Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR167W51250227050.0
Kwal_47.1746249248914440.0
KLLA0A04906g48048612611e-171
Sklu_2253.249850511671e-156
CAGL0G01254g50450311661e-156
YGL202W (ARO8)50050911601e-155
KLLA0F10021g49750211571e-154
AFR548C49749211541e-154
Scas_712.4849750011381e-152
Kwal_47.1898249650111271e-150
KLLA0D11110g5304645377e-62
Sklu_2392.15304955263e-60
Scas_697.115104475235e-60
Kwal_33.145825254855043e-57
YHR137W (ARO9)5135065019e-57
CAGL0G06028g5374644941e-55
AGR141C4383031557e-11
Kwal_8.5854462411531e-10
CAGL0I06578g4362401522e-10
YER152C4432401362e-08
Scas_555.74462751228e-07
Sklu_2389.74473171228e-07
KLLA0E00935g4452981112e-05
Scas_711.524452511112e-05
CAGL0J05126g4472491059e-05
CAGL0L12254g5741251041e-04
YLR089C5921581014e-04
KLLA0F01617g4442631004e-04
Kwal_56.23791518159950.002
YJL060W (BNA3)444252890.008
Kwal_14.2574443235830.041
Sklu_2264.5383242750.40
Kwal_26.845821956672.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR167W
         (502 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH] complement...  1046   0.0  
Kwal_47.17462                                                         560   0.0  
KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces c...   490   e-171
Sklu_2253.2 YGL202W, Contig c2253 1349-2845                           454   e-156
CAGL0G01254g 119281..120795 highly similar to sp|P53090 Saccharo...   453   e-156
YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid ...   451   e-155
KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces c...   450   e-154
AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH] (1421841..1...   449   e-154
Scas_712.48                                                           442   e-152
Kwal_47.18982                                                         438   e-150
KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces c...   211   7e-62
Sklu_2392.1 YHR137W, Contig c2392 2001-3593                           207   3e-60
Scas_697.11                                                           206   5e-60
Kwal_33.14582                                                         198   3e-57
YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid ...   197   9e-57
CAGL0G06028g complement(579261..580874) similar to sp|P38840 Sac...   194   1e-55
AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)...    64   7e-11
Kwal_8.585                                                             64   1e-10
CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces c...    63   2e-10
YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein...    57   2e-08
Scas_555.7                                                             52   8e-07
Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement       52   8e-07
KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces c...    47   2e-05
Scas_711.52                                                            47   2e-05
CAGL0J05126g complement(484849..486150) highly similar to sp|P47...    45   9e-05
CAGL0L12254g complement(1324815..1326539) similar to sp|P52893 S...    45   1e-04
YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putati...    44   4e-04
KLLA0F01617g complement(154025..155359) highly similar to sp|P47...    43   4e-04
Kwal_56.23791                                                          41   0.002
YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted t...    39   0.008
Kwal_14.2574                                                           37   0.041
Sklu_2264.5 , Contig c2264 7329-8480                                   33   0.40 
Kwal_26.8458                                                           30   2.5  

>AGR167W [4478] [Homologous to ScYGL202W (ARO8) - NSH]
           complement(1059796..1061334) [1539 bp, 512 aa]
          Length = 512

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/502 (100%), Positives = 502/502 (100%)

Query: 1   MTQEDQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVS 60
           MTQEDQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVS
Sbjct: 1   MTQEDQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVS 60

Query: 61  VEVPVPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHK 120
           VEVPVPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHK
Sbjct: 61  VEVPVPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHK 120

Query: 121 LRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDS 180
           LRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDS
Sbjct: 121 LRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDS 180

Query: 181 EGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDML 240
           EGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDML
Sbjct: 181 EGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDML 240

Query: 241 IVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRL 300
           IVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRL
Sbjct: 241 IVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRL 300

Query: 301 ESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNW 360
           ESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNW
Sbjct: 301 ESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNW 360

Query: 361 LIDLRLEYTARRDHCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQR 420
           LIDLRLEYTARRDHCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQR
Sbjct: 361 LIDLRLEYTARRDHCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQR 420

Query: 421 LETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGIKCIAQTLL 480
           LETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGIKCIAQTLL
Sbjct: 421 LETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGIKCIAQTLL 480

Query: 481 KEFGHCATSCSYYTYEQRIPAR 502
           KEFGHCATSCSYYTYEQRIPAR
Sbjct: 481 KEFGHCATSCSYYTYEQRIPAR 502

>Kwal_47.17462
          Length = 492

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/489 (55%), Positives = 344/489 (70%), Gaps = 19/489 (3%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP-- 66
           KA+D  HL S EALRR+PSPIKTTMAYF +  +VFLGAGMPP+ELFPI ++S+E+P P  
Sbjct: 8   KARDFSHLFSEEALRRKPSPIKTTMAYFQDPNIVFLGAGMPPSELFPIKSLSLELPKPPF 67

Query: 67  ----GEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLR 122
               GE  QTL   I K   +  F  DVPL+RALQYGNSRGQ ELV +L++HT  FH++ 
Sbjct: 68  VDGIGECKQTLQATIMKEQQDLLFEHDVPLARALQYGNSRGQKELVAYLKEHTSLFHRIP 127

Query: 123 YADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEG 182
           Y DWD++ T GSTQ WDA++R+FCN+GD+V++E +TYSSSVEAA+AQGL C+ M +D EG
Sbjct: 128 YQDWDIITTTGSTQGWDASLRIFCNKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242
           I+PE+L E+L  W   +     P++LYTIPTGQNP G TL D+RK  IY LAQ+YDM+I+
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 243 EDDPYYFLQMDAYDAAGPRGIEAYEGARAALRA-DHARFASSLSRSFLDWDTDGRVVRLE 301
           ED+PYYFLQMD Y+       E     + A RA  HA F  SL +SFL+ D +GRVVRL+
Sbjct: 248 EDEPYYFLQMDQYEP------EERRLEQPASRAMTHAEFIGSLGKSFLELDVEGRVVRLD 301

Query: 302 STSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWL 361
           S SK FAPGCR GW+VG++ LLD YW L EVS+QSTCGFAQ+IL G+LNRWGQ  Y +WL
Sbjct: 302 SVSKTFAPGCRMGWLVGSKHLLDNYWNLHEVSIQSTCGFAQSILGGILNRWGQGGYIDWL 361

Query: 362 IDLRLEYTARRDHCLDCCHKYLP-DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQR 420
           I +R EYT +R+ CLD C KYLP   V+V    AGMFFM+ +DA  HPGF + F+     
Sbjct: 362 IGIRQEYTVKRNTCLDLCRKYLPAQVVNVPAVTAGMFFMIYIDAKKHPGFLTTFNGDYLL 421

Query: 421 LETHLYDTFIKNGVLLACGSWFAVNR-SP----SKGTSIYFRGTYAAVDPASMEAGIKCI 475
           +E H+Y   +  GVL+ C SWF VN  SP    S    + FRGTYA+V P +M  G++ +
Sbjct: 422 MEQHIYRKCVSAGVLVTCSSWFKVNDPSPHAHKSGTKQLAFRGTYASVQPEAMANGLEIL 481

Query: 476 AQTLLKEFG 484
              L +EFG
Sbjct: 482 GNVLRQEFG 490

>KLLA0A04906g 437523..438965 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 480

 Score =  490 bits (1261), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 242/486 (49%), Positives = 318/486 (65%), Gaps = 11/486 (2%)

Query: 1   MTQEDQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVS 60
           MT +D   +   L HLLS EA  R+ SPIKTTM YF +  +VFLGAGMP   +FP  ++S
Sbjct: 1   MTVKDMGCRTNVL-HLLSDEAKIRKASPIKTTMKYFSDPNIVFLGAGMPSGNMFPFESIS 59

Query: 61  VE-VPVPGEDGQTLV-GRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKF 118
            + V +   +G   V G I +   + E  +DVPL  ALQYGNSRGQ EL+ FL++HT  F
Sbjct: 60  FKSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNSRGQPELISFLKEHTSIF 119

Query: 119 HKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEV 178
           H +   DWD++ TAGSTQAWDA +RLFCN G++V+ME +TYSSS+EAA AQGL CV M++
Sbjct: 120 HNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMKM 179

Query: 179 DSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYD 238
           D +GI  ++L+E+L +WD    G   P++LYTIP G NP G TL + RK ++ RLA QYD
Sbjct: 180 DKDGIKVDKLSEMLRDWDVAVQG-PFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYD 238

Query: 239 MLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVV 298
            +I+EDDPYYFLQM+ + A          G    ++     F + L RS L+WD  GR++
Sbjct: 239 FIIIEDDPYYFLQMNEFGAPELN----VPGDVNEMQWFKENFVNKLGRSLLEWDDVGRII 294

Query: 299 RLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYT 358
           RLES SK FAPGCR GW +G R LLD  W   EVS+QSTCGFAQ +++GM  RWGQ  Y 
Sbjct: 295 RLESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTCGFAQTLINGMFQRWGQIGYM 354

