Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR323C40239518410.0
Sklu_2014.24154099621e-128
Kwal_33.154354104118851e-116
KLLA0E09768g4054078491e-111
Scas_617.74204138471e-110
YGR193C (PDX1)4104007921e-102
CAGL0G09361g4294357672e-98
Scas_694.104792232504e-23
Sklu_2037.44712112321e-20
YNL071W (LAT1)4822082321e-20
Kwal_23.47254722122241e-19
KLLA0F04741g4732132203e-19
AER364W4532222185e-19
CAGL0J10186g4691822124e-18
Kwal_56.239344421221012e-04
Scas_693.29442106800.068
KLLA0D16522g46881780.13
YBR208C (DUR1,2)183558780.17
Kwal_23.535664986740.37
YOR227W124644740.46
YDR148C (KGD2)463111730.58
AGL200W436115710.90
CAGL0E01287g41368701.0
KLLA0F20834g61696701.1
CAGL0F00539g56561673.2
ADR051C181958664.8
Sklu_2172.143279645.6
Kwal_27.11951186958656.1
KLLA0E08107g182958647.2
Scas_657.14101849647.8
KLLA0A09823g131989648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR323C
         (395 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH] (1334333..1...   713   0.0  
Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement        375   e-128
Kwal_33.15435                                                         345   e-116
KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces c...   331   e-111
Scas_617.7                                                            330   e-110
YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate d...   309   e-102
CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces c...   300   2e-98
Scas_694.10                                                           100   4e-23
Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement         94   1e-20
YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide S-...    94   1e-20
Kwal_23.4725                                                           91   1e-19
KLLA0F04741g complement(463107..464528) similar to sp|P12695 Sac...    89   3e-19
AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH] complement(...    89   5e-19
CAGL0J10186g complement(995223..996632) highly similar to sp|P12...    86   4e-18
Kwal_56.23934                                                          44   2e-04
Scas_693.29                                                            35   0.068
KLLA0D16522g complement(1394850..1396256) similar to sp|P19262 S...    35   0.13 
YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea amid...    35   0.17 
Kwal_23.5356                                                           33   0.37 
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...    33   0.46 
YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutar...    33   0.58 
AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH] complement(...    32   0.90 
CAGL0E01287g 120567..121808 highly similar to sp|P19262 Saccharo...    32   1.0  
KLLA0F20834g complement(1942016..1943866) weakly similar to sp|P...    32   1.1  
CAGL0F00539g complement(56293..57990) highly similar to sp|P4041...    30   3.2  
ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH] (796213..8...    30   4.8  
Sklu_2172.1 YDR148C, Contig c2172 307-1605                             29   5.6  
Kwal_27.11951                                                          30   6.1  
KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharo...    29   7.2  
Scas_657.14                                                            29   7.8  
KLLA0A09823g 858458..862417 similar to sp|P40340 Saccharomyces c...    29   8.0  

>AGR323C [4634] [Homologous to ScYGR193C (PDX1) - SH]
           (1334333..1335541) [1209 bp, 402 aa]
          Length = 402

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/395 (90%), Positives = 358/395 (90%)

Query: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60
           MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD
Sbjct: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60

Query: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120
           VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT
Sbjct: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120

Query: 121 SEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTV 180
           SEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTV
Sbjct: 121 SEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTV 180

Query: 181 EEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNIELRPAQXXX 240
           EEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNIELRPAQ   
Sbjct: 181 EEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNIELRPAQPPK 240

Query: 241 XXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPY 300
                          YRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPY
Sbjct: 241 GAADKKAEPKPAPPAYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPY 300

Query: 301 SDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIFDILSGNXXXXXXXXXX 360
           SDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIFDILSGN          
Sbjct: 301 SDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIFDILSGNSVESKPAPSS 360

Query: 361 XXXXXXXXXLDLYLKVENKFSDSETRAARFIDYIK 395
                    LDLYLKVENKFSDSETRAARFIDYIK
Sbjct: 361 SEPSAHEYALDLYLKVENKFSDSETRAARFIDYIK 395

>Sklu_2014.2 YGR193C, Contig c2014 2083-3330 reverse complement
          Length = 415

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 205/409 (50%), Positives = 259/409 (63%), Gaps = 24/409 (5%)

Query: 1   MFR-SQLYKQSARI--SFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQ 57
           +FR S  Y  SA++  +  R FH +        F MPAMSPTMEKGG+V WK+KVGEPF 
Sbjct: 6   VFRNSAAYAASAKLLLTSSRGFHSAATLYKAQAFTMPAMSPTMEKGGVVEWKYKVGEPFS 65

Query: 58  AGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPK 117
           AGDV+LEVETDKAQIDVEAQDDGKLAAI+  +GSKD+ VGET+A+LAEV+DDL+ LEIPK
Sbjct: 66  AGDVLLEVETDKAQIDVEAQDDGKLAAIIIDNGSKDIKVGETIAYLAEVDDDLATLEIPK 125

Query: 118 VVTSEAPKEAEAKPSPKVSEQAPAPA-----------RKTPSKTVSNGILQQADKNQTLL 166
                  + A  KP+PK  E AP PA              P K   +GIL  A+ +QTL 
Sbjct: 126 Q------EPAAPKPTPKKQETAPTPAATPEPKKDNAPTSEPKKDTPSGILSTANPSQTLF 179

