXXGETMRWEVAPRKVGR-------EVYECVRWEAG-RAGALSVRVRRTD 55
           Q   G        G+ +  +V P K  R       +  +C+ +++      ++  +   +
Sbjct: 13  QSCFGEIISFPSNGQKLSLKVPPVKDSRVREGDYGKYTQCITFDSSTETEDVTFVISVQE 72

Query: 56  RVGHAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDV 115
            + +  D  RFGP S   G+Q L LE++D   N+L   R +P     ++ + + + Q  +
Sbjct: 73  SLPYETDIDRFGPISSARGKQFLQLEIFDEYDNLLRGTRHLPNGDNVLQVNTHGSSQFRI 132

Query: 116 CLINVSRDASWRAID-----TXXXXXXXXXXXXGRVPLTEDDMAVLAAVERDTRAQ---Q 167
           CLIN+  D SW++ID     T                +TE+D  +L  V+ D       +
Sbjct: 133 CLINLVYDGSWKSIDVEKDVTITVTRRDKLLNPSLKIITEEDCDLLNEVKEDLFHMVNVK 192

Query: 168 TADAVLGSEHVRRDLNESTYTWVVVRPXXXXXXXXXXYCMAVP 210
           T   +   E   RDLNES++  ++ +            C+ VP
Sbjct: 193 TTQTLTDIEREHRDLNESSFELLMYQLIMVGVLSFLGNCVMVP 235

>YGL146C (YGL146C) [1841] chr7 complement(228754..229689) Protein
           with similarity to Bunyamwera virus RNA-directed RNA
           polymerase [936 bp, 311 aa]
          Length = 311

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 81/186 (43%), Gaps = 17/186 (9%)

Query: 22  WEVAPRKVGREVYECVRWEAGRAGA---LSVRVRRTDRVGHAVDEARFGPTSVQLGRQQL 78
           +E +      +   C  + AG   A   +   +   D +    D +RFG TS + GRQ L
Sbjct: 91  FEYSSNNSASDGAFCTVFNAGMNDASREVVFEIHVMDVLQEETDSSRFGGTSHERGRQSL 150

Query: 79  GLEVWDTEANVLVRDRRVPAHGRTVRFSANPA--QQVDVCLINVSRDASWRAIDTXXXXX 136
           G  V++ +   L+R ++  A G +V    NP    +  +C IN+  D SW +IDT     
Sbjct: 151 GFSVFNNKNGDLLRSKKNLASGTSV-IEVNPGNCNEFLICFINLVYDGSWSSIDTEKSVT 209

Query: 137 XXXXXXXGRVP---------LTEDDMAVLAAVERDTRAQQTAD-AVLGSEHVRRDLNEST 186
                     P         +T   +  L  V  D   Q  +D  +L  E  RRD+NE+T
Sbjct: 210 IKMTYNDKLDPDMLLHLVNQMTPQVVKALNTVS-DGLFQIVSDTTLLQMESDRRDINEAT 268

Query: 187 YTWVVV 192
           Y++++V
Sbjct: 269 YSYLIV 274

>Kwal_23.3454
          Length = 258

 Score = 49.7 bits (117), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 68/166 (40%), Gaps = 16/166 (9%)

Query: 36  CVRWEAG-RAGALSVRVRRTDRVGHAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDR 94
           C  +E    + + ++ +  TD + + +D +RF   S + G+Q L L + D   N L+R R
Sbjct: 60  CFGFEVDPNSFSATLAIEVTDTISYKIDWSRFDSNSCERGKQSLDLTITDCSDN-LLRAR 118

Query: 95  RVPAHGRTV----RFSANPAQQVDVCLINVSRDASWRAIDTXXXXXXXXXXXXGRVPLTE 150
                G+T     R  + P   +++C IN   D SW++ID              R     
Sbjct: 119 NNLRTGKTFIKVRRQDSEPT--LNLCFINRVYDCSWKSIDMDKTITVTLIDFDSRQTKEL 176

Query: 151 DDMAVLAAVERDTRA--------QQTADAVLGSEHVRRDLNESTYT 188
            +    AA E  T A         +    +   E  RRD NE T++
Sbjct: 177 KEQTEKAANELSTNAGELLPLLLPKEKQELFKLESNRRDFNEETFS 222

>Scas_669.16
          Length = 277

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 59  HAVDEARFGPTSVQLGRQQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVD--VC 116
           + +D  RFG TS + G+Q+L L V+   +  L++  R    G T+ F  NP  + D   C
Sbjct: 95  YKIDFTRFGGTSSEKGKQKLYLTVFGLRSGNLLQSTRDLLTGTTL-FQLNPDGENDFEFC 153

Query: 117 LINVSRDASWRAID 130
             N+  D SW +I+
Sbjct: 154 FQNLVFDRSWNSIN 167

>KLLA0B00935g complement(72528..73166) similar to sp|P54837
           Saccharomyces cerevisiae YML012w ERV25 component of the
           COPII-coated vesicles, 25 Kda singleton, start by
           similarity
          Length = 212

 Score = 30.8 bits (68), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 76  QQLGLEVWDTEANVLVRDRRVPAHGRTVRFSANPAQQVDVCLINVSR 122
           QQL L V D+  N   R+R +    R V F+A  +   DVC  NV++
Sbjct: 61  QQLNLYVRDSNGNEYRRNRDIAGEVRVV-FTAPQSTSFDVCFENVAQ 106

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,223,549
Number of extensions: 160073
Number of successful extensions: 256
Number of sequences better than 10.0: 8
Number of HSP's gapped: 252
Number of HSP's successfully gapped: 8
Length of query: 223
Length of database: 16,596,109
Length adjustment: 98
Effective length of query: 125
Effective length of database: 13,203,545
Effective search space: 1650443125
Effective search space used: 1650443125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)