Query: 359 NWLIDLRLEYTARRDHCLDCCHKYLPDFV-HVEPPQAGMFFMLVLDAALHPGFASDFSSS 417
            WL+ LR  Y+ +RDHCL  C KYLP+ V  +  P +GMFFM+ +D   HP F  +F S 
Sbjct: 355 KWLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISGMFFMVYIDPHKHPKFEREFKSK 414

Query: 418 PQRLETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGIKCIAQ 477
              LE HLY++F++NG+LLAC SWF V+  P+    + FRG+YA+VD   M+ GI  +  
Sbjct: 415 VDLLEEHLYNSFVQNGMLLACSSWFRVD--PNHNKILAFRGSYASVDAEKMQNGIIMLGN 472

Query: 478 TLLKEF 483
            +  EF
Sbjct: 473 VIKAEF 478

>Sklu_2253.2 YGL202W, Contig c2253 1349-2845
          Length = 498

 Score =  454 bits (1167), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/505 (43%), Positives = 327/505 (64%), Gaps = 43/505 (8%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVPG- 67
           ++KD  HL S E   R+PSP+KT +  F +  ++FLG G+P ++ FP   V+ E P+P  
Sbjct: 5   ESKDFSHLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPMSDYFPWDKVTAESPLPPF 64

Query: 68  EDGQTLVGRIPKGAGEREF--------------ARDVPLSRALQYGNSRGQSELVEFLRQ 113
            +G   +G +P G  E                 ++D+ L+RALQYG S+GQ EL+EF+R+
Sbjct: 65  ANG---IGAVPSGGDEDTCHLTIRKNEITKAGDSKDIHLARALQYGFSQGQPELMEFVRK 121

Query: 114 HTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYC 173
           HT   H ++YADWDVL TAG+T AW++T+R+FCN GD+++ EA+++SSS+ AAEAQG+  
Sbjct: 122 HTSLVHDIKYADWDVLATAGNTNAWESTLRVFCNRGDTILAEAYSFSSSLYAAEAQGVNV 181

Query: 174 VGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRL 233
             + +D  GI+PE+L  ++  W+ +     +P++LYTIPTGQNP GS+L D RKA+IYR+
Sbjct: 182 FPVPLDEFGIIPEKLESIMDNWNPE---TPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRI 238

Query: 234 AQQYDMLIVEDDPYYFLQMDAY-DAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWD 292
           AQ+++ +I+ED+PYYFLQM+ Y   A  R  + Y        + H  F  SL++SF+  D
Sbjct: 239 AQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTY--------SSHDEFIQSLAKSFISLD 290

Query: 293 TDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRW 352
           TDGRVVRL+S SKV APG R GWIVG++ +L+ Y  L E+++Q+  GF Q++++G LNRW
Sbjct: 291 TDGRVVRLDSFSKVLAPGTRLGWIVGSKKILEPYLRLHEMTIQAPSGFTQSLVAGTLNRW 350

Query: 353 GQDRYTNWLIDLRLEYTARRDHCLDCCHKYLP--DFVHVEPPQAGMFFMLVLDAALHPGF 410
           GQD Y +WLI LR EYT +RD  +D  +KYLP   F+ + PP AGMFF + +D++ HP F
Sbjct: 351 GQDGYVDWLIGLRHEYTHKRDVAIDALYKYLPKGSFIKINPPIAGMFFTINIDSSAHPEF 410

Query: 411 ASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAVN---RSPS--------KGTSIYFRGT 459
           ++ + S+P+ +E  +Y+  +  GVL+  G WF  +   + P         K   I+FRGT
Sbjct: 411 STTYQSNPELVEKAIYEKVVSQGVLVVPGIWFKTDGETQPPQPKESKVVLKPNEIFFRGT 470

Query: 460 YAAVDPASMEAGIKCIAQTLLKEFG 484
           YAAV    +  G+K +   L +EFG
Sbjct: 471 YAAVPLEKLVQGVKRLGDALYEEFG 495

>CAGL0G01254g 119281..120795 highly similar to sp|P53090
           Saccharomyces cerevisiae YGL202w ARO8, start by
           similarity
          Length = 504

 Score =  453 bits (1166), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 221/503 (43%), Positives = 322/503 (64%), Gaps = 34/503 (6%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP-- 66
           ++KD  +  S E   R+PSP+KT + YF +  M+FLG G+P +  FP   ++ + P+P  
Sbjct: 5   ESKDFTYFFSEETKARKPSPLKTCIQYFSDPNMIFLGGGLPMSAYFPWDNLAADTPLPPF 64

Query: 67  -GEDGQTLVGR---IPKGAGERE---FARDVPLSRALQYGNSRGQSELVEFLRQHTEKFH 119
               G T+ G      K + ++E      D+PL+R+LQYG S GQ EL +FL++HT+  H
Sbjct: 65  TNGIGATITGSQEDTSKFSVKKESKVHEGDIPLARSLQYGKSMGQPELTDFLKEHTKMIH 124

Query: 120 KLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVD 179
            ++Y+DWDV+ T G+T AW++T+R+FCN GD ++ EA ++SSS+ +AEAQG+    + +D
Sbjct: 125 DMKYSDWDVVATTGNTNAWESTLRVFCNRGDVILAEAHSFSSSLASAEAQGIITFPVPID 184

Query: 180 SEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDM 239
           + GI+PE+L  LL  W     G  +P++LYTIPTGQNP GS+L   RK +IYR+AQ++D 
Sbjct: 185 AHGIIPEKLEALLDNWT---EGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDF 241

Query: 240 LIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVR 299
           LI+ED+PYYFLQ+  Y +   +  E    A+      H  F  SL+ +FL  DTDGRV+R
Sbjct: 242 LIIEDEPYYFLQVGEYISDLSKRAEV---AQKNANISHEDFLKSLALTFLSVDTDGRVIR 298

Query: 300 LESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTN 359
           ++S SKV APG R GWI G+  LL  Y  L E+++QS  GF+Q+++SG LNRWGQ  Y +
Sbjct: 299 MDSFSKVLAPGTRLGWITGSSKLLQAYLSLHEMTIQSPSGFSQSLVSGTLNRWGQKGYID 358

Query: 360 WLIDLRLEYTARRDHCLDCCHKYLPD--------FVHVEPPQAGMFFMLVLDAALHPGFA 411
           WLI LR EYTA+RDHC+D  +K++P            + PP AGMFF + +DA+ HP FA
Sbjct: 359 WLIGLRHEYTAKRDHCIDSLYKFIPKDNNKEGKPIFTINPPIAGMFFTVDMDASAHPEFA 418

Query: 412 SDFSSSPQRLETHLYDTFIKNGVLLACGSWFAVN--RSPSKGTS---------IYFRGTY 460
           + + S P ++E  LY   IK+GVL+  G WF  +   +P++  S         I+FRGTY
Sbjct: 419 TTYESDPTKVEEALYQKVIKSGVLVVPGIWFKADGETTPAQPASSKENPNPNQIFFRGTY 478

Query: 461 AAVDPASMEAGIKCIAQTLLKEF 483
           AAV+P+ ++ G+K + Q L +EF
Sbjct: 479 AAVEPSKLDEGLKRLGQCLREEF 501

>YGL202W (ARO8) [1793] chr7 (116061..117563) Aromatic amino acid
           aminotransferase I [1503 bp, 500 aa]
          Length = 500

 Score =  451 bits (1160), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/509 (43%), Positives = 322/509 (63%), Gaps = 49/509 (9%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVPGE 68
           ++KD  +L S E   R+PSP+KT +  F +  ++FLG G+P  + FP   +SV+ P P  
Sbjct: 5   ESKDFSYLFSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLKDYFPWDNLSVDSPKPP- 63

Query: 69  DGQTLVGRIPKGAG-------------EREFA-------RDVPLSRALQYGNSRGQSELV 108
                    P+G G              +++A        D+PLSRALQYG S GQ EL+
Sbjct: 64  --------FPQGIGAPIDEQNCIKYTVNKDYADKSANPSNDIPLSRALQYGFSAGQPELL 115

Query: 109 EFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEA 168
            F+R HT+  H L+Y DWDVL TAG+T AW++T+R+FCN GD +++EA ++SSS+ +AEA
Sbjct: 116 NFIRDHTKIIHDLKYKDWDVLATAGNTNAWESTLRVFCNRGDVILVEAHSFSSSLASAEA 175

Query: 169 QGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKA 228
           QG+    + +D++GI+PE+LA+++  W     G  +P++LYTIPTGQNP G+++ D RK 
Sbjct: 176 QGVITFPVPIDADGIIPEKLAKVMENWT---PGAPKPKLLYTIPTGQNPTGTSIADHRKE 232

Query: 229 QIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSF 288
            IY++AQ+YD LIVED+PYYFLQM+ Y     + ++  E A+++ + DH  F  SL+ +F
Sbjct: 233 AIYKIAQKYDFLIVEDEPYYFLQMNPYI----KDLKEREKAQSSPKQDHDEFLKSLANTF 288

Query: 289 LDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGM 348
           L  DT+GRV+R++S SKV APG R GWI G+  +L  Y  L E+++Q+  GF Q +++  
Sbjct: 289 LSLDTEGRVIRMDSFSKVLAPGTRLGWITGSSKILKPYLSLHEMTIQAPAGFTQVLVNAT 348

