Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR322W50049126010.0
CAGL0B03839g50749818330.0
Scas_647.251150217900.0
Kwal_33.1543450549617880.0
YJR010W (MET3)51150217760.0
Sklu_2014.150649717650.0
KLLA0E09812g50249517500.0
KLLA0D01573g607139840.038
CAGL0F08327g99249692.4
YEL013W (VAC8)57850657.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR322W
         (491 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH] complement(...  1006   0.0  
CAGL0B03839g 380291..381814 highly similar to sp|P08536 Saccharo...   710   0.0  
Scas_647.2                                                            694   0.0  
Kwal_33.15434                                                         693   0.0  
YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase (su...   688   0.0  
Sklu_2014.1 YJR010W, Contig c2014 195-1715                            684   0.0  
KLLA0E09812g complement(870664..872172) highly similar to sp|P08...   678   0.0  
KLLA0D01573g complement(139183..141006) similar to sp|Q03262 Sac...    37   0.038
CAGL0F08327g complement(829426..832404) similar to sp|P07276 Sac...    31   2.4  
YEL013W (VAC8) [1412] chr5 (128825..130561) Vacuolar protein req...    30   7.1  

>AGR322W [4633] [Homologous to ScYJR010W (MET3) - SH]
           complement(1332643..1334145) [1503 bp, 500 aa]
          Length = 500

 Score = 1006 bits (2601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/491 (100%), Positives = 491/491 (100%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQGLPQWNLTARQLCDIELILNGGFSPLTGFLGK 60
           MLSPHGGILQDLVARDAEKKDRLLHEAQGLPQWNLTARQLCDIELILNGGFSPLTGFLGK
Sbjct: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQGLPQWNLTARQLCDIELILNGGFSPLTGFLGK 60

Query: 61  EDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIYT 120
           EDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIYT
Sbjct: 61  EDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIYT 120

Query: 121 PDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRAD 180
           PDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRAD
Sbjct: 121 PDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRAD 180

Query: 181 FATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKVY 240
           FATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKVY
Sbjct: 181 FATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKVY 240

Query: 241 KEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKGD 300
           KEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKGD
Sbjct: 241 KEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKGD 300

Query: 301 DFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGSVKTLTISGTELRK 360
           DFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGSVKTLTISGTELRK
Sbjct: 301 DFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGSVKTLTISGTELRK 360

Query: 361 RLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHENPKRIANALLSTFLQVGGGR 420
           RLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHENPKRIANALLSTFLQVGGGR
Sbjct: 361 RLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHENPKRIANALLSTFLQVGGGR 420

Query: 421 QYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKVSATEP 480
           QYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKVSATEP
Sbjct: 421 QYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKVSATEP 480

Query: 481 VTEIVQKTVFF 491
           VTEIVQKTVFF
Sbjct: 481 VTEIVQKTVFF 491

>CAGL0B03839g 380291..381814 highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3, start by
           similarity
          Length = 507

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/498 (69%), Positives = 411/498 (82%), Gaps = 7/498 (1%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQGLPQWNLTARQLCDIELILNGGFSPLTGFLGK 60
           M +PHGG+LQDLVARDA K+D LL E+Q L QW LTARQ+CDIELILNGGFSPLTGFL +
Sbjct: 1   MPAPHGGVLQDLVARDASKRDSLLSESQQLSQWTLTARQICDIELILNGGFSPLTGFLAQ 60

Query: 61  EDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIYT 120
           EDY  VV NSRL+ G LWT+PITLDV E+FA SV   +RIALLQD  I VAI+TV DIY 
Sbjct: 61  EDYNGVVHNSRLSDGTLWTMPITLDVPEQFANSVKPNQRIALLQDGTIPVAILTVKDIYK 120

Query: 121 PDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRAD 180
           PDK VEA+KVFRGD EHPAI YL  TAGD Y+GG L+AIQLP HYDY  LRK+PA LR +
Sbjct: 121 PDKSVEAEKVFRGDPEHPAINYLFNTAGDYYIGGALDAIQLPQHYDYPGLRKTPAQLRLE 180

Query: 181 FATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKVY 240
           F ++QWDRVVAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++VY
Sbjct: 181 FQSRQWDRVVAFQTRNPMHRAHRELTVRAARETNAKVLIHPVVGLTKPGDIDHHTRVRVY 240