Query: 167 PSVITLLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHL 226
           PSV +LLH NG++VE+A  NIKASGPNGRILKGDVL YLGKIS D VVKV+EYIK  E L
Sbjct: 180 PSVQSLLHENGISVEDALNNIKASGPNGRILKGDVLAYLGKISNDCVVKVTEYIKSGESL 239

Query: 227 DLSNIELRPAQXXXXXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYIRE 286
           DL+NIEL+  +                  +    E L L+VP  VS ++ S +L+ YI E
Sbjct: 240 DLTNIELKKPELKLELGTSKTLLKPEPVVFT---ETLTLRVPSAVSSDQLSKSLRSYINE 296

Query: 287 ATYTAHGEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIFDI 346
           A Y +H + ++   SD +DP+FEEL++ +PR+PRF VSY + PL  V  SPK  +DIFD+
Sbjct: 297 ANYLSHEQPVNASTSDYYDPIFEELITPEPRQPRFSVSYQLTPLVPV-LSPKQHDDIFDL 355

Query: 347 LSGNXXXXXXXXXXXXXXXXXXXLDLYLKVENKFSDSETRAARFIDYIK 395
           LSG                    LD+ ++V  KF D+  +A RFI+Y+K
Sbjct: 356 LSGTSAATSSPQVEQPSKTTEYSLDVSVQVNGKFDDATLKAQRFIEYLK 404

>Kwal_33.15435
          Length = 410

 Score =  345 bits (885), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/411 (47%), Positives = 260/411 (63%), Gaps = 30/411 (7%)

Query: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60
           +FR QL     R+ + R  H S        F MPAMSPTMEKGG+V WKFKVGEPF AGD
Sbjct: 6   VFRRQLN----RLVYVRTLHQSGLVGKAQVFAMPAMSPTMEKGGVVEWKFKVGEPFSAGD 61

Query: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120
           V+LEVETDKAQIDVEAQDDGKLA I+  DG+KD++VGE +A+LAE EDDL+ LE+P+   
Sbjct: 62  VLLEVETDKAQIDVEAQDDGKLAKILVNDGAKDINVGEPIAYLAEPEDDLATLELPQ--- 118

Query: 121 SEAPKEAEAKPSPKVSEQAPAPARK----------------TPSKTVSNGILQQADKNQT 164
           SE  K++   P PKV +   A A+K                +      +G++ +AD  QT
Sbjct: 119 SEN-KQSTKAPEPKVEKDVKASAQKGQGSEPKAQKQTQVSSSSGSKDVSGVMVKADPAQT 177

Query: 165 LLPSVITLLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFE 224
           LLPSV  LLHAN ++ E+A  NI+ASGPNGRILKGDVL YLGK+S +++ K+++YI+K E
Sbjct: 178 LLPSVQLLLHANNISNEDALNNIQASGPNGRILKGDVLSYLGKVSQEAIAKLTKYIQKGE 237

Query: 225 HLDLSNIELRPAQXXXXXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYI 284
            LDLSNIEL+  +                       E+L LKV  +V+FE+FS +LK YI
Sbjct: 238 VLDLSNIELKKPEPASKAPESVVKKEPV-----IFTEQLHLKVEPNVTFEQFSRSLKSYI 292

Query: 285 REATYTAHGEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVPSSPKPKEDIF 344
            EA   +HGE + N  SD +D LFEEL++ +PR+PRF VSYD++PL     + K ++DIF
Sbjct: 293 DEARIISHGEPVSNVQSDYYDALFEELITPEPRKPRFSVSYDIIPLNARSLNAKQQDDIF 352

Query: 345 DILSGNXXXXXXXXXXXXXXXXXXXLDLYLKVENKFSDSETRAARFIDYIK 395
           D+L+G                    ++L ++V +KFSD++ +A RF+DY+K
Sbjct: 353 DLLAGT-KNTPASTESGNLQSNEVLVNLSVQVSDKFSDAKLKAERFVDYVK 402

>KLLA0E09768g 865604..866821 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, start by similarity
          Length = 405

 Score =  331 bits (849), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/407 (45%), Positives = 249/407 (61%), Gaps = 28/407 (6%)

Query: 1   MFRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60
           MFR  +  ++      R  H          F MPAMSPTME+GG+V WKFK G+ F AGD
Sbjct: 1   MFRLAIKNRACL----RQLHQCRTMLKAQAFGMPAMSPTMERGGVVDWKFKAGDTFSAGD 56

Query: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVT 120
           V+LEVETDKA IDVEAQDDGKLA I+K +G+KD+ VGE +A++A+V+DDL+ LE PK V 
Sbjct: 57  VLLEVETDKATIDVEAQDDGKLAKILKENGAKDIPVGEPIAYIADVDDDLATLEFPKPV- 115

Query: 121 SEAPKEA--------EAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITL 172
            EA KE+        EAKP  K  ++    A KTPSK   NG + QA+ +QTL PSV++L
Sbjct: 116 -EAKKESKPVETKKEEAKPVEKTDKKKQTSASKTPSK---NGSV-QANASQTLFPSVLSL 170