Query: 349 LNRWGQDRYTNWLIDLRLEYTARRDHCLDCCHKYLP--DFVHVEPPQAGMFFMLVLDAAL 406
           L+RWGQ  Y +WL+ LR EYT +RD  +D  +KYLP  D   + PP AGMFF + +DA++
Sbjct: 349 LSRWGQKGYLDWLLGLRHEYTLKRDCAIDALYKYLPQSDAFVINPPIAGMFFTVNIDASV 408

Query: 407 HPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWF-----------AVNRSPSKGTSIY 455
           HP F + ++S P +LE  LY   ++ GVL+  GSWF           A ++  S    I+
Sbjct: 409 HPEFKTKYNSDPYQLEQSLYHKVVERGVLVVPGSWFKSEGETEPPQPAESKEVSNPNIIF 468

Query: 456 FRGTYAAVDPASMEAGIKCIAQTLLKEFG 484
           FRGTYAAV P  +  G+K +  TL +EFG
Sbjct: 469 FRGTYAAVSPEKLTEGLKRLGDTLYEEFG 497

>KLLA0F10021g 926569..928062 similar to sp|P53090 Saccharomyces
           cerevisiae YGL202w ARO8 aromatic amino acid
           aminotransferase I, start by similarity
          Length = 497

 Score =  450 bits (1157), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 217/502 (43%), Positives = 316/502 (62%), Gaps = 36/502 (7%)

Query: 7   QNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP 66
           Q  AKD  HL S E   R PS +K+ + YF +  ++FLG G+P ++ FP   ++VE P+P
Sbjct: 3   QGVAKDFSHLYSDETKSRMPSQLKSIIHYFNDPNLIFLGGGLPMSDYFPWDNLTVESPLP 62

Query: 67  -----------GEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHT 115
                      G+D  T    I K   E +   D+PLSR+LQYG S+GQ E+ +F ++H 
Sbjct: 63  PFSNGIGAKPSGDDADTCQIHITKNLEESQKGVDIPLSRSLQYGYSQGQPEITKFFKEHH 122

Query: 116 EKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVG 175
              H ++Y +WDVL T G+T AW++ +R+FCN GD+++ E F +SSS+ AAEAQG+    
Sbjct: 123 SLIHDMKYENWDVLATIGNTGAWESVLRIFCNRGDTILAEQFAFSSSISAAEAQGVNVFP 182

Query: 176 MEVDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQ 235
           + +D  GI+P +L  +L  W     G A+P++LYT+PTGQNP GS+L   RK +IYR+AQ
Sbjct: 183 IPLDEHGIIPSKLETILDNWT---EGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQ 239

Query: 236 QYDMLIVEDDPYYFLQMDAYDA-AGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTD 294
           ++D +I+ED+PYYFLQM+ Y+     R +++Y        ADH  F  +L +SF+  DT+
Sbjct: 240 KHDFIIIEDEPYYFLQMEKYEKDPANRVVKSY--------ADHKEFIQNLEKSFVSIDTE 291

Query: 295 GRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQ 354
           GRV+RL+S SKV APG R GWIVGA+ +L +   LQE+++Q+  GF Q+I++G +NRWGQ
Sbjct: 292 GRVLRLDSLSKVLAPGTRFGWIVGAKDILARILSLQEMTIQAPAGFTQSIIAGTMNRWGQ 351

Query: 355 DRYTNWLIDLRLEYTARRDHCLDCCHKYLP--DFVHVEPPQAGMFFMLVLDAALHPGFAS 412
           + Y +WLI LR EYT +RD C+D  +KYLP  D++ + PP AGMFF + +DA+ HP FA+
Sbjct: 352 EGYLDWLIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHPEFAT 411

Query: 413 DFSSSPQRLETHLYDTFIKNGVLLACGSWFA-----------VNRSPSKGTSIYFRGTYA 461
            + S P+++E  ++D  I +GVL+  G+WF             +    K   I+FRGTYA
Sbjct: 412 KYGSDPEKVEKAIFDRSIASGVLVVPGNWFKSQGQTTPPQPEASFKSEKPNEIFFRGTYA 471

Query: 462 AVDPASMEAGIKCIAQTLLKEF 483
           AV    M  G+      L +EF
Sbjct: 472 AVPLDKMTVGLHRFGDGLYEEF 493

>AFR548C [3740] [Homologous to ScYGL202W (ARO8) - SH]
           (1421841..1423334) [1494 bp, 497 aa]
          Length = 497

 Score =  449 bits (1154), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 233/492 (47%), Positives = 319/492 (64%), Gaps = 25/492 (5%)

Query: 10  AKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP--- 66
           A+D  +  S E   R PSP+KT + Y+ +  ++FLG G+P +ELFP  +VS     P   
Sbjct: 8   AQDFSYKFSEETKARIPSPLKTCLRYYNDPDIIFLGGGLPRSELFPWDSVSASCAAPPFK 67

Query: 67  -GEDGQTLVGRIPKGAGEREF---ARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLR 122
            G  G   +     G         ARDVPL RALQYG S+GQ EL++F+R+HT + H+++
Sbjct: 68  TGTAGGMQLHVAKSGQSANAVVSGARDVPLERALQYGFSQGQPELMDFVREHTRRLHRMQ 127

Query: 123 YADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEG 182
           YADWDVL T G+T AW++T+R+FCN GD+++ E +T+SSS+ AAEAQG+    + +D  G
Sbjct: 128 YADWDVLATVGNTSAWESTLRVFCNRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDENG 187

Query: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242
           +VPERL ELL  W+  H G  RP++LYT+PTGQNP G+ L + R+  +YRLAQQ+D+LIV
Sbjct: 188 MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIV 247

Query: 243 EDDPYYFLQMDAYDA-AGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRLE 301
           ED+PYYFLQ+D Y+A AG R    +        A H  F  SL RSFL  DTDGRV+RL+
Sbjct: 248 EDEPYYFLQLDPYEADAGRRAPRVF--------ASHEEFVGSLVRSFLSLDTDGRVLRLD 299

Query: 302 STSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWL 361
           S SKV APG R GWI GA+ LL  Y  L E++VQ+  GF  ++++G L RWGQ+ Y +WL
Sbjct: 300 SFSKVLAPGTRLGWIAGAKQLLQAYLALLELTVQAPSGFTSSLIAGTLTRWGQEHYIDWL 359

Query: 362 IDLRLEYTARRDHCLDCCHKYLP--DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQ 419
           I+LR EYT  RD  +D  H+Y+P   +V V P +AGMFF + L+AA HP F S++ S P+
Sbjct: 360 IELRREYTHLRDVVMDALHRYIPAKPWVRVNPTEAGMFFTVHLNAAAHPRFVSEYESQPE 419

Query: 420 RLETHLYDTFIKNGVLLACGSWFAV-NRSPSKG------TSIYFRGTYAAVDPASMEAGI 472
           R+E  LY+  I +GVL   G WF    + PS+        +I+FRGT+AAV+   +  GI
Sbjct: 420 RVEWALYEKMIAHGVLAVPGMWFRTGGKDPSRSRQAGDTNNIFFRGTFAAVEEDKLVVGI 479

Query: 473 KCIAQTLLKEFG 484
           + +   L +EFG
Sbjct: 480 QRLGSMLAEEFG 491

>Scas_712.48
          Length = 497

 Score =  442 bits (1138), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 214/500 (42%), Positives = 314/500 (62%), Gaps = 32/500 (6%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP-- 66
           ++KD  HL S E   R+PSP+KT +  F +  ++FLG G+P ++ FP   VS++ P P  
Sbjct: 5   ESKDFSHLYSDETNARKPSPLKTCIHLFQDPNIIFLGGGLPLSDYFPWDNVSIDSPAPPF 64

Query: 67  --------GEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKF 118
                    E     V ++      +    D+PL+R+LQYG S+GQ EL+EF+R+H +  
Sbjct: 65  TKGIGHPISELSNDEVCKVDLKKDVKVHEGDIPLARSLQYGFSQGQPELLEFIREHNKLI 124

Query: 119 HKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEV 178
           H ++Y DWDV+ TAG+T AW++T+R+FCN GD ++ EA ++SS + AA+AQG+    + +
Sbjct: 125 HDMQYEDWDVVATAGNTNAWESTLRVFCNRGDVILAEAHSFSSCLAAAQAQGITTFPVPI 184

Query: 179 DSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYD 238
           D +GI+P +L  +L  W     G  +P++LYTIPTGQNP G++L D RK +I+R+AQ++D
Sbjct: 185 DDKGIIPAKLEAILDNWT---PGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHD 241

Query: 239 MLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVV 298
            LI+ED PYYFLQMD Y+    R ++     RA  R  H  F +SL ++FL  DTDGRV+
Sbjct: 242 FLIIEDAPYYFLQMDKYE----RDLQKRAVTRAQPRESHKDFLASLDKTFLSVDTDGRVI 297

