Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR165W50049123370.0
Sklu_1768.254253514420.0
Kwal_47.1745354453813760.0
KLLA0A04862g50350512151e-163
Scas_638.951050910821e-143
YGL017W (ATE1)50350510751e-142
CAGL0A00319g50950910221e-134
Kwal_33.1474842740647.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR165W
         (491 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH] complement(...   904   0.0  
Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement        560   0.0  
Kwal_47.17453                                                         534   0.0  
KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces c...   472   e-163
Scas_638.9                                                            421   e-143
YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase (...   418   e-142
CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces cer...   398   e-134
Kwal_33.14748                                                          29   7.4  

>AGR165W [4476] [Homologous to ScYGL017W (ATE1) - SH]
           complement(1054381..1055883) [1503 bp, 500 aa]
          Length = 500

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/491 (92%), Positives = 456/491 (92%)

Query: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNYACESWHERYXXXXXXXLRTATIGL 60
           MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNYACESWHERY       LRTATIGL
Sbjct: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNYACESWHERYAAGGGAALRTATIGL 60

Query: 61  QAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKRF 120
           QAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKRF
Sbjct: 61  QAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKRF 120

Query: 121 LRHIGAGAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHHDTGTIEPL 180
           LRHIGAGAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHHDTGTIEPL
Sbjct: 121 LRHIGAGAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHHDTGTIEPL 180

Query: 181 QFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDGKLIALGVS 240
           QFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDGKLIALGVS
Sbjct: 181 QFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDGKLIALGVS 240

Query: 241 DFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDCPKMKYKAK 300
           DFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDCPKMKYKAK
Sbjct: 241 DFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDCPKMKYKAK 300

Query: 301 YGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPXXXXXXXXXXXXPLSELPLDDRAR 360
           YGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEP            PLSELPLDDRAR
Sbjct: 301 YGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPDADCSDDEAGDDPLSELPLDDRAR 360

Query: 361 LDPAAPLRDVVERIYXXXXXXXXXXXXXXXXLVDLGVEYTPQLDVGLFPSETPDLRDCLA 420
           LDPAAPLRDVVERIY                LVDLGVEYTPQLDVGLFPSETPDLRDCLA
Sbjct: 361 LDPAAPLRDVVERIYGASGGAFAAANQAVEGLVDLGVEYTPQLDVGLFPSETPDLRDCLA 420

Query: 421 DVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRV 480
           DVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRV
Sbjct: 421 DVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRV 480

Query: 481 ICNVIRLIGLK 491
           ICNVIRLIGLK
Sbjct: 481 ICNVIRLIGLK 491

>Sklu_1768.2 YGL017W, Contig c1768 1526-3154 reverse complement
          Length = 542

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/535 (52%), Positives = 360/535 (67%), Gaps = 46/535 (8%)

Query: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNY-ACESWHERYXXXXXX-XLRTATI 58
           ME++DRLIISKPLYI++++   CGYCK  K++  +Y   +SW++ +        +   T+
Sbjct: 1   MEISDRLIISKPLYINDSSS-NCGYCKHSKNNDYDYFPTDSWYQLHKSHIKDLEINNCTL 59

Query: 59  GLQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVK 118
           GLQ EL PV++YD+ CN+GFRRSG+F+YK D LRNCCR+YTIRT+  Q   SKE +SC+ 
Sbjct: 60  GLQVELFPVEIYDDWCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPKQCKISKEFKSCIS 119

Query: 119 RFLRHIGAGA-------------GGHG--------VEALVAAEQASTRFCTRFEPARFTQ 157
           RF + I   +             GG G        V  +++AE +S  F TRFEPA +T 
Sbjct: 120 RFKKRIAPSSESSLSPGGTPLATGGKGKKQQPYDFVNEIISAELSSKNFYTRFEPAIYTP 179

Query: 158 EKYELFVRYQRAVHHDTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQR 217
           EKY+LFV+YQ  VH+D        F KFLCESPFPEDVV+GT EEW ELN W++  P  +
Sbjct: 180 EKYQLFVKYQEKVHNDHNN-SVKSFKKFLCESPFPEDVVIGTPEEWYELNNWKNLPPHSK 238

Query: 218 FRRVGPVHECYYFDGKLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVER 277
            +RVGPVHECYY++ KLIAL V+DFLPSG+SSVYFIWDP+Y++WSLGKLSALRE++++ +
Sbjct: 239 IQRVGPVHECYYYEEKLIALAVTDFLPSGISSVYFIWDPEYARWSLGKLSALRELSLLSK 298