Query: 173 LHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNIE 232
           L  N ++  +A   IKA+GPNGRILKGDVL YLGKIS DS+ KV+EYIK  E LDL+NIE
Sbjct: 171 LEENNISTADALDKIKATGPNGRILKGDVLAYLGKISQDSLNKVTEYIKSHEKLDLTNIE 230

Query: 233 LRPAQXXXXXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAH 292
           LRPA+                     L E++ L VPE+V++ + S A+  Y++E ++ AH
Sbjct: 231 LRPARETAAAAAAAQAAKPAKPLPLVLSEQITLHVPENVTYSQLSAAIASYVKECSFLAH 290

Query: 293 GEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTVVP----SSPKPKEDIFDILS 348
            E L N  S+ +DPLFEELL  +P +PRF+V+Y+++ L   P    SSP+P  DIFD+LS
Sbjct: 291 DEPLTNDASELYDPLFEELLVQEPTKPRFKVTYNIVDLEPTPRHRTSSPQP--DIFDLLS 348

Query: 349 GNXXXXXXXXXXXXXXXXXX----XLDLYLKVENKFSDSETRAARFI 391
           G                        L++ + V+   +D++ RA  F+
Sbjct: 349 GTTTQELQQEASAVSKQQQTRHEYALNVSVAVDESLTDAKQRAENFV 395

>Scas_617.7
          Length = 420

 Score =  330 bits (847), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/413 (46%), Positives = 250/413 (60%), Gaps = 25/413 (6%)

Query: 2   FRSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDV 61
            RS L  Q+ R S  R  H S +  +   F MPAMSPTMEKGGIVSWKFKVGEPF +GDV
Sbjct: 7   MRSCLQGQTRR-SLIRSIHLSRSLLSAQKFTMPAMSPTMEKGGIVSWKFKVGEPFSSGDV 65

Query: 62  ILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTS 121
           +LEVETDKAQIDVEAQDDGKLA I+KGDGSKDVDVGET+A+LA+V+DDLS L+I    ++
Sbjct: 66  LLEVETDKAQIDVEAQDDGKLAKILKGDGSKDVDVGETIAYLADVDDDLSTLKI----SA 121

Query: 122 EAPKEAEAKPSPKVSE----------QAPAPARKTPSKTVSNGILQQADKNQTLLPSVIT 171
           E  ++ +  P  KV E          Q    A+++P  T  NG+LQ A  NQTLLPSV  
Sbjct: 122 EEEEQVKVTPVSKVEEKTTSGNKEPLQNTKKAKESPIATDKNGVLQVAKSNQTLLPSVSL 181

Query: 172 LLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNI 231
           LL AN ++ E+A  NIKASG +G +LKGDVL YLGKI   S++KVSEY+K  E  D S+I
Sbjct: 182 LLAANNISKEDAIRNIKASGRDGLLLKGDVLAYLGKIPESSLIKVSEYVKNKEKQDFSHI 241

Query: 232 E---LRPAQXXXXXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYIREAT 288
           E   L  A+                     LH  + LKVP +VS ER  N +K +I E  
Sbjct: 242 ELGSLTKAEPPQSEKLEDKAIEKISKEPVLLHSEITLKVPSNVSRERLDNTVKSFIEEGF 301

Query: 289 YTAHGEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDV-LPLTVVPS-SPKPKEDIFDI 346
              H   L N  S  FD +FE+L++  PREPRF+V+Y++  P+      + K +EDIFD+
Sbjct: 302 EYTHAMPLSNINSQYFDDIFEDLITTAPREPRFQVNYELYCPVEEEERFTRKDREDIFDL 361

Query: 347 LSGNXXXX-----XXXXXXXXXXXXXXXLDLYLKVENKFSDSETRAARFIDYI 394
           L+G+                        L L L+V +K+SDS+ +A RF++Y+
Sbjct: 362 LAGSESRTPLRGPVVSNSEASTPASEWTLSLELEVSDKYSDSKQKAERFLEYM 414

>YGR193C (PDX1) [2143] chr7 complement(884512..885744) Pyruvate
           dehydrogenase complex protein X, the binding protein for
           Lpd1p [1233 bp, 410 aa]
          Length = 410

 Score =  309 bits (792), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/400 (44%), Positives = 238/400 (59%), Gaps = 18/400 (4%)

Query: 8   KQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVET 67
           K   R   +  +H S    A+  F MPAMSPTMEKGGIVSWK+KVGEPF AGDVILEVET
Sbjct: 12  KSCTRYLTKCNYHASAKLLAVKTFSMPAMSPTMEKGGIVSWKYKVGEPFSAGDVILEVET 71

Query: 68  DKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEA 127
           DK+QIDVEA DDGKLA I+K +GSKDVDVGE +A++A+V+DDL+ +++P+   +   K  
Sbjct: 72  DKSQIDVEALDDGKLAKILKDEGSKDVDVGEPIAYIADVDDDLATIKLPQEANTANAKSI 131

Query: 128 EAKP----SPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTVEEA 183
           E K     S + ++Q    A  TP KTV      QA+  QTLLPSV  LL  N ++ ++A
Sbjct: 132 EIKKPSADSTEATQQHLKKATVTPIKTVDGS---QANLEQTLLPSVSLLLAENNISKQKA 188