Query: 299 RLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYT 358
           RL+S SKV APG R GWI G++ +L  +  L E+++Q+  GF Q+++S  L+RWGQ  Y 
Sbjct: 298 RLDSFSKVLAPGSRLGWITGSKKILKPFVSLHEMTIQAPAGFIQSVVSSTLHRWGQSGYL 357

Query: 359 NWLIDLRLEYTARRDHCLDCCHKYLPD---FVHVEPPQAGMFFMLVLDAALHPGFASDFS 415
           +WL  LR EYT +RD  +D  HKY+P+   FV + PP AGMFF + +DA+ HP F + + 
Sbjct: 358 DWLQGLRHEYTLKRDCAIDALHKYIPENKAFV-INPPIAGMFFTVNIDASTHPEFKTKYD 416

Query: 416 SSPQRLETHLYDTFIKNGVLLACGSWF-----------AVNRSPSKGTSIYFRGTYAAVD 464
           S P+++E  LY+  I  GVL+  G WF           A ++       I+FRGTYAAV 
Sbjct: 417 SDPKKVEHALYEKVISRGVLVVPGDWFITEGDTVPPQPAASKERENPNEIFFRGTYAAVS 476

Query: 465 PASMEAGIKCIAQTLLKEFG 484
           P  +  G+K + +TL +EF 
Sbjct: 477 PEKLTEGLKRLGETLHEEFN 496

>Kwal_47.18982
          Length = 496

 Score =  438 bits (1127), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 218/501 (43%), Positives = 318/501 (63%), Gaps = 35/501 (6%)

Query: 9   KAKDLRHLLSREALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEVPVP-- 66
           +++D  HL S E   R+ SP+KT +  F +  +VFLG G+P ++ FP   +  E P+P  
Sbjct: 5   ESRDFSHLYSEETKARKSSPLKTCIHLFQDPNIVFLGGGLPQSKYFPWDNLQAESPLPPF 64

Query: 67  ---------GEDGQTLVGRIPK-GAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTE 116
                    G+   T    I K G  +   + D+PLSRALQYG S GQ E + F+R+HT+
Sbjct: 65  VNGIGETPSGDASDTCHIAIKKDGVSKAGSSTDIPLSRALQYGFSMGQPEFLSFVREHTQ 124

Query: 117 KFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGM 176
             HK++Y+DW+VL T G+T +W++T+R+FCN GD+++ E +T+SSSV AAEAQG+    +
Sbjct: 125 LVHKMKYSDWNVLATTGNTGSWESTLRIFCNRGDTILAEQYTFSSSVYAAEAQGINVFPV 184

Query: 177 EVDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQ 236
            +D++G++PERL  +L  W+      A+P++LYTIPTGQNP GS+L D RK +IYR+A++
Sbjct: 185 PLDADGLIPERLEAILDNWNPD---TAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKK 241

Query: 237 YDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGR 296
           +D+LI+ED+PYYFLQMDAY     +  E +        A    F +SL++SF+  DT+GR
Sbjct: 242 HDLLIIEDEPYYFLQMDAYQKDVSQRKETH-------FASQEDFVNSLAKSFISLDTEGR 294

Query: 297 VVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDR 356
           V+RL+S SKV  PG R GWIVG++ +L +Y  L E+++Q+  GF+QAI++G LNRWGQD 
Sbjct: 295 VLRLDSFSKVLGPGTRLGWIVGSKKILQKYTQLHEMTIQNPSGFSQAIVAGTLNRWGQDG 354

Query: 357 YTNWLIDLRLEYTARRDHCLDCCHKYLPDF--VHVEPPQAGMFFMLVLDAALHPGFASDF 414
           + +WL+ LR EY  +RD  +D  +KYLP+     + PP AGMFF +  DA+ HP FA+ +
Sbjct: 355 FLDWLVGLRREYNEKRDVAIDALYKYLPETPAFTINPPIAGMFFTVNTDASAHPEFATKY 414

Query: 415 SSSPQRLETHLYDTFIKNGVLLACGSWFAV---NRSPSKGTS--------IYFRGTYAAV 463
            S P+ +E  +Y+  I +GVL+  G WF        P    S        I+FRGTYAAV
Sbjct: 415 QSKPELVEQAIYEKVIASGVLVVPGVWFKATGDTNPPQPAESKLELDPNGIFFRGTYAAV 474

Query: 464 DPASMEAGIKCIAQTLLKEFG 484
               ++ GI+     L +EFG
Sbjct: 475 PLDKLQEGIQRFGIALKEEFG 495

>KLLA0D11110g 948248..949840 similar to sp|P38840 Saccharomyces
           cerevisiae YHR137w ARO9 aromatic amino acid
           aminotransferase II, start by similarity
          Length = 530

 Score =  211 bits (537), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 137/464 (29%), Positives = 233/464 (50%), Gaps = 55/464 (11%)

Query: 44  LGAGMPPAELFPISAVSVEV--------PVPGEDGQTLVGRIPK-GAGEREFAR------ 88
           L AGMP   LFP+ +V V V          P +  +  VG   + G  E E+ +      
Sbjct: 48  LAAGMPNEGLFPVESVHVNVVERPFQHLEYPFKSEKIHVGAAGEIGVNEAEYVKSRVDDG 107

Query: 89  --------------DVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGS 134
                         ++P+++ALQY +++G  +L++F ++     +K  Y +WDV++  GS
Sbjct: 108 SMVDIWRYDPSHGDNIPIAQALQYSDTKGFPQLIDFSKKLVSYLNKPAYDNWDVMLANGS 167

Query: 135 TQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVD------SEGIVPERL 188
           + +         +E  +V+ME FT++ ++    A G   + ++VD       +GI  E +
Sbjct: 168 SDSLSKVFTTLTDEDVTVLMEEFTFTPTISNVTANGGIPIPLKVDITDDASQQGINVEYM 227

Query: 189 AELLAEWDTQHAGH-ARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247
            +LL  W T    H ++PR+LYTI TGQNP G T    ++ +IY L +++D++IVEDDPY
Sbjct: 228 DQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

Query: 248 YFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVF 307
            +L+   +D + P   +  +G     +         L+ S+L  DT GRV+RLE+ SKVF
Sbjct: 288 GYLKFLPFDKSDPLKNQYNDGTITFDKY----CKEILAPSYLTIDTSGRVIRLETFSKVF 343

Query: 308 APGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQD-------RYTNW 360
           APG R  +IV  + +LD+     ++SV+S CG AQA+   ++++W ++        + +W
Sbjct: 344 APGMRLSFIVANKFILDKLLKYADISVRSPCGLAQAMTINIIDKWAENFNGDKVRAWLSW 403

Query: 361 LIDLRLEYTARRD---HCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSS 417
           ++ +  EYT RR+     L+    Y  +   +  P AGMF  + ++     G  SD   +
Sbjct: 404 VMKVAGEYTHRRNVLFQALEATPAYKEELFELIEPSAGMFISIKINFDKF-GEISDKLKA 462

Query: 418 PQRLETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYA 461
              L   L    ++ G ++  G   AV++  S   S + R T+A
Sbjct: 463 MNFLNYKL----LEEGCIVILGYRMAVDKKFSYDRSNFLRITFA 502

>Sklu_2392.1 YHR137W, Contig c2392 2001-3593
          Length = 530

 Score =  207 bits (526), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 154/495 (31%), Positives = 230/495 (46%), Gaps = 82/495 (16%)

Query: 21  ALRRRPSPIKTTMAYFGEAGMVFLGAGMPPAELFPISAVSVEV----------PVPG--- 67
            ++  PSPI+             L AGMP   LFP+ ++ + V          P      
Sbjct: 38  GVKPHPSPIE-------------LAAGMPNEGLFPVESIHMNVVSKPFQHRSYPTKSRLL 84

Query: 68  -----------EDGQTLVGRIPKGAGEREFARD------VPLSRALQYGNSRGQSELVEF 110
                      ++ + +  +I  G+    +  D      + ++RA QY  +RG   +VEF
Sbjct: 85  HKDTLEDDPEFDEAEFIKSKIDDGSMVNIWRYDPCKPDRLSIARAFQYSETRGLPSVVEF 144

Query: 111 LRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQG 170
            ++  ++F+   Y +WDVL+  GS+ +        C+EG +V+ME FT+S ++    A G
Sbjct: 145 SKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLCDEGVTVLMEEFTFSPTIFNVTASG 204

Query: 171 LYCVGMEVD------SEGIVPERLAELLAEWDTQHAGH-ARPRVLYTIPTGQNPMGSTLV 223
              V ++V+      ++GI  + L +LL  W+     H ++PRVLYTI TGQNP G TL 
Sbjct: 205 GKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLSKPRVLYTIATGQNPTGMTLS 264

Query: 224 DARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASS 283
             ++  IY LA+ ++ +IVEDDPY +L+  AYD   P       G               
Sbjct: 265 PEKRKAIYELAETHNFIIVEDDPYGYLKFPAYDPEDPLKNPYKSGEITP----DIYCNQV 320