Query: 278 IGRSYYYLGYYIEDCPKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVL----DR 333
           I R YYYLGYYIEDCPKMKYK KYGG++LDVCNNQY+PL  LE F+EHG+FFVL    ++
Sbjct: 299 INRDYYYLGYYIEDCPKMKYKRKYGGDILDVCNNQYVPLDELENFLEHGKFFVLSNENNK 358

Query: 334 AEPXXXXXXXXXXXXPLSELPLDDRARLDPAAPLRDVVERIYXXXXXXXXXXXXXXXXLV 393
            E             PLSELPLDD  +  P  PL+++VERIY                L 
Sbjct: 359 KEDDDEYYEEVNELAPLSELPLDDTKKFSPNKPLKNIVERIYGERGGAVQSANDAVDKLT 418

Query: 394 DLGVEYTPQLDVGLF-----PSETP------------DLRDCLADVYQLPNVVPGLVPLW 436
           DLG+EYTPQ+   L+     P   P            D+     ++Y LPNVVPGL+PLW
Sbjct: 419 DLGIEYTPQIFNDLYKLKPLPGMEPPTDEEHYEEDDGDISGYTNEIYHLPNVVPGLLPLW 478

Query: 437 QILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRVICNVIRLIGLK 491
           QIL+I++SGEI  +N KLM+Y+TR G++RLV DF  E+K TKRVICNVIR+IGLK
Sbjct: 479 QILQIVESGEINRLNNKLMLYNTRTGQIRLVVDFQLESKRTKRVICNVIRMIGLK 533

>Kwal_47.17453
          Length = 544

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 344/538 (63%), Gaps = 50/538 (9%)

Query: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNY-ACESWHERYXXXXXX-XLRTATI 58
           MEL+DRLIISKPLY +E  D +CGYC G+K +  +Y A ESW++ +            T+
Sbjct: 1   MELSDRLIISKPLYFTEPND-KCGYCSGKKSNLYDYFATESWYKYHEDDAKTLQFNNCTL 59

Query: 59  GLQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVK 118
           GLQ EL+PV VYD+LCN+GFRRSG+F+YK D LRNCCR+YTIRT+  +   SKEL+SCV 
Sbjct: 60  GLQVELIPVDVYDKLCNLGFRRSGNFLYKADMLRNCCRLYTIRTTPEKCQMSKELKSCVT 119

Query: 119 RFLRHI----------GAGAG--------------GHG----VEALVAAEQASTRFCTRF 150
           RF + I          G  AG              G      V  +V AE+ S  F  RF
Sbjct: 120 RFRKRISSQQSQTPSKGQNAGTIAQTARKGQAARNGQARYDYVNEIVQAEKNSESFHARF 179

Query: 151 EPARFTQEKYELFVRYQRAVHHDTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWR 210
           EPA ++ EKY+LFVRYQ  VH D        F +FLCESPFPEDVV GT EEW +LN WR
Sbjct: 180 EPATYSNEKYQLFVRYQENVHGDFNN-SVKAFKRFLCESPFPEDVVAGTQEEWDQLNNWR 238

Query: 211 SARPGQRFRRVGPVHECYYFDGKLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALR 270
             + G+  +RVGP HECYYF+GKLIAL V+DFLPSG+SSVYFIWDPD+ KWSLGKLSALR
Sbjct: 239 DMKEGEVLKRVGPAHECYYFEGKLIALAVTDFLPSGISSVYFIWDPDFPKWSLGKLSALR 298

Query: 271 EMAIVERIGRSYYYLGYYIEDCPKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFV 330
           E++++ +I R YYYLGYYI+DCPKMKYK KYGG++LDVCNN+Y+PL ++ PFIEHG+FF+
Sbjct: 299 ELSVLSKINRQYYYLGYYIDDCPKMKYKRKYGGDILDVCNNEYVPLDLVAPFIEHGKFFL 358

Query: 331 LDRAEPXXXXXXXXXXXXPLSELPLDDRARLDPAAPLRDVVERIYXXXXXXXXXXXXXXX 390
           L  A                 ELPLDD  RL   A   +VV+RIY               
Sbjct: 359 LG-ANKENDDDDDDPTEHDCEELPLDDVPRLHLNASNTNVVDRIYGENGGAELSANEAAE 417

Query: 391 XLVDLGVEYTPQL--------DVGLFPSETP---------DLRDCLADVYQLPNVVPGLV 433
            L ++G+EYTP +        +     S  P         D+      +Y LPNVVPGL+
Sbjct: 418 KLAEMGIEYTPTIFPDPYKPKEFASLTSSEPEVHYEEDDGDVPGYTNQIYHLPNVVPGLL 477