Query: 184 FANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSN---IELRPAQXXX 240
              I  SG NGR+LKGDVL YLGKI  DSV KV+E+IKK E LDLSN   I+L+P     
Sbjct: 189 LKEIAPSGSNGRLLKGDVLAYLGKIPQDSVNKVTEFIKKNERLDLSNIKPIQLKPKIAEQ 248

Query: 241 XXXXXXXXXXXXXXXYRTLHERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPY 300
                          +    E+L+   P  + F++ S +L  +++EA   +HG  L +  
Sbjct: 249 AQTKAADKPKITPVEF---EEQLVFHAPASIPFDKLSESLNSFMKEAYQFSHGTPLMDTN 305

Query: 301 SDRFDPLFEELLSVQPREPRFEVSYDVL--PLTVVPSSPKPKEDIFDILSGNXXXXXXXX 358
           S  FDP+FE+L+++ PREPRF+ SYD++  P          +EDIFD+L+G+        
Sbjct: 306 SKYFDPIFEDLVTLSPREPRFKFSYDLMQIPKANNMQDTYGQEDIFDLLTGSDATASSVR 365

Query: 359 XXXXXXXXXXXLDLYLKV---ENKFSDSETRAARFIDYIK 395
                        L L V     KF+D+E +A RF+DY++
Sbjct: 366 PVEKNLPEKNEYILALNVSVNNKKFNDAEAKAKRFLDYVR 405

>CAGL0G09361g 893614..894903 similar to sp|P16451 Saccharomyces
           cerevisiae YGR193c PDX1 pyruvate dehydrogenase complex
           protein X, hypothetical start
          Length = 429

 Score =  300 bits (767), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 181/435 (41%), Positives = 243/435 (55%), Gaps = 59/435 (13%)

Query: 1   MFRSQLYKQ-----SARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEP 55
           + RSQL  +        +   R F  +     ++PF MPAMSPTMEKGGIVSWKFK  + 
Sbjct: 8   LNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFLMPAMSPTMEKGGIVSWKFKENDS 67

Query: 56  FQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEI 115
           F AGDV+LEVETDKAQIDVEAQDDGKLA I++GDGSKDV VG+ +AF A+ EDDLS L+I
Sbjct: 68  FNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDGSKDVLVGDVIAFTADPEDDLSTLKI 127

Query: 116 PKV------VTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNG--------ILQQADK 161
           P+V      V+S + KE +    P  SE+ PAP ++   K VS          +L  AD 
Sbjct: 128 PEVTESMKQVSSGSGKEDQ---KPAKSEE-PAPLQRKEGKNVSESKTAKSSGDVLTTADA 183

Query: 162 NQTLLPSVITLLHANGVTVEEAFANIKASGPNGRILKGDVLGYLGKISADSVVKVSEYIK 221
           +QTLLPSV+  L  NG++ E+A ANIKASG NGRILKGDVL Y GKI  DSVVKV+EY+ 
Sbjct: 184 SQTLLPSVVMALADNGISKEDALANIKASGANGRILKGDVLAYAGKIQQDSVVKVAEYVN 243

Query: 222 KFEHLDLSNIELRPAQXXXXXXXXXXXXXXXXXXYRT---------------------LH 260
           + + LDLSNIE    +                   +                      + 
Sbjct: 244 RNQKLDLSNIERIVLEVNSEEGGDGQAQAQAQAQAQGQGQDSGKTGKLAKPAQVEPIRIQ 303

Query: 261 ERLILKVPEHVSFERFSNALKQYIREATYTAHGEALDNPYSDRFDPLFEELLSVQPREPR 320
           E ++L+V   V F RF  A+++YI +     H + L+N  S+R+D LFE+L++V PR  R
Sbjct: 304 EEILLEVRRGVDFTRFERAVREYIDDIYQYTHEQPLENTMSERYDSLFEDLVTVDPRSAR 363

Query: 321 FEVSYDVLPLTVVPSSPKPKEDIFDILSGNXXXXXXXXXXXXXXXXXXXLDLYLKVENKF 380
           F+V Y +L  T         EDIFD+L                      L++ + V +K+
Sbjct: 364 FDVEYSLLETT------DGSEDIFDLLGPG---------EVKEGKQVYSLEVSVTVNDKY 408

Query: 381 SDSETRAARFIDYIK 395
            D+  +A RF++ ++
Sbjct: 409 DDAVEKADRFMECLR 423

>Scas_694.10
          Length = 479

 Score =  100 bits (250), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/223 (33%), Positives = 108/223 (48%), Gaps = 39/223 (17%)

Query: 2   FRSQLYKQSARISFRRPFHGSMAPR-AITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGD 60
           F S   +   R   R     S A   A T   MP++SPTM  G +V+W  +VG+    GD
Sbjct: 11  FSSTSLRSQLRTQLRLQLTASYASYPAHTIIGMPSLSPTMTHGNLVAWSKQVGDQLAPGD 70