Query: 241 KEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKGD 300
           +EI+KRYP GIA L+LLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG+NSKG 
Sbjct: 241 QEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGSNSKGV 300

Query: 301 DFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTELR 359
           DFYGPYDAQ LVESYKNEL I+VVPF+++TYLPD+D Y P+DEID S  +TL ISGTELR
Sbjct: 301 DFYGPYDAQELVESYKNELDIDVVPFRMVTYLPDEDRYAPIDEIDTSKTRTLNISGTELR 360

Query: 360 KRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHE---NPKRIANALLSTFLQV 416
           KRLR+G +IP+WF+YPE+V+ILR+ NPPR +QGF +V N +   +  +++ ALLSTFLQ 
Sbjct: 361 KRLRDGGEIPEWFSYPEVVKILRESNPPRPKQGFALVFNDDIKVDRDQLSIALLSTFLQF 420

Query: 417 GGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSS--VDAHNIYELNTYPSAHIK 474
           GGGR YKI+DH  +P+ LELI DFV++G+GLI+ S   +S  V++ N+Y +     A IK
Sbjct: 421 GGGRHYKIYDHNDKPEFLELISDFVQAGSGLIIPSTWSASNKVNSANVYTIGHAKDADIK 480

Query: 475 VSAT-EPVTEIVQKTVFF 491
           +++T E +  IVQK V F
Sbjct: 481 LASTEETIFHIVQKVVLF 498

>Scas_647.2
          Length = 511

 Score =  694 bits (1790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/502 (68%), Positives = 406/502 (80%), Gaps = 11/502 (2%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58
           M +PHGGILQDLVARDA KK  L  EAQ   L QW LTARQ+CDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLVARDASKKAALSQEAQSGSLAQWTLTARQICDIELILNGGFSPLTGFL 60

Query: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118
            ++DY SVV+NSRL  G LWT+PITLDVDE FAKSV    RI LLQD +I +AI+TV+D+
Sbjct: 61  TEKDYLSVVKNSRLADGTLWTMPITLDVDETFAKSVAPNSRITLLQDGEIPIAILTVTDV 120

Query: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178
           Y PDK +EA +VFRGD EHPAI+YLN  AG+ Y+GG LEAIQLP HYDY  LRK+PA LR
Sbjct: 121 YRPDKALEAKEVFRGDPEHPAIRYLNNIAGEYYIGGSLEAIQLPQHYDYPGLRKAPAQLR 180

Query: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238
            +F ++QWDR+VAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++
Sbjct: 181 LEFQSRQWDRIVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298
           VY+EI+KRYP GIA L+LLPLAMRM GDREAVWHAIIRKNYGATHFIVGRDHAGPG+NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGSNSK 300

Query: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTE 357
           G DFYGPYDAQ LVESYKNEL I+VVPF+++TYLPD+D Y P+D+ID S  +TL ISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIQVVPFRMVTYLPDEDRYAPIDQIDTSKTRTLNISGTE 360

Query: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVN---HENPKRIANALLSTFL 414
           LRKRLR G +IP+WF+YPE+V+ILR+ NPPR +QGF IV+    +    ++A ALLSTFL
Sbjct: 361 LRKRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFAIVLEDSLNAPSGQLAIALLSTFL 420

Query: 415 QVGGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIV----TSPLPSSVDAHNIYELNTYPS 470
           Q GGGR YK+F+H+   +LLELIPDF+++G+GLIV    TS   S     N+Y L    +
Sbjct: 421 QFGGGRHYKVFEHENNDKLLELIPDFIQAGSGLIVPNQWTSKNVSFGADQNVYTLGASAN 480

Query: 471 AHIKV-SATEPVTEIVQKTVFF 491
           + IK+ S  E +  IVQK V F
Sbjct: 481 SDIKLDSVDETIFHIVQKVVLF 502

>Kwal_33.15434
          Length = 505

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/496 (66%), Positives = 406/496 (81%), Gaps = 5/496 (1%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEA-QGLPQWNLTARQLCDIELILNGGFSPLTGFLG 59
           M +PHGGILQDL+ARDA+ K++LL EA +    W+LTARQ+CD+ELI NGGFSPL+GFL 
Sbjct: 1   MPAPHGGILQDLIARDAQIKNQLLEEAAKAKITWDLTARQICDLELIQNGGFSPLSGFLN 60