Query: 284 LSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQA 343
           L  SF+  DT G V+RLE+ SK+F PG R  +IVG + L+D    L EVS ++  G +QA
Sbjct: 321 LGNSFITIDTSGTVLRLETYSKLFFPGLRLSFIVGNKFLIDTLAELSEVSSRAPSGTSQA 380

Query: 344 ILSGMLNRWGQDR------YTNWLIDLRLEYTARRD---HCLDCCHKYLPDFVHVEPPQA 394
           IL+ +  +W QD       +TNW++ +  EYT RR+     L     Y      +  P A
Sbjct: 381 ILNNITQKWCQDYGDEVDGWTNWIMSVAEEYTHRRNVLFEALLSTDAYKKGLFSLLEPSA 440

Query: 395 GMFF--------MLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAVNR 446
           GMF         ++ LDA  H   A DF          L    I+ GV    G   AV +
Sbjct: 441 GMFVSIEILLDKLVKLDAEDHLK-AMDF----------LNYRLIEEGVSTVLGYRLAVCK 489

Query: 447 SPSKGTSIYFRGTYA 461
             S   S + R TYA
Sbjct: 490 KFSYDRSNFLRVTYA 504

>Scas_697.11
          Length = 510

 Score =  206 bits (523), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 221/447 (49%), Gaps = 47/447 (10%)

Query: 44  LGAGMPPAELFPISAVSVEVP----VPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYG 99
           +  GMP    FPI ++++++         + +T+   I K     E   ++PLS+++QY 
Sbjct: 56  MSGGMPNEGFFPIESINLKISNTPHFEKSERKTVTTNISK-----ETPVELPLSKSMQYS 110

Query: 100 NSRGQSELVEFLRQHTEKF-HKLRYAD--WDVLVTAGSTQAWDATMRLFCNEGDSVVMEA 156
            +RG + L++F+R   +   +   Y D  W+V++  GS+ +        C+E D+V+ME 
Sbjct: 111 ETRGLNPLLDFIRYFIKWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVLMEE 170

Query: 157 FTYSSSVEAAEAQGLYCVGMEVD----SEGIVPERLAELLAEWDTQHAGH-ARPRVLYTI 211
           FT+   +    A G  C+ ++V+     +GI  + L+ LL  W      H ++P++LYTI
Sbjct: 171 FTFVPVISNVMATGAKCIPIKVNLNYEDQGIDIDYLSNLLNNWKEGPYKHLSKPKILYTI 230

Query: 212 PTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARA 271
            TGQNPMG TL   ++ +IY++AQQ+D++I+EDDPY +L    +D         YE    
Sbjct: 231 STGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPYTYLTFPKFDPQDKFN-NPYENPNF 289

Query: 272 ALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQE 331
            ++       +  ++SF+  D DGRV+RLE+ SK+FAPG R  +I+  + LL+++    E
Sbjct: 290 TIK---EYLQNHFTKSFITLDNDGRVIRLETFSKLFAPGLRLSFIIANKFLLEKFVDFSE 346

Query: 332 VSVQSTCGFAQAILSGMLNRWGQDRYTN--------------WLIDLRLEYTARRDHCLD 377
           +S ++  G +QAI+   +      R  N              W+I +   YT RR+  L 
Sbjct: 347 LSSRAPSGTSQAIVYSTVKALTTTRANNEKPDLEQMSKAWLSWIIQIAKHYTNRRNITLS 406

Query: 378 CCHK---YLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGV 434
             ++   Y      V  P AGMF  L ++       + +      +L+  L     KNGV
Sbjct: 407 TLYESNAYKKKLFSVIEPSAGMFINLKIN-----NISINILEEMNKLDKLLS----KNGV 457

Query: 435 LLACGSWFAVNRSPSKGTSIYFRGTYA 461
            +  G   AV++  S     + R T +
Sbjct: 458 KVILGYKMAVSKEFSMSDCNFIRITIS 484

>Kwal_33.14582
          Length = 525

 Score =  198 bits (504), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 142/485 (29%), Positives = 231/485 (47%), Gaps = 53/485 (10%)

Query: 44  LGAGMPPAELFPISAVSVEVP------VPGE-DGQTLVGRIPKGAGE---REFARD---- 89
           L AG+P    FP+ ++ + V        P + +   L   +PK   E   REF       
Sbjct: 42  LSAGLPNEGFFPLESLHLNVVDEPFQLTPCDANSHKLHQGVPKTGSEFDEREFVTRKIDS 101

Query: 90  ----------------VPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAG 133
                           +PLSRALQY  +RG   L++F +      +   YADWD+ +  G
Sbjct: 102 GSMVDVWRYDPDAPSVIPLSRALQYTATRGMPPLIDFCKDFISYVNPPAYADWDLTLANG 161

Query: 134 STQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVD------SEGIVPER 187
           ++ +        C++G++V++E FT++ ++    A G   V ++++       +GI    
Sbjct: 162 TSDSLFKIFETLCDQGEAVLVEEFTFAPTLSNIRAAGGVPVPVKLNISADPQVQGIDIGH 221

Query: 188 LAELLAEWDTQHAGH-ARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDP 246
           L ELL  W      H +RP++LYTIPTGQNP G TL   ++ QIY LA+++D +IVEDDP
Sbjct: 222 LTELLDNWVQGPYAHLSRPKLLYTIPTGQNPTGMTLSREKRQQIYDLAEKHDFIIVEDDP 281

Query: 247 YYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKV 306
           Y +L+   YD A P     YE    ++     +    LS SF+  D   RV+R E+ SKV
Sbjct: 282 YGYLKFPQYDPANP-DYNPYESHTYSIDEYCHKV---LSPSFITIDKSARVLRCETFSKV 337

Query: 307 FAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLNRWGQD------RYTNW 360
           F+PG R  ++VG + L+ +     EVS ++  G +Q I++ ++ +W +D       +  W
Sbjct: 338 FSPGLRLSFVVGNKFLISKIIDFAEVSSRAPSGVSQMIVNNVIQKWAKDYRNPQEAWLTW 397

Query: 361 LIDLRLEYTARRD---HCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSS 417
           ++ +  +YT RR+     L+    Y      +    AGMF  L ++  +     SD   S
Sbjct: 398 VMKVAGQYTERRNKLVQALEATDAYRQGLFSLAQISAGMFLALKINFDMFQKVESDEERS 457

Query: 418 PQRLETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYA-AVDPASMEAGIKCIA 476
                  LY   I+ GV    G    V++  S   S + R T+A A D   ++     ++
Sbjct: 458 --HAMQLLYYKLIEEGVNTVLGINMTVSKEYSLHRSHFLRLTFAFAADSEQLKEASARLS 515

Query: 477 QTLLK 481
           + +L+
Sbjct: 516 KGVLR 520

>YHR137W (ARO9) [2424] chr8 (375710..377251) Aromatic amino acid
           aminotransferase II [1542 bp, 513 aa]
          Length = 513

 Score =  197 bits (501), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 142/506 (28%), Positives = 245/506 (48%), Gaps = 57/506 (11%)

Query: 5   DQQNKAKDLRHLLSREALRRRPSPIKTTMAYFGEAG-----MVFLGAGMPPAELFPISAV 59
           D  +  K+ +  LSR    R       ++  F +A      ++ L  GMP    FPI ++
Sbjct: 10  DYTSLKKNFQPFLSRRVENR-------SLKSFWDASDISDDVIELAGGMPNERFFPIESM 62

Query: 60  SVEV-PVPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKF 118
            +++  VP  D             +     ++P++R+ QY  ++G   L+ F++    + 
Sbjct: 63  DLKISKVPFNDNPKWHNSFTTAHLDLGSPSELPIARSFQYAETKGLPPLLHFVKDFVSRI 122

Query: 119 HKLRYAD-----WDVLVTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYC 173
           ++  ++D     WDV+++ GS  +        C+E  +V++E FT++ ++   EA G   
Sbjct: 123 NRPAFSDETESNWDVILSGGSNDSMFKVFETICDESTTVMIEEFTFTPAMSNVEATGAKV 182

Query: 174 VGMEVD------SEGIVPERLAELLAEWDT-QHAGHARPRVLYTIPTGQNPMGSTLVDAR 226
           + ++++      S+GI  E L +LL  W T  +    +PRVLYTI TGQNP G ++   +
Sbjct: 183 IPIKMNLTFDRESQGIDVEYLTQLLDNWSTGPYKDLNKPRVLYTIATGQNPTGMSVPQWK 242

Query: 227 KAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASS-LS 285
           + +IY+LAQ++D LIVEDDPY +L   +Y+   P      E    +      R+ +  L 
Sbjct: 243 REKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQEP-----LENPYHSSDLTTERYLNDFLM 297

Query: 286 RSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQEVSVQSTCGFAQAIL 345
           +SFL  DTD RV+RLE+ SK+FAPG R  +IV  + LL +   L +++ ++  G +QAI+
Sbjct: 298 KSFLTLDTDARVIRLETFSKIFAPGLRLSFIVANKFLLQKILDLADITTRAPSGTSQAIV 357

Query: 346 SGMLNRWGQDRYTN--------------WLIDLRLEYTARRDHCLDCCHK---YLPDFVH 388
              +    +   ++              W++ +  +Y  R++  L   ++   Y      
Sbjct: 358 YSTIKAMAESNLSSSLSMKEAMFEGWIRWIMQIASKYNHRKNLTLKALYETESYQAGQFT 417