Query: 61  VILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKV-- 118
           V+ E+ETDKAQ+D E QDDG LA I+  +G+KDV + + +A   E  DD++A +  K+  
Sbjct: 71  VLAELETDKAQMDFEFQDDGYLAKILVPEGTKDVPINKPIAVYVEDADDVAAFKDFKIED 130

Query: 119 ------------VTSEAPKE-----AEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADK 161
                       V  E P++     A+ +P+ K  EQ  +P             + Q D 
Sbjct: 131 SADAAATTTTTEVKEEKPQQPEKINAQQQPTQKSKEQKSSP-------------VTQEDT 177

Query: 162 NQTLLPSVIT--LLHANGVTVEEAFANIKASGPNGRILKGDVL 202
              ++ S +   +   NGV    A    K SGP+GRI+K DVL
Sbjct: 178 TGRIIASPLAKKIALENGV----ALKGFKGSGPHGRIVKDDVL 216

>Sklu_2037.4 YNL071W, Contig c2037 4059-5474 reverse complement
          Length = 471

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 107/211 (50%), Gaps = 15/211 (7%)

Query: 3   RSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVI 62
           RS L   SAR+  R   + S  P  I    MPA+SPTM +G +  W  KVG+    G+VI
Sbjct: 12  RSALV-SSARLQLRT--YASYPPHTI--IGMPALSPTMTQGNLAVWSKKVGDSLSPGEVI 66

Query: 63  LEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALE---IPKVV 119
            E+ETDKAQ+D E Q++G LA I+  +G+KD+ V + +A   E E D+ A +   +    
Sbjct: 67  AEIETDKAQMDFEFQEEGFLAKILVPEGTKDIPVNKPIAVYVEEEGDVEAFKDFTVDDSA 126

Query: 120 TSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLL---PSVITLLHAN 176
           +    +  + +   +  + A  PA  TPS+  S+     +  +   +   P   T+    
Sbjct: 127 SPAKKEAPKEEAPKEEEQAATKPASSTPSQNKSSSSSSSSSAHAGRIFASPLAKTIALEK 186

Query: 177 GVTVEEAFANIKASGPNGRILKGDVLGYLGK 207
           G+    A  N+  +GP+GRI K D+  +L K
Sbjct: 187 GI----ALKNVTGTGPHGRITKADIETFLAK 213

>YNL071W (LAT1) [4519] chr14 (491522..492970) Dihydrolipoamide
           S-acetyltransferase component (E2) of pyruvate
           dehydrogenase complex [1449 bp, 482 aa]
          Length = 482

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 104/208 (50%), Gaps = 13/208 (6%)

Query: 3   RSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVI 62
           RS +  +S R+  R   + S     I    MPA+SPTM +G + +W  K G+    G+VI
Sbjct: 13  RSSVLTRSLRLQLR--CYASYPEHTI--IGMPALSPTMTQGNLAAWTKKEGDQLSPGEVI 68

Query: 63  LEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSA-----LEIPK 117
            E+ETDKAQ+D E Q+DG LA I+  +G+KD+ V + +A   E + D+ A     LE   
Sbjct: 69  AEIETDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFKDFKLEDSG 128

Query: 118 VVTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANG 177
             +  + K   A+P  +  ++APA   KT +       +          P   T+    G
Sbjct: 129 SDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLAKTIALEKG 188

Query: 178 VTVEEAFANIKASGPNGRILKGDVLGYL 205
           +++++    +  +GP GRI K D+  YL
Sbjct: 189 ISLKD----VHGTGPRGRITKADIESYL 212

>Kwal_23.4725
          Length = 472

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 107/212 (50%), Gaps = 24/212 (11%)

Query: 9   QSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETD 68
           +SAR+  R   + S  P  +    MPA+SPTM +G +  W  K G+  + G+ I E+ETD
Sbjct: 17  RSARLQLRA--YASYPPHTV--IGMPALSPTMTQGNLAVWLKKAGDKLEPGEAIAEIETD 72

Query: 69  KAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSAL--------EIPKVVT 120
           KAQ++ E Q+DG LA I+  +GSKD+ VG+ +A   E E D+ A            K   
Sbjct: 73  KAQMEFEFQEDGYLAKILVPEGSKDLPVGKPIAVYVEEEGDVGAFADFTAEEAAPEKPAA 132

Query: 121 SEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVI--TLLHANGV 178
           +   K+ E +      E++  PA+K      S+G    A     ++ S +  T+    G+
Sbjct: 133 APEKKQDEPQQQAAQKEESGKPAKK------SSGATSAAPSGDRIIASPLAKTIALDKGI 186

Query: 179 TVEEAFANIKASGPNGRILKGDVLGYLGKISA 210
           +++     +  +GP GRI K DV  YL K SA
Sbjct: 187 SLKA----VTGTGPRGRITKADVEEYLSKSSA 214

>KLLA0F04741g complement(463107..464528) similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 473

 Score = 89.4 bits (220), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 106/213 (49%), Gaps = 18/213 (8%)

Query: 3   RSQLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVI 62
           R  +   +AR+  R   + S  P  I    MPA+SPTM +GG+  W   VG+  + GDV+
Sbjct: 11  RMSVLACAARLQLRT--YASYPPYTI--IGMPALSPTMVQGGLTEWSKNVGDRLEPGDVL 66

