Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR162C76374934490.0
Kwal_56.2341772360813780.0
KLLA0F14465g76760213121e-170
CAGL0L11726g82560813121e-170
YER162C (RAD4)75460712881e-167
Scas_576.377960612211e-157
CAGL0H07293g6686171775e-13
YDR314C692222990.001
ABR193W350120960.002
CAGL0H05753g348123940.003
Kwal_27.12204368118940.003
YPL096W (PNG1)363120800.15
Scas_700.2351139740.69
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR162C
         (749 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH] (1049961..1...  1333   0.0  
Kwal_56.23417                                                         535   0.0  
KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736 Saccha...   509   e-170
CAGL0L11726g complement(1249886..1252363) similar to sp|P14736 S...   509   e-170
YER162C (RAD4) [1590] chr5 complement(500625..502889) Component ...   500   e-167
Scas_576.3                                                            474   e-157
CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces c...    73   5e-13
YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Membe...    43   0.001
ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH] complement(7...    42   0.002
CAGL0H05753g complement(569862..570908) similar to tr|Q02890 Sac...    41   0.003
Kwal_27.12204                                                          41   0.003
YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase...    35   0.15 
Scas_700.2                                                             33   0.69 

>AGR162C [4473] [Homologous to ScYER162C (RAD4) - SH]
           (1049961..1052252) [2292 bp, 763 aa]
          Length = 763

 Score = 1333 bits (3449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/749 (88%), Positives = 665/749 (88%)

Query: 1   MRRADLWAMVGALGPGPSCLVHAVYSGQGTGKEVRARRDSTGEQAHSSSMEGKLPEHYFE 60
           MRRADLWAMVGALGPGPSCLVHAVYSGQGTGKEVRARRDSTGEQAHSSSMEGKLPEHYFE
Sbjct: 1   MRRADLWAMVGALGPGPSCLVHAVYSGQGTGKEVRARRDSTGEQAHSSSMEGKLPEHYFE 60

Query: 61  LXXXXXXXXXXXXHGPKRRRTXXXXXXXXXXXXXXXXXDDEGSAQSXXXXXXXXXXXXXA 120
           L            HGPKRRRT                 DDEGSAQS             A
Sbjct: 61  LVREAVAAEPAARHGPKRRRTAAGVAAAQSAGPGSVASDDEGSAQSEEEYDSEDFEDVEA 120

Query: 121 ETDAAGDVSVTLAASRARPARAKVVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRL 180
           ETDAAGDVSVTLAASRARPARAKVVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRL
Sbjct: 121 ETDAAGDVSVTLAASRARPARAKVVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRL 180

Query: 181 QSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDGGLYMR 240
           QSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDGGLYMR
Sbjct: 181 QSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDGGLYMR 240

Query: 241 PWAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPP 300
           PWAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPP
Sbjct: 241 PWAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPP 300

Query: 301 DLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRN 360
           DLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRN
Sbjct: 301 DLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRN 360

Query: 361 KSKLEPTGKFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDA 420
           KSKLEPTGKFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDA
Sbjct: 361 KSKLEPTGKFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDA 420

Query: 421 LLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATE 480
           LLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATE
Sbjct: 421 LLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATE 480

Query: 481 QCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG 540
           QCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG
Sbjct: 481 QCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG 540

Query: 541 XXXXXXXXXXXXXXXYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAA 600
                          YVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAA
Sbjct: 541 ESEEERLYPESETEPYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAA 600

Query: 601 FIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQEREXX 660
           FIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERE  
Sbjct: 601 FIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQERELG 660

Query: 661 XXXXXXXXXXXXRVKQRLIDRHGAVSEHTSDSDSEPEASDTEAGGFFPDDSASPVPRSPP 720
                       RVKQRLIDRHGAVSEHTSDSDSEPEASDTEAGGFFPDDSASPVPRSPP
Sbjct: 661 ALQSWALLLAQLRVKQRLIDRHGAVSEHTSDSDSEPEASDTEAGGFFPDDSASPVPRSPP 720