Query: 60  KEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIY 119
           ++DYESVV NSRL++ L+WTIPITLDVD EFAK +    R+ LLQD++I VAI+TV+D+Y
Sbjct: 61  QKDYESVVHNSRLSNDLVWTIPITLDVDAEFAKQLKPETRVTLLQDNEIPVAILTVTDVY 120

Query: 120 TPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRA 179
            PDK VEA KVFRGD EHPA++YL ETAG+ Y+GGE++AIQ P HYDY  LRK+PA LR 
Sbjct: 121 KPDKDVEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAIQYPVHYDYPGLRKTPAQLRL 180

Query: 180 DFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKV 239
           +F ++QWDR+VAFQTRNPMHRAHRELT+RAA+EHNAKVL+HPVVGLTKPGDID+HTR++V
Sbjct: 181 EFESKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKVLIHPVVGLTKPGDIDHHTRVRV 240

Query: 240 YKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKG 299
           Y+EI+KRYP G+AQL+LLPLAMRM GDREAVWHAIIRKNYGATHFIVGRDHAGPG NS G
Sbjct: 241 YQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSAG 300

Query: 300 DDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEID-GSVKTLTISGTEL 358
            DFYG YDAQ LVE+YK+EL IEVVPF+++TYLPD+D Y P+D+ID  + KTL ISGTEL
Sbjct: 301 VDFYGAYDAQELVETYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDLSTTKTLNISGTEL 360

Query: 359 RKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNH--ENPKRIANALLSTFLQV 416
           R RLR G  IP+WF+YPE+V+ILR+ NPPR +QGF IV++    N K++A ALLSTFLQ 
Sbjct: 361 RNRLRSGGAIPEWFSYPEVVKILRESNPPRPQQGFAIVLSSALSNNKQLATALLSTFLQF 420

Query: 417 GGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKV- 475
           GGGR YK+ +H  +  +LEL+PDF++SG GLI+ S   ++    N Y++ T   A IK+ 
Sbjct: 421 GGGRHYKVLEHSDESSVLELVPDFIRSGAGLIIPSEYKNASATTNAYQVGTSDGADIKLE 480

Query: 476 SATEPVTEIVQKTVFF 491
           S  E V  +VQK V F
Sbjct: 481 SNDESVLHVVQKVVLF 496

>YJR010W (MET3) [2912] chr10 (456153..457688) ATP-sulfurylase
           (sulfate adenylyltransferase), catalyzes incorporation
           of inorganic sulfate into ATP to form adenosine
           5'-phosphosulfate (APS) [1536 bp, 511 aa]
          Length = 511

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/502 (67%), Positives = 406/502 (80%), Gaps = 11/502 (2%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58
           M +PHGGILQDL+ARDA KK+ LL EAQ   +  WNLT RQLCDIELILNGGFSPLTGFL
Sbjct: 1   MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL 60

Query: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118
            + DY SVV +SRL  G LWTIPITLDVDE FA  +    RIAL QDD+I +AI+TV D+
Sbjct: 61  NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV 120

Query: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178
           Y P+K +EA+KVFRGD EHPAI YL   AGD Y+GG LEAIQLP HYDY  LRK+PA LR
Sbjct: 121 YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR 180

Query: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238
            +F ++QWDRVVAFQTRNPMHRAHRELT+RAA+E NAKVL+HPVVGLTKPGDID+HTR++
Sbjct: 181 LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298
           VY+EI+KRYP GIA L+LLPLAMRM+GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEIDGS-VKTLTISGTE 357
           G DFYGPYDAQ LVESYK+EL IEVVPF+++TYLPD+D Y P+D+ID +  +TL ISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE 360

Query: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHE---NPKRIANALLSTFL 414
           LR+RLR G +IP+WF+YPE+V+ILR+ NPPR +QGF IV+ +    + ++++ ALLSTFL
Sbjct: 361 LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL 420

Query: 415 QVGGGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLP----SSVDAHNIYELNTYPS 470
           Q GGGR YKIF+H  + +LL LI DF+ SG+GLI+ +       S V   N+Y L+T  S
Sbjct: 421 QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS 480

Query: 471 AHIKV-SATEPVTEIVQKTVFF 491
           A I++ SA EP++ IVQK V F
Sbjct: 481 ADIQLESADEPISHIVQKVVLF 502

>Sklu_2014.1 YJR010W, Contig c2014 195-1715
          Length = 506

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/497 (65%), Positives = 403/497 (81%), Gaps = 6/497 (1%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQGLP-QWNLTARQLCDIELILNGGFSPLTGFLG 59
           M +PHGG+LQDL+ARDA  K +LL EA      W+LT RQ+CD+ELILNGGFSPLTGFL 
Sbjct: 1   MPAPHGGVLQDLIARDASIKPQLLQEASDSKLTWSLTGRQICDLELILNGGFSPLTGFLN 60