Query: 63  LEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSAL-------EI 115
            EVETDKAQ+D E Q++G LA I+   G+KD+ V + +A   E E D+ A          
Sbjct: 67  AEVETDKAQMDFEFQEEGYLAKILVPAGTKDIPVNKPLAVYVEEESDVPAFANFTAADAE 126

Query: 116 PKVVTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLL---PSVITL 172
                 EA K    +P+ + S++      K  SK  +      +  + T +   P   ++
Sbjct: 127 SATAAKEAAKNGAKQPAKEESKEESKEGAKPASKPAAKKSSGSSASSGTRIFASPLAKSI 186

Query: 173 LHANGVTVEEAFANIKASGPNGRILKGDVLGYL 205
              +GV+++E    ++ +GP GRI K DV  +L
Sbjct: 187 ALEHGVSLKE----VEGTGPRGRITKDDVEAFL 215

>AER364W [2865] [Homologous to ScYNL071W (LAT1) - SH]
           complement(1312487..1313848) [1362 bp, 453 aa]
          Length = 453

 Score = 88.6 bits (218), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 114/222 (51%), Gaps = 10/222 (4%)

Query: 11  ARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKA 70
           AR+  R   + S  P  I    MPA+SPTM +G +  W  K G+    G+V+ EVETDKA
Sbjct: 18  ARMQLRT--YASYPPHTI--IGMPALSPTMTQGNLAVWTKKEGDKLSPGEVLAEVETDKA 73

Query: 71  QIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEA-PKEAEA 129
           Q+D E Q++G LA I+  +G+KDV V + +A   E E D++A +  KV  S A  K+A A
Sbjct: 74  QMDFEFQEEGFLAKILVPEGAKDVPVNKPIAVYVEEEGDVAAFKDFKVEESAAESKDAPA 133

Query: 130 KPSPKVSEQAPAPARKTPSKTVSNGILQQADKNQTLLPSVITLLHANGVTVEEAFANIKA 189
           K     ++ APA A    +   S G      +     P   T+    G++++E    +  
Sbjct: 134 KEEAAPAKAAPAAAAPAKAAKKSTGSAASGGRIMA-SPLAKTIALEKGISLKE----VTG 188

Query: 190 SGPNGRILKGDVLGYLGKISADSVVKVSEYIKKFEHLDLSNI 231
           +GPNGRI K DV  YL K    +    +     +E + +SN+
Sbjct: 189 TGPNGRITKEDVEKYLAKAPKKTESAAAPAAATYEDVPISNM 230

>CAGL0J10186g complement(995223..996632) highly similar to sp|P12695
           Saccharomyces cerevisiae YNL071w LAT1 dihydrolipoamide
           S-acetyltransferase, start by similarity
          Length = 469

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 96/182 (52%), Gaps = 8/182 (4%)

Query: 29  TPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKG 88
           T   MPA+SPTM +G +  W  K G+    GDV+ E+ETDKAQ+D E QD+G LA I+  
Sbjct: 36  TVIGMPALSPTMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVP 95

Query: 89  DGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEAEAKPSPKVSEQAPAPARKTPS 148
            G+KDV V   +A   E E D++A    K  T E    +++  +P   EQ   P ++   
Sbjct: 96  AGTKDVAVSRPIAVYVEDEADVAAF---KDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVK 152

Query: 149 KTVSNGILQQADKNQTLLPS---VITLLHANGVTVEEAFA--NIKASGPNGRILKGDVLG 203
           +  S     +++   + + S   +I    A  + +E+  A  ++K +GP GRI K DV  
Sbjct: 153 EEKSEKKAAKSNSTPSSVASGDRIIASPLAKTIALEKGIALKSVKGTGPRGRITKADVEK 212

Query: 204 YL 205
           YL
Sbjct: 213 YL 214

>Kwal_56.23934
          Length = 442

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 65/122 (53%), Gaps = 3/122 (2%)

Query: 22  SMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGK 81
           ++A  A T   +P M+ ++ +G +  +  +VGE  +  +++  +ETDK  ++V A   GK
Sbjct: 49  AVARMASTTVKVPPMAESLTEGSLKEYTKQVGEFIKQDELLATIETDKIDVEVNAPTSGK 108

Query: 82  LAAIVKGDGSKDVDVGETVAFL-AEVEDDLSALEIPKVVTSEAPKEAEAKPSPKVSEQAP 140
           +  +        V VG+ +A + A  E   S  + PK  + E PK++ ++ +PK  ++A 
Sbjct: 109 VTKL-NFQPEDTVTVGDDLAEIEAGAEAPASGQDAPKETSQEQPKQS-SESAPKKEQEAA 166

Query: 141 AP 142
           AP
Sbjct: 167 AP 168

>Scas_693.29
          Length = 442

 Score = 35.4 bits (80), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 54/106 (50%), Gaps = 2/106 (1%)

Query: 10  SARISFRRPFHGSMAPR-AITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETD 68
           S  +SF++  + ++A R A T   +P M+ ++ +G +  +   VG+  +  +++  +ETD
Sbjct: 44  SPHVSFQKLTNFTLAQRWASTSVKVPQMAESLTEGSLKEFTKAVGDFIEQDELLATIETD 103