Query: 721 IRXXXXXXXXXXXXXLQTAVELEDEFAEF 749
           IR             LQTAVELEDEFAEF
Sbjct: 721 IRAPSEPVAEPAASPLQTAVELEDEFAEF 749

>Kwal_56.23417
          Length = 723

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/608 (43%), Positives = 374/608 (61%), Gaps = 31/608 (5%)

Query: 120 AETDAAGDVSVTLAASR--ARPARAKVVDSETRAFRRSFHMLHVAALLAHYHVRNTWLND 177
           +E  +  ++S+TL   +   +     +V +E R +RR FH+L +  L+ H +VRN WLND
Sbjct: 112 SEQTSNAELSITLNPQKPQKKTGSKNLVSNEERKYRRYFHLLQLVTLMVHGYVRNQWLND 171

Query: 178 GRLQSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG-G 236
            +L  +L+ LVPD V+  +HP+RD++LPLRSTRKLLD L++CM++W KH  +I   +  G
Sbjct: 172 AKLHQKLSKLVPDNVFELLHPKRDDELPLRSTRKLLDGLKRCMEIWWKHFDQITRWETPG 231

Query: 237 LYMRPWAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVAS 296
           LYM  W +L   +      +++K FN+ +  G      +A +GFVA+LR CG+NARL+ +
Sbjct: 232 LYMLDWDELDGPWEQPTRYMSQKLFNKKVAHGKG-SSEIAAQGFVAMLRACGVNARLIMN 290

Query: 297 LQPPDLTDMKPAGDARGS-DPPGDSED-----------------DTDKYEFPLVWCEVWD 338
            QPPD T+ K +  ARGS   PG+  D                 D D     L WCEVWD
Sbjct: 291 AQPPDFTNNKVS--ARGSLKTPGEYLDKTDMRPKRRKKAKGGQRDPDAKRHVLFWCEVWD 348

Query: 339 RYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFNQMRYVVGFDRKMGCRDITRRYCAQ 398
           + SK WITVDP+ ++ +EQ+R K+ L+P G   R N  RY++ +DRK+GCRD+TRRY   
Sbjct: 349 KVSKKWITVDPMGQRTIEQIRYKTALDPQGSAKRNNLFRYIIAYDRKLGCRDVTRRYTTH 408

Query: 399 YNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLR 458
           +N+K R+RRITRD  G  W   +L  LHQRKR +TDD+ED YF +RDE EGIP+NM DL+
Sbjct: 409 FNSKTRKRRITRDAEGEKWMKRVLARLHQRKRTRTDDFEDAYFRQRDETEGIPDNMQDLK 468

Query: 459 NHPHYVLEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQ 518
           NHP+YVL+ D + +E+L+   ++CG++R K       ++LKV+RR D++   + R W+ +
Sbjct: 469 NHPYYVLQNDFKWNEVLKSGCKECGFLRTKN-----NTSLKVYRREDVLVLKTARTWYTE 523

Query: 519 GKVLRKNCRAAKTVIVKDHRTGXXXXXXXXXXXXXXXYVPPPVAPDGTIPTNSFGNIDIY 578
           G+VL+    A KT   +D +TG               ++P  + P+  +PTN +GNIDIY
Sbjct: 524 GRVLKPGASALKTTKSRDFKTGEATEERLYAFDETELFIPEDLGPNNEVPTNVYGNIDIY 583

Query: 579 KPSMIPAGCVLIENPNAVRAAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAV 638
             SMIP G  LIE+P AV+AAA +G+ FAKAVTGF FE+ R  KP+ +G+VV   YR+AV
Sbjct: 584 TSSMIPRGSCLIESPVAVKAAACLGIEFAKAVTGFKFEKKRVAKPQITGIVVSQEYREAV 643

