Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR326C20219910741e-151
Scas_647.4270156952e-04
Kwal_33.1544423190830.007
KLLA0D01859g37159750.092
KLLA0E09702g21154730.10
YJR011C26191710.23
Sklu_1610.136569680.75
Scas_719.6779024633.0
Kwal_27.1027537971614.7
YMR276W (DSK2)37345598.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR326C
         (199 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)...   418   e-151
Scas_647.4                                                             41   2e-04
Kwal_33.15444                                                          37   0.007
KLLA0D01859g 161628..162743 similar to sp|P48510 Saccharomyces c...    33   0.092
KLLA0E09702g 861812..862447 no similarity, hypothetical start          33   0.10 
YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protei...    32   0.23 
Sklu_1610.1 YMR276W, Contig c1610 1143-2240                            31   0.75 
Scas_719.67                                                            29   3.0  
Kwal_27.10275                                                          28   4.7  
YMR276W (DSK2) [4230] chr13 (818826..819947) Protein required wi...    27   8.9  

>AGR326C [4637] [Homologous to ScYJR011C - SH] (1338045..1338653)
           [609 bp, 202 aa]
          Length = 202

 Score =  418 bits (1074), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 199/199 (100%), Positives = 199/199 (100%)

Query: 1   MSAMKYPEKAHLHHLILQHASDSIMFIWTMCFLCFYLESLPMTEPVNAVTSADRDQLVQW 60
           MSAMKYPEKAHLHHLILQHASDSIMFIWTMCFLCFYLESLPMTEPVNAVTSADRDQLVQW
Sbjct: 1   MSAMKYPEKAHLHHLILQHASDSIMFIWTMCFLCFYLESLPMTEPVNAVTSADRDQLVQW 60

Query: 61  LEAVKSQFHELLADPQSVDCRGVIDRPMLQGLGRIKDKMQAQLQVAKETRLVNVLANCYN 120
           LEAVKSQFHELLADPQSVDCRGVIDRPMLQGLGRIKDKMQAQLQVAKETRLVNVLANCYN
Sbjct: 61  LEAVKSQFHELLADPQSVDCRGVIDRPMLQGLGRIKDKMQAQLQVAKETRLVNVLANCYN 120

Query: 121 GFVHTLQFMRKLPVGNGQVSYEIPAHQWKVLLDEQESMNSNWKAQLKKFGVWSAKLIAPQ 180
           GFVHTLQFMRKLPVGNGQVSYEIPAHQWKVLLDEQESMNSNWKAQLKKFGVWSAKLIAPQ
Sbjct: 121 GFVHTLQFMRKLPVGNGQVSYEIPAHQWKVLLDEQESMNSNWKAQLKKFGVWSAKLIAPQ 180

Query: 181 DGITRDFLLQFCTQALTKV 199
           DGITRDFLLQFCTQALTKV
Sbjct: 181 DGITRDFLLQFCTQALTKV 199

>Scas_647.4
          Length = 270

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 81/156 (51%), Gaps = 19/156 (12%)

Query: 26  FIWTMCFLCFYLESL--PMTEPVNAVTSADRDQLVQWLEAVKSQFHELL-----ADPQS- 77
            I+T+ ++    E++    TE  +A+ +  + +L   +  ++++F  LL      DP++ 
Sbjct: 64  LIYTLYYVANTEENMQEKNTEKSDALLNL-KTELCSLVVKLRTRFRNLLDECDLNDPETP 122

Query: 78  VDCRGVIDRPMLQGLGRIKDKMQAQL-QVAKE-----TRLVNVLANCYNGFVHTLQFMRK 131
           +  R +ID+ ++  L ++ D +  +L +++ +       L+  L NC+NGF +   F++K
Sbjct: 123 IVFRNLIDKNIISILYQVNDILTNELGELSNDHDSNFNGLIIQLQNCFNGFGNLFNFVKK 182

Query: 132 LPVGNGQVSYEIPAHQWKVLLD-EQESMNSNWKAQL 166
           +P+   Q  Y++ + Q  VL+   +  +   WK QL
Sbjct: 183 MPL---QRQYKVTSLQLDVLITVVRNDLLPTWKTQL 215

>Kwal_33.15444
          Length = 231

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 41/90 (45%), Gaps = 5/90 (5%)

Query: 80  CRGVIDRPMLQGLGRIKDKMQAQLQVA-KETRLVNVLANCYNGFVHTLQFMRKLPVGNGQ 138
           C   +   + + + RI      + +   K T++   L NC  GFV    F RKLP+   Q
Sbjct: 99  CSNAVSTELYEIMERITSGSDGEYEAPMKLTKVPTHLKNCILGFVQIFHFFRKLPI---Q 155