Query: 60  KEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDIY 119
           ++DY SVV +SRL++GL+WT+PITLDVD EFA  + + +RI LLQ+++I +A +TV+D+Y
Sbjct: 61  EKDYTSVVNDSRLSNGLVWTMPITLDVDSEFASKLQIDDRILLLQENEIPLAFLTVTDVY 120

Query: 120 TPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALRA 179
            PDK VEA KVFRGD EHPAI YLN  AG+ Y+GGEL+AIQLP HYDY  LR++PA LR 
Sbjct: 121 KPDKSVEAKKVFRGDPEHPAISYLNNIAGEYYVGGELQAIQLPQHYDYPGLRRTPAQLRL 180

Query: 180 DFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIKV 239
           +F ++QWDR+VAFQTRNPMHRAHRELT+RAA+E NAK+L+HPVVGLTKPGDID+HTR++V
Sbjct: 181 EFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREQNAKILIHPVVGLTKPGDIDHHTRVRV 240

Query: 240 YKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSKG 299
           Y+EI+KRYP G+A L+LLPLAMRM GDREAVWHAIIRKNYGATHFIVGRDHAGPG NSKG
Sbjct: 241 YQEIIKRYPNGMAHLSLLPLAMRMGGDREAVWHAIIRKNYGATHFIVGRDHAGPGKNSKG 300

Query: 300 DDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEID-GSVKTLTISGTEL 358
            DFYG YDAQ LVESYKNEL IEVVPF+++TYLPD+D Y P+D+ID  + KTL ISGTEL
Sbjct: 301 VDFYGAYDAQELVESYKNELEIEVVPFRMVTYLPDEDRYAPIDQIDLATTKTLNISGTEL 360

Query: 359 RKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNH--ENPKRIANALLSTFLQV 416
           R RLR+G +IP WF+YPE+V+ILR+ +PPR  QGF +V++   +N K+++ ALLSTFLQ 
Sbjct: 361 RNRLRDGGEIPAWFSYPEVVKILRESSPPRPNQGFAVVLDDSLKNNKQLSIALLSTFLQF 420

Query: 417 GGGRQYKIFDH-QGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKV 475
           GGGR YKIF+H     +L+ELIPDF++SG GLIV      S DA N++ +     A IK+
Sbjct: 421 GGGRHYKIFNHSNNNEELVELIPDFIRSGAGLIVPGQFNGSSDATNVFTVGVADDAEIKL 480

Query: 476 -SATEPVTEIVQKTVFF 491
            S  EP+  +VQK V F
Sbjct: 481 ESEDEPILHVVQKVVLF 497

>KLLA0E09812g complement(870664..872172) highly similar to sp|P08536
           Saccharomyces cerevisiae YJR010w MET3 sulfate
           adenylyltransferase singleton, start by similarity
          Length = 502

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/495 (65%), Positives = 399/495 (80%), Gaps = 6/495 (1%)

Query: 1   MLSPHGGILQDLVARDAEKKDRLLHEAQG--LPQWNLTARQLCDIELILNGGFSPLTGFL 58
           M SPHGG+LQDLVARDA KK  LL  AQ   L  W+LTARQ+CD+ELILNGGFSPL GFL
Sbjct: 1   MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL 60

Query: 59  GKEDYESVVQNSRLTSGLLWTIPITLDVDEEFAKSVNLGERIALLQDDDIFVAIITVSDI 118
            ++DY+SVV+ SRL +GL+WTIPITLDVD EFA  ++  +RI LLQD++  +AI+TVSD+
Sbjct: 61  NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV 120

Query: 119 YTPDKKVEADKVFRGDEEHPAIQYLNETAGDIYLGGELEAIQLPAHYDYLNLRKSPAALR 178
           Y PDK VEA KVFRGD EHPA++YL E AG+ Y+GG LEAIQLP HYDY   RK+PA LR
Sbjct: 121 YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR 180