Query: 389 VEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTF-IKNGVLLACGSWFAVNRS 447
           V  P AGMF ++ ++     G        PQ+++  + D F +KNGV +  G   AV  +
Sbjct: 418 VMEPSAGMFIIIKINW----GNFDRPDDLPQQMD--ILDKFLLKNGVKVVLGYKMAVCPN 471

Query: 448 PSKGTSIYFRGT--YAAVDPASMEAG 471
            SK  S + R T  YA  D   +EA 
Sbjct: 472 YSKQNSDFLRLTIAYARDDDQLIEAS 497

>CAGL0G06028g complement(579261..580874) similar to sp|P38840
           Saccharomyces cerevisiae YHR137w ARO9 aromatic amino
           acid aminotransferase II, start by similarity
          Length = 537

 Score =  194 bits (494), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 135/464 (29%), Positives = 220/464 (47%), Gaps = 42/464 (9%)

Query: 41  MVFLGAGMPPAELFPISAVSVE-VPVPGEDGQTLVGRIPKGAGEREFARDVPLSRALQYG 99
           ++ L AGMP  + FPI A+ +  V  P E        +       E  + +P++R+ QY 
Sbjct: 68  VIELTAGMPNEQFFPIKAMDMTIVNKPFESADDTSKHLHCKMSTYE-PKSLPIARSFQYN 126

Query: 100 NSRGQSELVEFLRQHTEKFHKLRYA--DWDVLVTAGSTQAWDATMRLFCNEGDSVVMEAF 157
              G  ++  F +    K +K  Y+   WDVL+++GS  +       FC+E  +V+ME F
Sbjct: 127 EVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLMEEF 186

Query: 158 TYSSSVEAAEAQGLYCVGMEVD------SEGIVPERLAELLAEWDTQHAGH-ARPRVLYT 210
           T++  +   +A G  C+ ++++      ++GI  + L +LL  W +    H  +PR+LYT
Sbjct: 187 TFTPVISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRILYT 246

Query: 211 IPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGAR 270
           I TGQNP G T+    + +IY LA +++ LI+EDDPY +L   +Y    P   +  E   
Sbjct: 247 ICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPYGYLSFPSYKPEDPLKNDYLEDGF 306

Query: 271 AALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQYWYLQ 330
              +  +      L  SFL  DTD RV+R+E+ SKVFAPG R G+IV  + ++       
Sbjct: 307 TVEKYTN----EFLVDSFLTIDTDARVIRMETFSKVFAPGLRLGFIVANKYIISNLLEYA 362

Query: 331 EVSVQSTCGFAQAILSGMLNRW-----GQDR-------------YTNWLIDLRLEYTARR 372
           E++ ++  G +QA+L   L        G D+             + +W++ +  EYT RR
Sbjct: 363 EITTRAPSGVSQAVLYNTLETMALYQDGDDKEDPEKKQEALFQGWMHWIMKVAAEYTHRR 422

Query: 373 DHCLDCCHK---YLPDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTF 429
           +  L   ++   Y      V  P AGMF  + +     PG   +     ++L+  L    
Sbjct: 423 NITLKALYETDAYKNGLFTVIEPSAGMFVGVKIKWDKAPGEIGNIPEQMKKLDRFL---- 478

Query: 430 IKNGVLLACGSWFAVNRSPSKGTSIYFRGT--YAAVDPASMEAG 471
           ++NG+    G    V+   S   S + R T  YA  D   +EA 
Sbjct: 479 VQNGIKTVLGYRMGVSSELSHDNSDFLRVTIAYAKDDQQLVEAS 522

>AGR141C [4452] [Homologous to ScYER152C - SH] (1013962..1015278)
           [1317 bp, 438 aa]
          Length = 438

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 83/303 (27%), Positives = 120/303 (39%), Gaps = 44/303 (14%)

Query: 186 ERLAELLAEWDTQHAGH---ARPR----------VLYTIPTGQNPMGSTLVDARKAQIYR 232
           E LAE L+E+D +H        PR          V+Y IPT  NP GST     + ++  
Sbjct: 148 EYLAEKLSEFDAEHPSTEALTEPRRTPPKRTYRYVMYLIPTYSNPSGSTYSLETRTRLVE 207

Query: 233 LAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWD 292
           LA++YDML++ DD Y  L  D      PR + +       +  D A           + D
Sbjct: 208 LARRYDMLLISDDIYDLLAYDQPSDQLPRALPSL------VHVDRATLNE-------EQD 254

Query: 293 TDGRVVRLESTSKVFAPGCRTGW--IVGARALLDQYWYLQEVSVQSTCGFAQAILSGMLN 350
           + G  V   S SK+ APG R G+   V +R +         VS  S       I+ G L 
Sbjct: 255 SWGHTVANASFSKIVAPGLRCGYQESVTSRLVGQLANGGANVSGGSPAQLNSMII-GTLI 313

Query: 351 RWGQDRYTNWLIDLRLEYTARRDHCLDCCHKYLPDFVHVEPPQAGMFFMLVLDAALHPGF 410
             G+    + L  LR  Y  R +       +YLP     +    G F    L    +   
Sbjct: 314 STGE--LAHLLQLLRSVYQDRAEVLHRAVREYLPAATDYKAQNGGYFSWCTLPEGYN--- 368

Query: 411 ASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAVNRSPSKGTSIYFRGTYAAVDPASMEA 470
               S +  R   H Y      GV+LA GS F V+           R + + ++PA +E 
Sbjct: 369 ----SEAICRTLQHDY------GVVLANGSHFEVSDDELGWGRRSVRLSVSFLEPAEIEE 418

Query: 471 GIK 473
           G++
Sbjct: 419 GMR 421

>Kwal_8.585
          Length = 446

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 95/241 (39%), Gaps = 32/241 (13%)

Query: 207 VLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAY 266
           V+Y +PT  NP G+T     + ++  LA++YD+LI+ D        D YD  G  G    
Sbjct: 191 VIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISD--------DVYDLLGFHGQRTD 242

Query: 267 EGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQY 326
            G R   +  H RF      +    +T G  +   + SK+ APG RTG+   A   L   
Sbjct: 243 SGIR---KPSHFRFPQLDRITVPAGNTHGNTISNCTFSKIIAPGLRTGYQETANENLANQ 299

Query: 327 WYL--QEVSVQSTCGFAQAILSGMLNRWGQDRYTNWLIDLRLEYTARRDHCLDCCHK-YL 383
             L    +S  +       I++ M+      R    L D+     A R   L+   K YL
Sbjct: 300 LSLGGANISGGTPAQLNSMIIATMIKSGAVGRIVARLTDVY----AERARVLEASIKAYL 355

Query: 384 PDFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWFA 443
           P      P + G F        L PG+ S            + +     G++LA GS F 
Sbjct: 356 PPGTQCTPCEGGYFSW----CTLPPGYNSKL----------IAERASAKGLILANGSLFE 401

Query: 444 V 444
           V
Sbjct: 402 V 402

>CAGL0I06578g 637311..638621 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c, hypothetical start
          Length = 436

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 97/240 (40%), Gaps = 32/240 (13%)

Query: 207 VLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAY 266
           V+Y +PT  NP G +     + ++  +A++YDMLI+ DD Y  L         PR  +  
Sbjct: 185 VMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVYDLLDYSTDVHEWPRPQKRL 244

Query: 267 EGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGW--IVGARALLD 324
                A   D   F +++S +              + SK+ APG R G+   +  +    
Sbjct: 245 VHIDRATAPDDNEFGNTISNA--------------TFSKIIAPGLRFGYHETINDKLAAQ 290

Query: 325 QYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWLIDLRLEYTARRDHCLDCCHKYLP 384
                  VS  +       I+  +L     +R    L  LR  Y  R     D   K++P
Sbjct: 291 LSRGGANVSGGTPSQLNSMIVGTILQNGSMERI---LGKLRETYKTRSVAMWDSLQKHMP 347

Query: 385 DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAV 444
              H+  P+ G F  + L     PG+ +      +++   L D   ++GV+LA GS F V
Sbjct: 348 KDTHISSPKGGYFVWVTLP----PGYDA------KKIGKKLKD---EHGVILANGSDFEV 394

>YER152C (YER152C) [1581] chr5 complement(472652..473983) Protein of
           unknown function, has a region of weak similarity to a
           region of kynurenine aminotransferase II (human KATII),
           which catalyzes conversion of L-kynurenine to kynurenic
           acid and may act in glutamatergic neurotransmission and
           neurodegeneration [1332 bp, 443 aa]
          Length = 443

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 94/240 (39%), Gaps = 31/240 (12%)

Query: 207 VLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAY 266
           V+Y IPT  NP G+T     + ++  +A++YDMLI+ DD Y     D  D   P      
Sbjct: 187 VMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVY-----DILDYTTPSD---- 237