Query: 69  KAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALE 114
           K  I+V A   G ++ +        V VGE +A + E E   S  E
Sbjct: 104 KIDIEVIAPVSGTVSKL-NFKPEDTVTVGEELATIEEGEGSASKSE 148

>KLLA0D16522g complement(1394850..1396256) similar to sp|P19262
           Saccharomyces cerevisiae YDR148c KGD2 2-oxoglutarate
           dehydrogenase complex E2 component, start by similarity
          Length = 468

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 23  MAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGKL 82
           MA R  T   +P M+ ++ +G +  +  KVG+  +  +++  +ETDK  ++V +   G +
Sbjct: 74  MAVRHATSVPVPPMAESLTEGSLKEYTKKVGDFIEKDELLATIETDKIDVEVISPISGTI 133

Query: 83  AAIVKGDGSKD--VDVGETVA 101
           A   K + S D  V VGE +A
Sbjct: 134 A---KLNFSPDDTVTVGEEIA 151

>YBR208C (DUR1,2) [390] chr2 complement(636660..642167) Urea
            amidolyase, contains urea carboxylase and allophanate
            hydrolase activities fused together in a single
            polypeptide [5508 bp, 1835 aa]
          Length = 1835

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 48   WK--FKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFL 103
            WK    VG+  +AG  +L +E  KA++ + A   GK+  I  G+G   VD G+ VA +
Sbjct: 1775 WKSIASVGDVIEAGQGLLIIEAMKAEMIISAPKSGKIIKICHGNGDM-VDSGDIVAVI 1831

>Kwal_23.5356
          Length = 649

 Score = 33.1 bits (74), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 41/86 (47%), Gaps = 3/86 (3%)

Query: 69  KAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEAE 128
           +A  +++ Q D KLA  V+        + +    +A++ED+ + LE  +   +   ++ +
Sbjct: 563 QASTELKHQIDDKLAEDVEQSQKSKERIEQ---LMAQIEDERALLETLEKQVATVTEQLK 619

Query: 129 AKPSPKVSEQAPAPARKTPSKTVSNG 154
             PSP+V    P P  +T  +   NG
Sbjct: 620 KTPSPRVRSSNPGPRERTKQRKQQNG 645

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
           function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 119 VTSEAPKEAEAKPSPKVSEQAPAPARKTPSKTVSNGILQQADKN 162
           V +E      A  + KVS+Q   P R+T S +VS G+LQ+ + N
Sbjct: 71  VNNELSNSKPAVSAEKVSQQGQVPTRRTRSHSVSYGLLQKKNNN 114

>YDR148C (KGD2) [993] chr4 complement(753669..755060) 2-oxoglutarate
           dehydrogenase (alpha-ketoglutarate dehydrogenase)
           complex KE2 component dihydrolipoamide
           S-succinyltransferase [1392 bp, 463 aa]
          Length = 463

 Score = 32.7 bits (73), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 16/111 (14%)

Query: 29  TPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKG 88
           T   +P M+ ++ +G +  +   VG+  +  +++  +ETDK  I+V +   G +  +   
Sbjct: 74  TSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVNSPVSGTVTKL-NF 132

Query: 89  DGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSEAPKEAEAKPSPKVSEQA 139
                V VGE               E+ +V   EAP E   +  P+ +EQA
Sbjct: 133 KPEDTVTVGE---------------ELAQVEPGEAPAEGSGESKPEPTEQA 168

>AGL200W [4112] [Homologous to ScYDR148C (KGD2) - SH]
           complement(321080..322390) [1311 bp, 436 aa]
          Length = 436

 Score = 32.0 bits (71), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 8/115 (6%)

Query: 27  AITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIV 86
           A T   +P M+ ++ +G +  +  +VGE  +  +++  +ETDK  I+V A   G +  + 
Sbjct: 59  ASTSVQVPPMAESLTEGSLKEFTKQVGEYIEQDELLATIETDKIDIEVNAPVSGTVTKL- 117

Query: 87  KGDGSKDVDVGETVAFLAEVEDDLSALEIPKVVTSE---APKEAEAKPSPKVSEQ 138
                  V VGE    LA++E+  +     K    E   AP+EA A  SP   E+
Sbjct: 118 NFKPEDTVTVGEE---LAQIEEGAAPAGGQKPAAKEETSAPQEA-APASPAAKEE 168

>CAGL0E01287g 120567..121808 highly similar to sp|P19262
          Saccharomyces cerevisiae YDR148c oxoglutarate
          dehydrogenase complex E2 component, hypothetical start
          Length = 413

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%)

Query: 18 PFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVETDKAQIDVEAQ 77
          P + S    A T   +P+M+ ++ +G +  +  KVGE  +  +++  +ETDK  I+V + 
Sbjct: 30 PAYLSQYRWASTSVKVPSMAESLTEGSLKEFTKKVGEFVEQDELLATIETDKIDIEVNSP 89

Query: 78 DDGKLAAI 85
            G +  +
Sbjct: 90 VSGTVTKL 97

>KLLA0F20834g complement(1942016..1943866) weakly similar to
           sp|P34761 Saccharomyces cerevisiae YNL197c WHI3 involved
           in regulation of cell size, start by similarity
          Length = 616