Query: 639 CAMIDGIETIGDEARMQEREXXXXXXXXXXXXXXRVKQRLIDRHGAVSEHTSDS--DSEP 696
            +MIDG+E   +E   QERE              R+KQRL   HG VS  T  +  D+EP
Sbjct: 644 ESMIDGVEYSLEEDERQERELEALQHWNLFLAKLRIKQRLNTTHGKVSSATVSTWDDNEP 703

Query: 697 EASDTEAG 704
           + SDT  G
Sbjct: 704 DQSDTSDG 711

>KLLA0F14465g 1341764..1344067 weakly similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein singleton, start by similarity
          Length = 767

 Score =  509 bits (1312), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/602 (42%), Positives = 369/602 (61%), Gaps = 34/602 (5%)

Query: 126 GDVSVTLAASRARPARAKV------VDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGR 179
           G++S+T+  S  + +  K       +D   + FR++ HM  +  L+ H + RN W ND +
Sbjct: 97  GNISITIDTSAQKKSTKKKKKTEHGLDPAVKEFRKTCHMFMLLTLVCHSYQRNEWCNDEK 156

Query: 180 LQSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRD---GG 236
           LQ +LA LV D+++ ++HP++D+++PLRSTRKLLDALR  MK W K  K  +        
Sbjct: 157 LQKKLAKLVSDDIFNNLHPQKDDEMPLRSTRKLLDALRMLMKHWNKKFKLELTSPYEFNH 216

Query: 237 LYMRPWAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVAS 296
           LYM  W  +  ++   +             +G   P +++ +GFV +LRGCGLNARL+ S
Sbjct: 217 LYMVHWDSV-LKHKCESVTFKTFKKFFTRMRG---PANISVQGFVTMLRGCGLNARLIHS 272

Query: 297 LQPPDLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVE 356
           LQPPD TD K              E++  KY  P+ WCEVWD+++K WIT+D + ++++E
Sbjct: 273 LQPPDFTDSK----IYNKRVVWSLENECLKY--PIFWCEVWDKFAKQWITIDIVGQEIIE 326

Query: 357 QVRNKSKLEPTGKF-ARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGA 415
           QVR KSKLEP G+  + FN MRYV+ FDRK GC+D++RRY A    KVR++RITR+    
Sbjct: 327 QVRYKSKLEPIGRINSAFNMMRYVIAFDRKQGCKDVSRRYIAHLQNKVRKKRITREAKLN 386

Query: 416 AWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEIL 475
            W++++++ L++R R + DDYEDEYF  R+E EGIP+++ D++NHP YVLEKDLR +++L
Sbjct: 387 EWFNSIIKFLNKRNRNRIDDYEDEYFDLRNEHEGIPDSLQDIKNHPFYVLEKDLRANQVL 446

Query: 476 RPATEQCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVK 535
           +P  +QCG++R +     + S LKVF R D++ CYS RHW++QG+ L+   +   T  +K
Sbjct: 447 KPGAQQCGFLRLRN---KSNSLLKVFPRKDVISCYSARHWYMQGRALKSGAKHLLTHKIK 503

Query: 536 DHRTGXXXXXXXXXXXXXXXYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNA 595
           +                    +P  V  DG IPTN +GNIDIYKP MIP GC L+ENPN+
Sbjct: 504 NPVEEDEDEERLYPIGQTEYVIPKQVDADGKIPTNFYGNIDIYKPWMIPIGCCLVENPNS 563

Query: 596 VRAAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQ 655
           ++AA+F+ VPFAKAVTGF FE GR VKPK +GVVV++ Y DA+ A+I+ IE   D+A   
Sbjct: 564 IKAASFLRVPFAKAVTGFKFESGRRVKPKVTGVVVENEYVDALVAVIENIEECNDDAARH 623