Query: 267 EGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWIVGARALLDQY 326
           E     LR  H   +++ S      D+ G  V   + SK+ APG R G+     A L + 
Sbjct: 238 ELPSPPLRMVHIDRSTAPSGE----DSFGNTVSNATFSKLIAPGLRFGYHESINANLARQ 293

Query: 327 WYL--QEVSVQSTCGFAQAILSGMLNRWGQDRYTNWLIDLRLEYTARRDHCLDCCHKYLP 384
                  VS  +       I+  ML      R    +  LR  Y+ R         KY+P
Sbjct: 294 LSKGGANVSGGTPSQLNSMIVGEMLRSGAAQR---CIAHLRSVYSERATVLTSALKKYMP 350

Query: 385 DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAV 444
               + P + G F  + L  A +             + T L   F    V+LA GS F V
Sbjct: 351 LGTEIMPLKGGYFTWITLPPAYN----------AMEISTILAKKF---NVILADGSNFEV 397

>Scas_555.7
          Length = 446

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 104/275 (37%), Gaps = 41/275 (14%)

Query: 207 VLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAY 266
           V+Y +PT  NP G+T     K ++  LA++YDMLI+ DD Y  L  + +    P   + +
Sbjct: 190 VMYCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVYDLLDYEQFLDVLPHVPKRF 249

Query: 267 -EGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFAPGCRTGWI--VGARALL 323
               R         F ++LS +              + SK+ APG R G+   +  + +L
Sbjct: 250 VHLDRETSTHPENSFGNTLSNA--------------TFSKIIAPGLRFGYTESISNKLVL 295

Query: 324 DQYWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWLIDLRLEYTARRDHCLDCCHKYL 383
                    S  +       I+  ML     D+    L +LR  Y  R     +   ++L
Sbjct: 296 QLSRGGANTSGGTPSQLNSMIVGTMLKNGLVDKV---LHNLRQTYKERSVVMYESIKRWL 352

Query: 384 PDFVHVEPPQAGMFFMLVL----DAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACG 439
           P     +  + G F  + L    DA       +D                 K  V+LA G
Sbjct: 353 PRKTQCQLQKGGYFTWITLPLGYDAVEIGKMLND-----------------KYQVVLANG 395

Query: 440 SWFAVNRSPSKGTSIYFRGTYAAVDPASMEAGIKC 474
           S F V  +  K      R + + ++   + AGIK 
Sbjct: 396 SNFEVIGNERKWGERSVRLSISFLETQDIRAGIKA 430

>Sklu_2389.7 YJL060W, Contig c2389 13116-14459 reverse complement
          Length = 447

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 64/317 (20%), Positives = 115/317 (36%), Gaps = 51/317 (16%)

Query: 70  GQTLVGRIPKGAGEREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVL 129
           GQ      P     RE  + + ++   QY  ++G+  L+  L +    F+K R    +V 
Sbjct: 63  GQGFFSYSPPQFAVREAQKALEVALNNQYSPTKGRPSLINELIKLYSPFYKTRLGPSNVQ 122

Query: 130 VTAGSTQAWDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEGIVPERL- 188
           VT G+ +A  + +    N+GD V++    +   +   E  G     + +     +  R+ 
Sbjct: 123 VTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPKELENRVT 182

Query: 189 --AELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDP 246
              E   ++D   A          + T  NP+G         +I  +  + +++I+ D+ 
Sbjct: 183 HGTEWTVDYDELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEV 242

Query: 247 YYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSR-SFLDWDTDGRVVRLESTSK 305
           Y                            +H  F S  +R + L  +     + + S  K
Sbjct: 243 Y----------------------------EHLYFTSEFTRIATLSPEIGNLTLSVGSAGK 274

Query: 306 VF-APGCRTGWIVGARALLDQYWYLQEVSV--------QSTCGFAQAILSGMLNRWGQDR 356
            F A G R GWIV   A L +Y  +    +        Q  C  A++I   + N      
Sbjct: 275 TFAATGWRIGWIVSQNAELLKYASMAHTRICFASPSPFQEAC--AKSIEIALQN------ 326

Query: 357 YTNWLIDLRLEYTARRD 373
             N+   +R EY  + D
Sbjct: 327 --NYFEKMRQEYINKFD 341

>KLLA0E00935g 101430..102767 similar to sp|P10356 Saccharomyces
           cerevisiae YER152c singleton, start by similarity
          Length = 445

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/298 (23%), Positives = 104/298 (34%), Gaps = 42/298 (14%)

Query: 207 VLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAY 266
           V+Y +PT  NP G T     + ++  LA+++DMLIV DD Y  L+              Y
Sbjct: 188 VIYLVPTYSNPGGQTYSLETRVKLIELARKHDMLIVSDDVYDLLR--------------Y 233

Query: 267 EGARAALRADHARFASSLSRSFLDWDTD-GRVVRLESTSKVFAPGCRTGWIVGARALLDQ 325
           + +   L     R       S+   D+  G  +   + SK+ APG R G+       L  
Sbjct: 234 DDSLDELPHPLPRLTHVDRMSYKHGDSGYGNTISNATFSKIIAPGLRFGYQETVNENLA- 292

Query: 326 YWYLQEVSVQSTCGFAQAILSGMLNRWGQDRYTNWLI-DLRLEYTARRDHCLDCCHKYLP 384
            + L +     + G    + S ++    Q+     +I  LR EY  R          YLP
Sbjct: 293 -YQLSQGGANVSGGTPSQLNSMIVGTLIQNGKAKEIICSLRKEYQLRAACLYQSVKSYLP 351

Query: 385 DFVHVEPPQAGMFFMLVLDAALHPGFASDFSSSPQRLETHLYDTFIKNGVLLACGSWFAV 444
                     G F    L                +++   L + F    V LA GS F V
Sbjct: 352 RATQYHLQLGGYFSWCTLPEGY----------DAKKIGQELKERF---NVTLANGSSFEV 398

Query: 445 NRSPSKGTSIYFRGTYAAVDPASMEAGIKCIAQTLLKEFGHCATSCSYYTYEQRIPAR 502
                       R + + ++ A +E GIK              T C  Y     +P R
Sbjct: 399 IGDERNWGERSVRLSNSFLEIADIEQGIKL-----------WGTVCEDYAKRHNLPFR 445

>Scas_711.52
          Length = 445

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 97/251 (38%), Gaps = 39/251 (15%)

Query: 83  EREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATM 142
           E + A D+PL    QY  +RG+  L+  L +     +       +V +T G+ +   + +
Sbjct: 76  EAQKALDIPLVN--QYSPTRGRVSLLNALIKQYTPIYGSELKQENVTITTGANEGILSCL 133

Query: 143 RLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDT----- 197
               N GD V++    +   +   E  G   V + ++    + +R+ E   EW       
Sbjct: 134 MGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTE-GTEWTVDMEQF 192

Query: 198 QHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDA 257
           ++A  ++ + +  I T  NP+G         QI  +  + +++I+ D+ Y          
Sbjct: 193 KNAITSKTKAV-IINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVY---------- 241

Query: 258 AGPRGIEAYEGARAALRADHARFASSLSR-SFLDWDTDGRVVRLESTSKVF-APGCRTGW 315
                             +H  F    +R + L  +     + + S  K F A G R GW
Sbjct: 242 ------------------EHLYFTDEFTRIATLSPEIGQLTLTVGSAGKTFAATGWRIGW 283

Query: 316 IVGARALLDQY 326
           ++   + L QY
Sbjct: 284 VISLNSELLQY 294

>CAGL0J05126g complement(484849..486150) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w, hypothetical start
          Length = 447

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 52/249 (20%), Positives = 92/249 (36%), Gaps = 43/249 (17%)

Query: 87  ARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADW----DVLVTAGSTQAWDATM 142
           A DVPL    QY  +RG+  L++ L +     +K  + D+    +VLVT G+ +   + +
Sbjct: 68  ALDVPLVN--QYSPTRGRPSLIKSLVE----LYKPVFGDFIDNQNVLVTTGANEGILSCL 121

Query: 143 RLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEGIVPERLA---ELLAEWDTQH 199
               N GD V++    +   +   E  G     + +     +  R     E   +WD   
Sbjct: 122 MGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALE 181

Query: 200 AGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAG 259
                      I T  NP+G    +    ++ +L  +++ +++ D+ Y            
Sbjct: 182 KTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY------------ 229

Query: 260 PRGIEAYEGARAALRADHARFASSLSR-SFLDWDTDGRVVRLESTSKVF-APGCRTGWIV 317
                           +H  F  S  R + ++ D     + + S  K F A G R GWI+
Sbjct: 230 ----------------EHLYFTESFPRIANINEDIANLTLTVGSAGKSFAATGWRIGWII 273

Query: 318 GARALLDQY 326
                L  Y
Sbjct: 274 SKNDQLLNY 282

>CAGL0L12254g complement(1324815..1326539) similar to sp|P52893
           Saccharomyces cerevisiae YLR089c, hypothetical start
          Length = 574

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 127 DVLVTAGSTQAWDATMRLFCNEGDSVVMEAFT----YSSSVEAAEAQGLYCVGMEVDSEG 182
           D+ +TAG++ A D  + +FC   ++ V+        Y++++    +  L     E     
Sbjct: 233 DIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWS 292