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 2/96 (2%)

Query: 5   QLYKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWK--FKVGEPFQAGDVI 62
           QL  Q    SF+ P  GS++         P  S + ++  ++  +  F   +PF A +  
Sbjct: 192 QLQPQLNTNSFQIPSSGSVSSNVAPTLTSPPQSSSRKRPSLLGQRSRFSFSDPFSAENPH 251

Query: 63  LEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGE 98
           +      AQ  ++  D GK   +++GDG  D   G 
Sbjct: 252 IPPAQTSAQTPLQNIDAGKSFLLMEGDGINDTIWGS 287

>CAGL0F00539g complement(56293..57990) highly similar to sp|P40413
           Saccharomyces cerevisiae YJR064w CCT5 T-complex protein
           1, epsilon subunit, hypothetical start
          Length = 565

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 271 VSFERFSNALKQYIREATYTAHGEALDNPYSDRFDPL-FEELLSVQPREPRFEVSYDVLP 329
           + FE+ S  L  Y+ +A  T+ G  + +   D+F  +  + +LSV  +E R +V +D++ 
Sbjct: 170 IEFEKDSKLLNDYLFKAAKTSLGSKIVSKVHDKFAQMAVDSILSVMDKE-RKDVDFDLIK 228

Query: 330 L 330
           L
Sbjct: 229 L 229

>ADR051C [1792] [Homologous to ScYBR208C (DUR12) - SH]
            (796213..801672) [5460 bp, 1819 aa]
          Length = 1819

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 48   WK--FKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFL 103
            WK    VG+  + GD ++ +E  K ++ V A  DG++  I+  +G   VD G  V  L
Sbjct: 1760 WKQVVSVGDKVKEGDKLVIIEAMKTEMVVSATADGEVINILHANGDM-VDAGNLVVVL 1816

>Sklu_2172.1 YDR148C, Contig c2172 307-1605
          Length = 432

 Score = 29.3 bits (64), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 17/79 (21%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 7   YKQSARISFRRPFHGSMAPRAITPFHMPAMSPTMEKGGIVSWKFKVGEPFQAGDVILEVE 66
           +  S ++S RR           T   +P M+ ++ +G +  +  +VGE  +  +++  +E
Sbjct: 35  FVTSYKVSCRRIIAARYQS---TVVKVPPMAESLTEGSLKEFTKQVGEFIEQDELLATIE 91

Query: 67  TDKAQIDVEAQDDGKLAAI 85
           TDK  ++V +   G +  +
Sbjct: 92  TDKIDVEVNSPVSGTITKL 110

>Kwal_27.11951
          Length = 1869

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 48   WK--FKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFL 103
            WK    VG+  +AGD ++ VE  K ++ V A   GK+  +V  +G   V+ G+ V  +
Sbjct: 1812 WKPLVSVGDVVKAGDGLIVVEAMKTEMMVSAPKGGKVLKVVHKNGDM-VEAGDVVVVI 1868

>KLLA0E08107g 730334..735823 highly similar to sp|P32528 Saccharomyces
            cerevisiae YBR208c DUR1_2 urea amidolyase, start by
            similarity
          Length = 1829

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 48   WK--FKVGEPFQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKDVDVGETVAFL 103
            WK    VG+  +AGD ++ +E  K ++ V A   GK+  I+  +G   V+ G+ VA +
Sbjct: 1772 WKPVAAVGDHVEAGDGVIIIEAMKTEMVVGATKSGKVYKILHKNGDM-VEAGDLVAVI 1828

>Scas_657.14
          Length = 1018

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 284 IREATYTAHGEALDNPYSDRFDPLFEELLSVQPREPRFEVSYDVLPLTV 332
           I+ A +    E L+    +RF  +  EL SV P+EP     Y  L + +
Sbjct: 515 IQWAFFAKENEPLNELAKERFSSILAELTSVIPKEPHHSWQYYALDIIL 563

>KLLA0A09823g 858458..862417 similar to sp|P40340 Saccharomyces
           cerevisiae YGR270w YTA7 26S proteasome subunit, start by
           similarity
          Length = 1319

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 6/89 (6%)

Query: 35  AMSPTMEKGGIVSWKFKVGEP-FQAGDVILEVETDKAQIDVEAQDDGKLAAIVKGDGSKD 93
           A+ P + + G    +F    P  +A D IL + T K    +  Q   KLA++ KG G  D
Sbjct: 557 AVDPALRRPGRFDREFYFPLPDLKARDKILHIHTKKWNPPISDQFISKLASLTKGYGGAD 616

Query: 94  VDVGETVAFLAEVEDDLSALEIPKVVTSE 122
           +    T A L  ++      + P++  SE
Sbjct: 617 LRALCTEASLISIQR-----KFPQIYKSE 640

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,644,387
Number of extensions: 482315
Number of successful extensions: 1591
Number of sequences better than 10.0: 64
Number of HSP's gapped: 1548
Number of HSP's successfully gapped: 65
Length of query: 395
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 291
Effective length of database: 12,995,837
Effective search space: 3781788567
Effective search space used: 3781788567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 63 (28.9 bits)