Query: 656 EREXXXXXXXXXXXXXXRVKQRLIDRHGAVSEHTS-------DSDSEPEAS----DTEAG 704
           E E              R+K RL++ HGAV++          DSD E   S    DTE G
Sbjct: 624 ELELEALNGWSLLLTKLRIKSRLVEEHGAVADEDGRDYSGERDSDLEDHESYTGEDTEMG 683

Query: 705 GF 706
           GF
Sbjct: 684 GF 685

>CAGL0L11726g complement(1249886..1252363) similar to sp|P14736
           Saccharomyces cerevisiae YER162c RAD4 excision repair
           protein, start by similarity
          Length = 825

 Score =  509 bits (1312), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/608 (42%), Positives = 369/608 (60%), Gaps = 37/608 (6%)

Query: 128 VSVTLAASRARPARAKV----VDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDGRLQSR 183
           ++V    S+++   +K+      +E R FR   H L++  L+ H H+ N WLN+ ++  +
Sbjct: 125 INVNKKDSQSKKESSKIQKNMCSNEDRKFRTHMHCLYLLCLMCHGHIINHWLNNSKMNRK 184

Query: 184 LAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDGGL--YMRP 241
           L+ ++P++V+  +HPE+DE+LPLRSTRKLLD L+K M++W+KH  RI+ R  G+  YMR 
Sbjct: 185 LSGMIPEKVFDMLHPEKDEELPLRSTRKLLDGLKKAMEIWQKHW-RIMQRYKGVNCYMRY 243

Query: 242 WAQLGQRYSSGAALLTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVASLQPPD 301
           W +L Q        LT+  F + + KG    R VA +GFVALLR C +NARLV S QPPD
Sbjct: 244 WDEL-QICDKSRKTLTKNDFIKGILKGVG-DRDVATQGFVALLRSCNVNARLVMSCQPPD 301

Query: 302 LTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVEQVRNK 361
            T++K +    G++     ED T   ++P+ WCEVWD++SK WIT+DP CK+ +EQVR  
Sbjct: 302 FTNLKKS---YGTEKKVSYEDMT---KYPVFWCEVWDKFSKKWITIDPFCKKTIEQVRLS 355

Query: 362 SKLEPTGKF-ARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGAAWYDA 420
           SK EP G    + N MRYV+GFDRK GCRDITRRYC  +N+K R++RIT++  G  WY+ 
Sbjct: 356 SKFEPRGVSPCKRNAMRYVIGFDRKEGCRDITRRYCQWFNSKTRKKRITKEAFGERWYER 415

Query: 421 LLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATE 480
           +L +LH+RKR K DDYED YF +R++ EG+P+NM D + HP+YVLEKD+RQ+++L+   +
Sbjct: 416 VLASLHKRKRTKIDDYEDAYFDQRNQDEGMPDNMQDFKGHPYYVLEKDIRQNQVLKSGCK 475

Query: 481 QCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIVKDHRTG 540
           +CGY++           LKV+ + DI+   S + W+++G++L+   RA KTV  K  R  
Sbjct: 476 ECGYLKLHN---KTNQVLKVYSKKDIIDLKSAKQWYMEGRILKTGARALKTVEKKRGRFT 532

Query: 541 ---XXXXXXXXXXXXXXXYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVR 597
                             YV P     G I TN+FGNI+++ PSMIPA C L+E+P A++
Sbjct: 533 DPEEQEEERLYQFDDTELYVAPLATRSGEIETNTFGNIEVFVPSMIPANCCLVESPVAIK 592

Query: 598 AAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDEARMQER 657
           AA+FI + FAKAVT F FE+GR+VKP  +GVVV   +RDA+ A IDGI     E +  E 
Sbjct: 593 AASFIRIKFAKAVTAFKFEKGRSVKPSITGVVVALWFRDALVAAIDGITQANAEEKHIEH 652

Query: 658 EXXXXXXXXXXXXXXRVKQRLIDRHGAVSEHTSDS-----------DSEPEASDT----E 702
           E              R+K +L   +G V+E  S +           D E   +D+     
Sbjct: 653 ELEALSYWHNLITKLRIKNKLNSEYGKVNEEESSTVVSQPLIANRFDEETSMTDSGDEFP 712