Query: 179 ADFATQQWDRVVAFQTRNPMHRAHRELTIRAAKEHNAKVLLHPVVGLTKPGDIDYHTRIK 238
            +F ++QWDRVVAFQTRNPMHRAHRELT+RAA+ +N+K+L+HPVVGLTKPGDID+HTR++
Sbjct: 181 LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR 240

Query: 239 VYKEIVKRYPEGIAQLALLPLAMRMAGDREAVWHAIIRKNYGATHFIVGRDHAGPGTNSK 298
           VY+EI+KRYP G+AQL+LLPLAMRM GDREAVWHAIIRKNYGA+HFIVGRDHAGPG NSK
Sbjct: 241 VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK 300

Query: 299 GDDFYGPYDAQVLVESYKNELGIEVVPFKLITYLPDKDIYLPVDEID-GSVKTLTISGTE 357
           G DFYGPYDAQ LVESYKNEL IEVVPF+++TYLPD+D Y P+DEID    +TL ISGTE
Sbjct: 301 GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE 360

Query: 358 LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNHENPKRIANALLSTFLQVG 417
           LR RLR+G +IP WF+YPE+V+ILR+ NP R +QGF +V++   P ++  ALLSTFLQ G
Sbjct: 361 LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG 420

Query: 418 GGRQYKIFDHQGQPQLLELIPDFVKSGTGLIVTSPLPSSVDAHNIYELNTYPSAHIKVSA 477
           GGR YK+ +H    ++L L+PDFV+SGTGLI+ +   SS+   N++++     + I +  
Sbjct: 421 GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQN--ASSLKGTNVFKIGEESGSDIPLET 478

Query: 478 TEP-VTEIVQKTVFF 491
            +  +  IVQ+ V F
Sbjct: 479 EDKNILHIVQRVVLF 493

>KLLA0D01573g complement(139183..141006) similar to sp|Q03262
           Saccharomyces cerevisiae YMR278w singleton, start by
           similarity
          Length = 607

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 64/139 (46%), Gaps = 18/139 (12%)

Query: 341 VDEIDGSVKTLTISGTE-LRKRLREGTDIPDWFTYPEIVEILRQYNPPRYRQGFVIVVNH 399
           + E+   + T+   GT  LR R+  G +  +  T  +  + L +Y   ++ +   +VV H
Sbjct: 43  ITELHKRLDTMIAFGTAGLRGRMEAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGH 102

Query: 400 E---NPKRIANALLSTFLQVGGGRQYKIF--DHQGQPQLLE--LIPDFVKSGTG-----L 447
           +   N +      + TFLQ+G    +K+F  +H+ +  L+   L+P F  + TG     +
Sbjct: 103 DHRHNSRLFGKVTVDTFLQLG----FKVFHLNHENEKSLVHTPLVP-FTVNATGASVGIM 157

Query: 448 IVTSPLPSSVDAHNIYELN 466
           I  S  P   + + +Y  N
Sbjct: 158 ITASHNPKMDNGYKVYYTN 176

>CAGL0F08327g complement(829426..832404) similar to sp|P07276
           Saccharomyces cerevisiae YGR258c RAD2 structure-specific
           nuclease of the nucleotide excision repairosome, start
           by similarity
          Length = 992

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 341 VDEIDGSVKTLTISGTELRKRLREGTDIPDWFTYPEIVEILRQYNPPRY 389
           +D+IDG  K L     E  KR RE  +IP WFT    +E    Y   ++
Sbjct: 536 IDDIDGVQKVL--PAEEGEKRDREVPEIPSWFTNDSFIEKSNPYTANQF 582

>YEL013W (VAC8) [1412] chr5 (128825..130561) Vacuolar protein
           required for vacuole fusion and involved in vacuolar
           inheritance and protein targeting from the cytoplasm to
           vacuole [1737 bp, 578 aa]
          Length = 578

 Score = 29.6 bits (65), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 149 DIYLGGELEAIQLPAHYDYLNLRKSPAALRADFATQQWDRVVAFQTRNPM 198
           D Y GG L+A+    + D LNL++S A   A+  T+++ R V+ +   P+
Sbjct: 42  DFYSGGPLKALTTLVYSDNLNLQRSAALAFAEI-TEKYVRQVSREVLEPI 90

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,730,727
Number of extensions: 762833
Number of successful extensions: 1778
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1809
Number of HSP's successfully gapped: 14
Length of query: 491
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 385
Effective length of database: 12,926,601
Effective search space: 4976741385
Effective search space used: 4976741385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)