Query: 434 PLWQILKILKSGEIRHINTKLMIYDTRLGRVRLVRDFHQEAKTTKRVICNVIRLIGLK 491
           PLWQIL I++SGEI  +N KLM+Y+TR G++ LV DF  E+K  KRVICNVIR+IGLK
Sbjct: 478 PLWQILHIIESGEINRLNNKLMLYNTRSGQIHLVNDFQAESKRIKRVICNVIRMIGLK 535

>KLLA0A04862g 431710..433221 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase
           singleton, start by similarity
          Length = 503

 Score =  472 bits (1215), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 233/505 (46%), Positives = 319/505 (63%), Gaps = 27/505 (5%)

Query: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNYACESWHERYX-XXXXXXLRTATIG 59
           M+  D+LIIS+PLYIS+ ADP+CGYC G+KDS + +A   W + Y        L+++T+G
Sbjct: 1   MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDFYKGDEDKVELQSSTVG 60

Query: 60  LQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKR 119
             +EL+  + YD+LCN+GFRRSG F+YKTD LRNCCR+YTIRT+   L  SKEL++ +KR
Sbjct: 61  FNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIRTNEKYLTMSKELKTSLKR 120

Query: 120 FLRHIGAGAGG------HGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHHD 173
           F + I +            ++ L   E  ST F   FEPA FT EKY+L+VRYQ  +H D
Sbjct: 121 FKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPAEFTDEKYDLYVRYQHYIHSD 180

Query: 174 TGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDGK 233
                P QF  FLC++PF +  + GT +EW +LN W + +PG+R  + GP HECYY +GK
Sbjct: 181 EDNT-PSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNLQPGERVTKNGPAHECYYHNGK 239

Query: 234 LIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDCP 293
           LIAL V DFLPSGVSSVYFIWDPDY  WSLGK+SALRE+A+V +IGR YYYLGYYI+DCP
Sbjct: 240 LIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALRELALVSKIGRPYYYLGYYIDDCP 299

Query: 294 KMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPXXXXXXXXXXXXPLSEL 353
           KM YKAK+GGE+LDVCN +Y+PL  +   I+H   FV                  P SE+
Sbjct: 300 KMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNELFV----------GLNSTVASPDSEI 349

Query: 354 PLDDRA-RLDPAAPLRDVVERIYXXXXXXXXXXXXXXXXLVDLGVEYTPQLDVGLFPSET 412
            +   + +++   P  + V+ IY                L   G+ Y+P L   ++  E 
Sbjct: 350 LITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAKLRKYGINYSPDLQRSIY-KEI 408

Query: 413 PDLRDCLA-------DVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGRVR 465
           P+  +  +       DVY++PNVVPGLVPL +I+ + +SG++  +N  ++++DT++  +R
Sbjct: 409 PNDGNSTSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKMNELNNNVVLFDTKINALR 468

Query: 466 LVRDFHQEAKTTKRVICNVIRLIGL 490
           +VRDF  E    K VI +VIRLIGL
Sbjct: 469 IVRDFISEKPEIKTVITDVIRLIGL 493

>Scas_638.9
          Length = 510

 Score =  421 bits (1082), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 219/509 (43%), Positives = 309/509 (60%), Gaps = 26/509 (5%)

Query: 1   MELNDRLIISKPLYISEAADPQCGYCKGRKDSKNNY-ACESWHERYXXXXXXXL---RTA 56
           M L DRLII+KP+Y  E+A  +CGYC G+K +  NY   +SW+E+Y            T 
Sbjct: 1   MSLQDRLIITKPMYFKESA-SECGYCHGKKKNPRNYFPLDSWYEKYKDGFDLDAPNRGTY 59

Query: 57  TIGLQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSC 116
            +G QAEL+ V++YD LCN+GFRRSG F+Y+ D LRNCCR++TIRTS  Q   +KELR  
Sbjct: 60  NLGFQAELMTVEMYDTLCNLGFRRSGKFIYRHDMLRNCCRLFTIRTSPDQFQITKELRKT 119

Query: 117 VKRFLRHIGA----------GAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRY 166
           VK+F +HI A                ++ +++AE+AS  F T FEPA FTQEKY+LF +Y
Sbjct: 120 VKKFKKHITAVDAIEEPSSKNQKFDFIKEIISAEKASPDFKTVFEPAIFTQEKYDLFAKY 179

Query: 167 QRAVHHDTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSA--RPGQRFRRVGPV 224
           Q  VH+D     P  F +FLC+ PF   V+ GTAEEW  LN W+        +  R+GP 
Sbjct: 180 QENVHNDFKH-NPKSFKRFLCDGPFMPQVITGTAEEWKALNEWQDQDFNNSTKITRLGPT 238