Query: 139 VSYEIPAHQWKVL-LDEQESMNSNWKAQLK 167
             Y+I   Q +VL L+ +  +   W  Q++
Sbjct: 156 EQYQISKLQMRVLELELKTDLLGPWTRQVE 185

>KLLA0D01859g 161628..162743 similar to sp|P48510 Saccharomyces
           cerevisiae YMR276w DSK2 ubiquitin-like protein
           singleton, start by similarity
          Length = 371

 Score = 33.5 bits (75), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 46  VNAVTSADRDQLVQWLEA--VKSQFHELLADPQSVDCRGVIDRPMLQGLG-RIKDKMQA 101
           +N+   A+ + ++Q LE    +SQ +E+L++PQ VD   +   P LQ LG R +D +Q+
Sbjct: 141 LNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFL-IQQNPQLQALGPRARDMLQS 198

>KLLA0E09702g 861812..862447 no similarity, hypothetical start
          Length = 211

 Score = 32.7 bits (73), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 117 NCYNGFVHTLQFMRKLPVGNGQVSYEIPAHQWKVLLDEQESMNSNWKAQLKKFG 170
           N  NGF+    +++ LP  N     ++   QW++   E   +N  ++ QL  FG
Sbjct: 130 NVLNGFLFNEDYVKNLPALNE----DVKLSQWEIFAREVTQINKTYRIQLDHFG 179

>YJR011C (YJR011C) [2914] chr10 complement(458555..459340) Protein
           of unknown function [786 bp, 261 aa]
          Length = 261

 Score = 32.0 bits (71), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 80  CRGVIDRPM---LQGLGRIKDKMQAQLQVAKETRLVNVLANCYNGFVHTLQFMRKLPVGN 136
           CR +I++ +   + G+ R   +   +L V  +   +  + NC +GFV+  +F+ K+P+  
Sbjct: 118 CRHLIEKVLVTSIYGVNRYIFQELNRLNVDFKDEFILQMQNCLSGFVNLYKFLNKIPMSK 177

Query: 137 GQVSYEIPAHQWKVLLDE-QESMNSNWKAQL 166
            Q   ++   Q K+L++  Q  +   WK QL
Sbjct: 178 QQS--QMNDLQMKILVNVLQNELLPIWKFQL 206

>Sklu_1610.1 YMR276W, Contig c1610 1143-2240
          Length = 365

 Score = 30.8 bits (68), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 5/69 (7%)

Query: 37  LESLPMTEPVNAVTSA-DRDQLVQWLEA--VKSQFHELLADPQSVDCRGVIDRPMLQGLG 93
           L S  M  P   +T+A + D+++  L+   V+SQ +E+L++PQ VD   +   P LQ +G
Sbjct: 128 LPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFM-IQQNPQLQAMG 186

Query: 94  -RIKDKMQA 101
            R ++ +Q+
Sbjct: 187 PRARELLQS 195

>Scas_719.67
          Length = 790

 Score = 28.9 bits (63), Expect = 3.0,   Method: Composition-based stats.
 Identities = 10/24 (41%), Positives = 17/24 (70%)

Query: 48  AVTSADRDQLVQWLEAVKSQFHEL 71
           ++   DRD +VQWL+ ++SQF  +
Sbjct: 762 SLLDTDRDAVVQWLKILQSQFSNI 785

>Kwal_27.10275
          Length = 379

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 8/71 (11%)

Query: 29  TMCFLCFYLESLPMTE---PVNAVTSA-DRDQLVQWLE--AVKSQFHELLADPQSVDCRG 82
           T      YL +LP  +   P   +TSA + D +++ LE   ++SQ +E+L++PQ +D   
Sbjct: 122 TSARYAGYL-NLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFL- 179

Query: 83  VIDRPMLQGLG 93
           +   P LQ +G
Sbjct: 180 IQQSPQLQSMG 190

>YMR276W (DSK2) [4230] chr13 (818826..819947) Protein required with
           Rad23p for duplication of the spindle pole body,
           involved in ubiquitin-dependent protein degradation, has
           ubiquitin-like domain (UBL) that binds directly to 26S
           proteasome subunits Rpn1p and Rpn2p [1122 bp, 373 aa]
          Length = 373

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%), Gaps = 3/45 (6%)

Query: 51  SADRDQLVQWLEA--VKSQFHELLADPQSVDCRGVIDRPMLQGLG 93
           S ++D+L++ +E    +SQ +E+L++PQ +D   +   P LQ +G
Sbjct: 145 SNNQDELLRMMENPIFQSQMNEMLSNPQMLDFM-IQSNPQLQAMG 188

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.134    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,151,907
Number of extensions: 231409
Number of successful extensions: 755
Number of sequences better than 10.0: 11
Number of HSP's gapped: 754
Number of HSP's successfully gapped: 11
Length of query: 199
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 103
Effective length of database: 13,272,781
Effective search space: 1367096443
Effective search space used: 1367096443
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)