Query: 703 AGGFFPDD 710
            GGF P D
Sbjct: 713 QGGFLPTD 720

>YER162C (RAD4) [1590] chr5 complement(500625..502889) Component of
           the nucleotide excision repairosome, homolog of human
           XPC xeroderma pigmentosum gene product [2265 bp, 754 aa]
          Length = 754

 Score =  500 bits (1288), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 250/607 (41%), Positives = 357/607 (58%), Gaps = 29/607 (4%)

Query: 121 ETDAAGDVSVTLAASRARPARAK-----VVDSETRAFRRSFHMLHVAALLAHYHVRNTWL 175
           E     D+SV +  S  R + A+     V  +E R  R+ FHML++  L+ H  +RN W+
Sbjct: 103 EVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWI 162

Query: 176 NDGRLQSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG 235
           N  RL  +L+ LVP++V+  +HP++DE+LPLRSTRKLLD L+KCM+LW+KH K     D 
Sbjct: 163 NSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDN 222

Query: 236 -GLYMRPWAQLGQRYSSGAAL--LTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNAR 292
            GLYMR W ++    ++      L R  F RA+ KG   P  ++ +GFVA+LR C +NAR
Sbjct: 223 EGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDP-DISVQGFVAMLRACNVNAR 281

Query: 293 LVASLQPPDLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCK 352
           L+ S QPPD T+MK      G++         D  ++P+ WCEVWD++SK WITVDP+  
Sbjct: 282 LIMSCQPPDFTNMKIDTSLNGNNAY------KDMVKYPIFWCEVWDKFSKKWITVDPVNL 335

Query: 353 QLVEQVRNKSKLEPTG-KFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRD 411
           + +EQVR  SKL P G      N +RYV+ +DRK GCRD+TRRY    N+KVR+RRIT+D
Sbjct: 336 KTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKD 395

Query: 412 THGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQ 471
             G  W+  ++ ALH RKR K DDYED+YF +RDE EGIP+++ DL+NHP+YVLE+D++Q
Sbjct: 396 DFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQ 455

Query: 472 HEILRPATEQCGYVRFKTTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKT 531
            +I++P  ++CGY++        G  LKV+ + DI    S R W++ G++L+   R  K 
Sbjct: 456 TQIVKPGCKECGYLKVHG---KVGKVLKVYAKRDIADLKSARQWYMNGRILKTGSRCKKV 512

Query: 532 V---IVKDHRTGXXXXXXXXXXXXXXXYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCV 588
           +   + +                    Y+PP  +  G I  N+FGNI+++ P+MIP  C 
Sbjct: 513 IKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCC 572

Query: 589 LIENPNAVRAAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETI 648
           L+ENP A++AA F+GV FA AVT F FERG TVKP  SG+VV    R+A+   IDGIE I
Sbjct: 573 LVENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFI 632

Query: 649 GDEARMQEREXXXXXXXXXXXXXXRVKQRLIDRHGAVSEHTSDSDSEPEASDTE------ 702
            ++   +E                R++ +L   +G ++E   +   E   +D        
Sbjct: 633 QEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTETF 692

Query: 703 -AGGFFP 708
             GGF P
Sbjct: 693 MGGGFLP 699

>Scas_576.3
          Length = 779

 Score =  474 bits (1221), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 246/606 (40%), Positives = 365/606 (60%), Gaps = 23/606 (3%)

Query: 126 GDVSVTLA-ASRARPARAK------VVDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDG 178
            D+S+T+   ++   A+ K      V   E R  R +FHM  +  L+ H ++RN WLN  
Sbjct: 118 NDISITIEDPTKRNEAKGKTASTRNVCSREDRDRRYAFHMADLLCLMVHGYLRNEWLNSS 177