Query: 225 HECYYFDGKLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYY 284
           HECYY+  KLIA+ V DFLPSGVSSVYFIWDPD+ KWSLGK+SA+REMAI+ ++ R YYY
Sbjct: 239 HECYYYKDKLIAMAVLDFLPSGVSSVYFIWDPDFKKWSLGKISAMREMAILSKLQRKYYY 298

Query: 285 LGYYIEDCPKMKYKAKYGGELLDVCNNQYLPLRVL--EPFIEHGRFFVLDRAEPXXXXXX 342
           +GYY+EDCPKM YK  YGGELLDVCN +Y+ L  L  +  I +G+ FV+D +E       
Sbjct: 299 MGYYVEDCPKMNYKGAYGGELLDVCNGEYVSLDFLHRKQMISNGKLFVMDESE--TGTSS 356

Query: 343 XXXXXXPLSELPLDDRARLDPAAPLRDVVERIYXXXXXXXXXXXXXXXXLVDLGVEYTPQ 402
                  LS    ++   ++     +++ E IY                L++  + Y  +
Sbjct: 357 DSPLMRKLSAESENNFPSVNTKVKSKNIAENIYGVNGEAYDDIEQYISGLLNFDMPYLSE 416

Query: 403 LDVGLFPSETPDLRDCLADVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLG 462
            +  ++      ++     +  LPNV PGL+PL ++  I++  EI  +N KL+I DT   
Sbjct: 417 DEDAIYGV----IKAGGDGMSALPNVSPGLLPLQELYFIVELEEITDLNGKLLILDTDDN 472

Query: 463 RVRLVRDFHQEAKTTKRVICNVIRLIGLK 491
            +R + + + E++++KRVIC+++R +GL+
Sbjct: 473 EIRPMLNIYGESESSKRVICDLVRTLGLE 501

>YGL017W (ATE1) [1956] chr7 (459857..461368) Arginyltransferase
           (arg-tRNA protein transferase), transfers arg to N-Asp
           or N-Glu of proteins prior to degradation by the N-end
           rule pathway [1512 bp, 503 aa]
          Length = 503

 Score =  418 bits (1075), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 219/505 (43%), Positives = 299/505 (59%), Gaps = 31/505 (6%)

Query: 3   LNDRLIISKPLYISEAADPQCGYCKGRKDSKNN--YACESWHERYXXXX-XXXLRTATIG 59
           ++DR +I  P   +E A  +CGYC G K    +  +A +SW  RY        +   TIG
Sbjct: 1   MSDRFVIWAPSMHNEPA-AKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIG 59

Query: 60  LQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSCVKR 119
              E + V  YD +CNMGFRRSG F+YK DPLRNCCR+YTIRT+  +L+ +KEL+ C+ R
Sbjct: 60  SFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISR 119

Query: 120 FLRHI-------GAGAGGHGVEALVAAEQASTRFCTRFEPARFTQEKYELFVRYQRAVHH 172
           F   I        A A    V  +V AE  S  F TRFEPA +++EKY LFV+YQ  VH 
Sbjct: 120 FATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQ 179

Query: 173 DTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYYFDG 232
           D     P  F +FLC++PF  + VLGT E W +LN W+  +PG++ + +GPVHECYY++G
Sbjct: 180 DYNN-SPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEG 238

Query: 233 KLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYIEDC 292
           KLIA+ VSD LPSG+SSVYFIWDPDYSKWSLGKLSALR++AI++R    YYYLGYYIEDC
Sbjct: 239 KLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDC 298

Query: 293 PKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPXXXXXXXXXXXXPLSE 352
           PKM YKA YG E+LDVC+++Y+PL+ ++  I  G+ FV+   E               SE
Sbjct: 299 PKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVD----SE 354

Query: 353 LPLDDRARLDPAAPLRDVVERIYXXXXXXXXXXXXXXXXLVDL-GVEYTPQ-LDVGLFPS 410
               +    D     +++ E IY                L +L G+ Y  + LD      
Sbjct: 355 TGRGEGFPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLK 414

Query: 411 E----TPDLRDCLADVYQLPNVVPGLVPLWQILKILKSGEIRHINTKLMIYDTRLGRVRL 466
           E     P+          +PNVVPGL+PLW++L I++SG+I  +  +L +++     +R 
Sbjct: 415 EHNGHAPN---------GIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRP 465