Query: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242
             PE L  ++ +       + +P VL  I  G NP G+ L +    QI+ LA +Y ++++
Sbjct: 293 TDPEELESIILD---SIENNIKPSVLVVINPG-NPTGAVLSEEAIEQIFTLAAKYGIIVI 348

Query: 243 EDDPY 247
            D+ Y
Sbjct: 349 ADEVY 353

>YLR089C (YLR089C) [3504] chr12 complement(318238..320016) Putative
           mitochondrial alanine aminotransferase [1779 bp, 592 aa]
          Length = 592

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 74/158 (46%), Gaps = 15/158 (9%)

Query: 98  YGNSRG----QSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVV 153
           Y +S+G    +  + EF+ +  E   ++ Y + D+ +TAG++ A +  + +FC   ++ V
Sbjct: 221 YSSSQGVEGIRKSVAEFITKRDEG--EISYPE-DIFLTAGASAAVNYLLSIFCRGPETGV 277

Query: 154 MEAF----TYSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLY 209
           +        Y++++    +Q L     E       PE +  ++ E         +P VL 
Sbjct: 278 LIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAI---QNEIKPTVLV 334

Query: 210 TIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247
            I  G NP G+ L     AQI+ +A +Y  +++ D+ Y
Sbjct: 335 VINPG-NPTGAVLSPESIAQIFEVAAKYGTVVIADEVY 371

>KLLA0F01617g complement(154025..155359) highly similar to sp|P47039
           Saccharomyces cerevisiae YJL060w singleton, start by
           similarity
          Length = 444

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 101/263 (38%), Gaps = 52/263 (19%)

Query: 78  PKGAGEREF-ARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQ 136
           PK A E+   A +VPL+   QY  +RG+  L++ L       +     + +V +T G+ +
Sbjct: 69  PKFAIEQAVSALNVPLNN--QYSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANE 126

Query: 137 AWDATMRLFCNEGDSV-VMEAF--TYSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELL- 192
              A++    N GD V V E F   Y S++E    +  Y          + P+ L+E + 
Sbjct: 127 GILASLVGLLNPGDEVIVFEPFFDQYISNIEIPGGKVRYV-------PLVAPKELSERVT 179

Query: 193 --AEWDT-----QHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDD 245
             AEW           + R + +  + T  NP+G         Q+  +  + ++ I+ D+
Sbjct: 180 IGAEWKIDFDILNKTINERTKCI-ILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDE 238

Query: 246 PYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSR-SFLDWDTDGRVVRLESTS 304
            Y                            +H  F    +R + +  +     + + S  
Sbjct: 239 VY----------------------------EHLYFGDEFTRIATISKEIGDLTLSVGSAG 270

Query: 305 KVF-APGCRTGWIVGARALLDQY 326
           K F A G R GW+V   A L  Y
Sbjct: 271 KSFAATGWRIGWVVSRNAELLSY 293

>Kwal_56.23791
          Length = 518

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 18/159 (11%)

Query: 98  YGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSVVM--- 154
           Y NS+G +   E + +  E+      +  D+ +T G++ A    + LFCN  ++  +   
Sbjct: 148 YSNSQGVAGFRESVAEFIEERDGEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPI 207

Query: 155 ---EAFTYSSSVEAAEAQGLYC---VGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVL 208
                +T S ++  + A   Y     G  +D+E I  E++ +     D+   G  RP  L
Sbjct: 208 PQYPLYTASLALNNSHALPYYLDEESGWSMDTEQI--EKVVQ-----DSIKKG-IRPTCL 259

Query: 209 YTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPY 247
             I  G NP G+ L       + ++A +Y M+I+ D+ Y
Sbjct: 260 VVINPG-NPTGALLNTDTIENVIKVAAKYSMVIIADEVY 297

>YJL060W (BNA3) [2851] chr10 (323302..324636) Protein predicted to
           be part of the nicotinic acid biosynthetic pathway from
           tryptophan, has similarity to human tyrosine
           transaminase, mutations in which cause tyrosinemia, may
           be localized to mitochondria [1335 bp, 444 aa]
          Length = 444

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 51/252 (20%), Positives = 92/252 (36%), Gaps = 41/252 (16%)

Query: 83  EREFARDVPLSRALQYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATM 142
           E + A D+P+    QY  +RG+  L+  L +     +       +V VT G+ +   + +
Sbjct: 75  EAQKALDIPMVN--QYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCL 132

Query: 143 RLFCNEGDSV-VMEAF--TYSSSVEAAEAQGLYC---VGMEVDSEGIVPERLAELLAEWD 196
               N GD V V E F   Y  ++E    + +Y       E+D      E       +++
Sbjct: 133 MGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFE 192

Query: 197 TQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYD 256
                  +  +   I T  NP+G          +  +  +++++I+ D+ Y         
Sbjct: 193 KAITSKTKAVI---INTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVY--------- 240

Query: 257 AAGPRGIEAYEGARAALRADHARFASSLSR-SFLDWDTDGRVVRLESTSKVF-APGCRTG 314
                              +H  F  S +R + L  +     + + S  K F A G R G
Sbjct: 241 -------------------EHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIG 281

Query: 315 WIVGARALLDQY 326
           W++   A L  Y
Sbjct: 282 WVLSLNAELLSY 293

>Kwal_14.2574
          Length = 443

 Score = 36.6 bits (83), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 45/235 (19%), Positives = 83/235 (35%), Gaps = 33/235 (14%)

Query: 97  QYGNSRGQSELVEFLRQHTEKFHKLRYADWDVLVTAGSTQAWDATMRLFCNEGDSV-VME 155
           QY  ++G+  L+  L +     +  +    +V VT G+ +   + +    N GD V V E
Sbjct: 86  QYAPTKGRVSLINSLVKLYSPLYNTQLDASNVQVTTGANEGILSCLVGLLNPGDEVIVFE 145

Query: 156 AF--TYSSSVEAAEAQGLYCVGMEVDSEGIVPERLAELLAEWDTQHAGHARPRVLYTIPT 213
            F   Y S+++    +  Y          +   +  E    +D   A          + T
Sbjct: 146 PFFDQYISNIQIPGGKVTYVPMHPPKEMNVRNTKGTEWTVNYDELEAAITPKTKALILNT 205

Query: 214 GQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYDAAGPRGIEAYEGARAAL 273
             NP+G         +I  +  +++++I+ D+ Y                          
Sbjct: 206 PHNPVGKVFTREELLRIGEICVKHNVVIISDEVY-------------------------- 239

Query: 274 RADHARFASSLSR-SFLDWDTDGRVVRLESTSKVF-APGCRTGWIVGARALLDQY 326
             +H  F    +R + L  +     + + S  K F A G R GW+V     L +Y
Sbjct: 240 --EHLYFTPEFTRIATLSPEIGQITLTVGSAGKSFAATGWRIGWVVSLNPELLKY 292

>Sklu_2264.5 , Contig c2264 7329-8480
          Length = 383

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 98/242 (40%), Gaps = 46/242 (19%)

Query: 81  AGER-EFARDVPLSRALQYGNSRGQSELVEFLRQ-HTEKFHKLRYADWD-VLVTAGSTQA 137
            GER E  RD+  +    YG  +G  EL   +   +++K  KL   D D VL+T G+  A
Sbjct: 41  TGERFELDRDLRFT----YGAIKGSDELRSLVASLYSDKEVKL---DKDNVLITNGAIGA 93

Query: 138 WDATMRLFCNEGDSVVMEAFTYSSSVEAAEAQGLYCVGMEVDSEG-IVPERLAELLAEWD 196
                      GD V+    TY       +  G     +E++ E   +P+     + +  
Sbjct: 94  NFLVSYTLAGPGDHVICVDPTYQQLSSVPKMFGAEVELLELNRENDFIPD-----IGKLK 148

Query: 197 TQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIVEDDPYYFLQMDAYD 256
           +   G+ +  VL       NP+GS +  A   +I  LA++ ++ ++ D+ Y  L   ++D
Sbjct: 149 SMIKGNTKCIVL---NNPNNPLGSVIPTATLEEIAALARKNEIRVICDEVYRPL-FHSHD 204

Query: 257 AAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDGRVVRLESTSKVFA-PGCRTGW 315
                              + +++  S+         D R V   S SK FA  G R GW
Sbjct: 205 -------------------NESQYPKSMCV------LDPRGVVTGSMSKAFACAGLRLGW 239

Query: 316 IV 317
           IV
Sbjct: 240 IV 241

>Kwal_26.8458
          Length = 219

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 67  GEDGQTLVGRIPKGAGEREFA---------RDVPLSRALQYGNSRGQSELVEFLRQ 113
           G  G   V R+PKG  ERE A         R+V L+R  + GNSR     VEF+ +
Sbjct: 87  GLSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYG-FVEFVNK 141

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,583,425
Number of extensions: 634917
Number of successful extensions: 1326
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1265
Number of HSP's successfully gapped: 33
Length of query: 502
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 396
Effective length of database: 12,926,601
Effective search space: 5118933996
Effective search space used: 5118933996
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)