Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR325C91903379e-43
YJR010C-A (SPC1)94891443e-13
Sklu_2014.488861355e-12
Kwal_33.1544288821139e-09
Scas_647.390851061e-07
KLLA0E09724g9189833e-04
KLLA0C13926g78438547.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR325C
         (90 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH] (1337706....   134   9e-43
YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit...    60   3e-13
Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement       57   5e-12
Kwal_33.15442                                                          48   9e-09
Scas_647.3                                                             45   1e-07
KLLA0E09724g 862612..862887 weakly similar to sp|P46965 Saccharo...    37   3e-04
KLLA0C13926g 1195709..1198063 similar to sp|P40850 Saccharomyces...    25   7.3  

>AGR325C [4636] [Homologous to ScYJR010C-A (SPC1) - SH]
          (1337706..1337981) [276 bp, 91 aa]
          Length = 91

 Score =  134 bits (337), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 69/90 (76%), Positives = 69/90 (76%)

Query: 1  MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXX 60
          MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLS           
Sbjct: 1  MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSLTLYAFAAAYG 60

Query: 61 XXXXXXXXXXGKYRQQKLAWVGSAAATTKD 90
                    GKYRQQKLAWVGSAAATTKD
Sbjct: 61 LALLLVVPAYGKYRQQKLAWVGSAAATTKD 90

>YJR010C-A (SPC1) [2913] chr10 complement(457991..458275) Subunit
          of the signal peptidase complex [285 bp, 94 aa]
          Length = 94

 Score = 60.1 bits (144), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 39/89 (43%)

Query: 2  EIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXXX 61
          EI  D+ RKLVFPID+PSQR+  K   + L  G LV+C+LGF   SL             
Sbjct: 3  EILQDVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILGFAQQSLKVLLTAYGISCVI 62

Query: 62 XXXXXXXXXGKYRQQKLAWVGSAAATTKD 90
                     Y +QKL W         D
Sbjct: 63 TLICVLPAYPWYNKQKLRWAQPKIEINVD 91

>Sklu_2014.4 YJR010C-A, Contig c2014 5573-5839 reverse complement
          Length = 88

 Score = 56.6 bits (135), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 42/86 (48%)

Query: 2  EIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXXX 61
          E+  ++SR +VFPID+PSQ+   KL   IL  GT+VSC +GF   SL+            
Sbjct: 3  ELLQEISRIIVFPIDFPSQQYTEKLATRILAFGTVVSCSIGFVTQSLATLVYCYGACCLL 62

Query: 62 XXXXXXXXXGKYRQQKLAWVGSAAAT 87
                     Y +++L W G+   T
Sbjct: 63 CLLLVLPSYPTYNKRRLKWAGTKIET 88

>Kwal_33.15442
          Length = 88

 Score = 48.1 bits (113), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 38/82 (46%)

Query: 2  EIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXXX 61
          E+  ++ +KLVFPID+ SQR   +L +  L  GT+ +C +G +  SL+            
Sbjct: 3  EVLQEIQKKLVFPIDFASQRETDRLVNRTLIFGTIAACFIGLFTQSLANLMMSFGVSLAL 62

Query: 62 XXXXXXXXXGKYRQQKLAWVGS 83
                     Y +++  WV +
Sbjct: 63 CFAAVLPSYSAYNKRRPEWVKT 84

>Scas_647.3
          Length = 90

 Score = 45.4 bits (106), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 37/85 (43%)

Query: 3  IFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXXXX 62
          I +++ + LV PID+PSQ+R  +L   IL  G + + + GF   SL              
Sbjct: 4  ILDEIQKFLVLPIDFPSQKRTFELQQNILLIGAIAASIYGFLTQSLYNTLICYGVTFVVT 63

Query: 63 XXXXXXXXGKYRQQKLAWVGSAAAT 87
                    Y +QKL WV    AT
Sbjct: 64 LLLVVPPYPFYNKQKLQWVQPKLAT 88

>KLLA0E09724g 862612..862887 weakly similar to sp|P46965
          Saccharomyces cerevisiae YJR010ca SPC1 signal peptidase
          10.8 kDa subunit singleton, hypothetical start
          Length = 91

 Score = 36.6 bits (83), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 33/89 (37%)

Query: 1  MEIFNDLSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFYAGSLSXXXXXXXXXXX 60
          ME+  DL R+LVFPID+ SQ     +++  L   T  S + G+   S+            
Sbjct: 1  MEVLQDLGRQLVFPIDFESQSYTESISNKALYLITFFSFISGYLTESIKVSGIVFVLGLI 60

Query: 61 XXXXXXXXXXGKYRQQKLAWVGSAAATTK 89
                      Y + +  W  S     +
Sbjct: 61 VVLVIVLPPYSAYNKHRPQWANSGPTVVE 89

>KLLA0C13926g 1195709..1198063 similar to sp|P40850 Saccharomyces
           cerevisiae YNL085w MKT1 required for propagation of M2
           dsRNA satellite of L-A virus singleton, start by
           similarity
          Length = 784

 Score = 25.4 bits (54), Expect = 7.3,   Method: Composition-based stats.
 Identities = 11/38 (28%), Positives = 21/38 (55%)

Query: 7   LSRKLVFPIDYPSQRRVAKLTDIILGSGTLVSCLLGFY 44
           +S K++FP   P+  ++    D++  +   +  LLGFY
Sbjct: 499 ISNKVLFPASVPADEKLTTPFDLLATNFLRLLTLLGFY 536

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,965,539
Number of extensions: 45369
Number of successful extensions: 85
Number of sequences better than 10.0: 8
Number of HSP's gapped: 84
Number of HSP's successfully gapped: 8
Length of query: 90
Length of database: 16,596,109
Length adjustment: 61
Effective length of query: 29
Effective length of database: 14,484,411
Effective search space: 420047919
Effective search space used: 420047919
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 54 (25.4 bits)