Query: 467 VRDFHQEAKTTKRVICNVIRLIGLK 491
           + +F+ E    K+ IC+VIRL G +
Sbjct: 466 LINFYSEPPNVKKRICDVIRLFGFE 490

>CAGL0A00319g 30978..32507 similar to sp|P16639 Saccharomyces
           cerevisiae YGL017w ATE1 arginyl tRNA transferase, start
           by similarity
          Length = 509

 Score =  398 bits (1022), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 302/509 (59%), Gaps = 29/509 (5%)

Query: 3   LNDRLIISKPLYISEAADPQCGYCKGRKDSKNN-YACESWHERYXXXXXXXL-----RTA 56
           + ++LII +PLY S+ +D  CGYC G+K   ++ Y+ ESW+ER        +     R+ 
Sbjct: 1   MENKLIIHRPLYFSDKSD--CGYCHGKKAKGSDFYSLESWYERIKENADSEVEELPVRSC 58

Query: 57  TIGLQAELLPVQVYDELCNMGFRRSGDFVYKTDPLRNCCRMYTIRTSMAQLHASKELRSC 116
           T+G Q E + V +YD++CNMGFRRSG FVYK D LR+CCR+YTIRT       +K++R C
Sbjct: 59  TVGFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTIRTRPDWFKLTKDMRKC 118

Query: 117 VKRFLRHI----GAGAGGHG-VEALVAAE--QASTRFCTRFEPARFTQEKYELFVRYQRA 169
           + RF +H+     A A   G VE +V  E    S  F TRF PA +T EKYELF  YQ  
Sbjct: 119 INRFRKHVLGEPVANAKTQGYVEDIVDIEGQSDSINFYTRFGPAVYTDEKYELFSIYQER 178

Query: 170 VHHDTGTIEPLQFNKFLCESPFPEDVVLGTAEEWAELNGWRSARPGQRFRRVGPVHECYY 229
           VH D    +   F +FLC++PF + V++GT EEW +LN W+S +PG+R  R GPVHE YY
Sbjct: 179 VHQDFDHSKK-GFKRFLCDAPFTQGVIMGTEEEWEQLNNWKSMKPGERLLRTGPVHESYY 237

Query: 230 FDGKLIALGVSDFLPSGVSSVYFIWDPDYSKWSLGKLSALREMAIVERIGRSYYYLGYYI 289
           + GKLIAL V+DFLPSG+SSVYFIW PDY KWSLGKLSALRE+++V +    YYYLGYYI
Sbjct: 238 YKGKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSALRELSLVSKTNLKYYYLGYYI 297

Query: 290 EDCPKMKYKAKYGGELLDVCNNQYLPLRVLEPFIEHGRFFVLDRAEPXXXXXXXXXXXXP 349
           +DC KM YKA YGGELLD C  +Y  L  ++  I  G+ F++                  
Sbjct: 298 DDCKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGGKLFMV------GTQGHDISREVA 351

Query: 350 LSELPLDDRARLDP--AAPLRDVVERIYXXXXXXX--XXXXXXXXXLVDLGVEYT-PQLD 404
           LS+   D   + D    A   +V E++Y                  L   G+EY  P  +
Sbjct: 352 LSDAIRDCIYQTDAFDIASDDNVAEKVYGTSSNIYRPQYLKEVISFLKTSGLEYDFPIYN 411

Query: 405 VGLFPSETPDL-RDCLADVYQLPNVVPGLVPLWQILKILKSGEI-RHINTKLMIYDTRLG 462
            G+F      + +D     + +P++ PGL+PLW++  +L SG++ + +  + +++DT  G
Sbjct: 412 DGVFNQYAKRIAKDGEDPDFTIPSICPGLIPLWELKDLLMSGKLQKELTGRTLVFDTSFG 471

Query: 463 RVRLVRDFHQEAKTTKRVICNVIRLIGLK 491
            +R +  +  E  TTK  IC+V+RL+GL+
Sbjct: 472 FIRKLEPWEDEDSTTKTAICDVVRLLGLE 500

>Kwal_33.14748
          Length = 427

 Score = 29.3 bits (64), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 296 KYKAKYGGELLDVCNNQYLP----LRVLEPFIEHGRFFVL 331
           KY     GE++++CN+  +P     R+L+ F EH  + V 
Sbjct: 269 KYYKVTAGEIVELCNHFEIPRDVAYRILDQFFEHATYLVF 308

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.141    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,150,311
Number of extensions: 613287
Number of successful extensions: 1126
Number of sequences better than 10.0: 8
Number of HSP's gapped: 1117
Number of HSP's successfully gapped: 10
Length of query: 491
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 385
Effective length of database: 12,926,601
Effective search space: 4976741385
Effective search space used: 4976741385
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)