Query: 179 RLQSRLAALVPDEVYASMHPERDEQLPLRSTRKLLDALRKCMKLWEKHCKRIIGRDG-GL 237
           +   +L+ LVP++V+  +HP +DE+LPLRSTRKLLD L+K M+LW KH K +   +G   
Sbjct: 178 KFIVKLSKLVPEKVFQLLHPVKDEELPLRSTRKLLDGLKKTMELWNKHWKILQKYEGVAC 237

Query: 238 YMRPWAQLGQRYSSGAAL-LTRKAFNRALQKGAPMPRSVAQEGFVALLRGCGLNARLVAS 296
           YM+ W ++       +   L++K F R + KG    R +A +G+VALLR C +NARL+ S
Sbjct: 238 YMKSWDEITTSTKPNSPFFLSKKQFIRQVIKGQG-DRDIAAQGYVALLRACNVNARLIMS 296

Query: 297 LQPPDLTDMKPAGDARGSDPPGDSEDDTDKYEFPLVWCEVWDRYSKAWITVDPLCKQLVE 356
            QPPD+TD+K          P D + D D  ++P+ WCEVWD+++K WIT+D +   ++E
Sbjct: 297 CQPPDITDLKEKC------KPIDIDYD-DMVKYPIFWCEVWDKFAKKWITIDCMNFHIIE 349

Query: 357 QVRNKSKLEPTG-KFARFNQMRYVVGFDRKMGCRDITRRYCAQYNAKVRRRRITRDTHGA 415
           QV+++SKLEP G    + N +RYV+G+DRK GCRD+TRRY   YNAK R++RIT++  G 
Sbjct: 350 QVKHRSKLEPHGVACCKRNNLRYVIGYDRKNGCRDVTRRYAEWYNAKTRKKRITKEPKGE 409

Query: 416 AWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEIL 475
            W++ +L  LH+RKR K DDYED Y  +RD  E +P+N+ DL+NHP+Y+LE DLR++++L
Sbjct: 410 EWFNKVLTTLHRRKRTKIDDYEDAYLEQRDYDEAMPDNLQDLKNHPYYILETDLRRNQVL 469

Query: 476 RPATEQCGYVRFK-TTKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKTVIV 534
           +P +++ GY+  + +  ++    LKV+ R +I+   S R W+++G+VL+   R+ KTV  
Sbjct: 470 KPGSKESGYLHLQGSKSKNKNKLLKVYERKNILDLKSARQWYMEGRVLKTGSRSLKTVKR 529

Query: 535 KDHRTGXXXXXXXX---XXXXXXXYVPPPVAPDGTIPTNSFGNIDIYKPSMIPAGCVLIE 591
           +  R                    YVPP    DG I  N++GNI+++ P+MIP  C LIE
Sbjct: 530 RAMRPSLDDEEDEERLYSIDDTVLYVPPLATSDGEITPNAYGNIEVFVPTMIPGNCCLIE 589

Query: 592 NPNAVRAAAFIGVPFAKAVTGFSFERGRTVKPKFSGVVVQSCYRDAVCAMIDGIETIGDE 651
           +P A++AA F+ + + +AVTGF FERGRT KP   GVVV + YRDAV + IDGIE   D 
Sbjct: 590 SPYAIKAAKFLRINYGRAVTGFKFERGRTSKPIIGGVVVANWYRDAVKSCIDGIEYSVDN 649

Query: 652 ARMQEREXXXXXXXXXXXXXXRVKQRLIDRHGAVSEHTSDSDSEPEASDTEAGGFF-PDD 710
            +  E E              R+K++L   +G V E   +  +  +    E GGFF P  
Sbjct: 650 DKKLEEELESLRCWHTLLSKLRIKKKLDVIYGTVGEENLNLGNVSDEDVAEGGGFFVPRT 709

Query: 711 SASPVP 716
            + P P
Sbjct: 710 ESFPEP 715

>CAGL0H07293g 713669..715675 similar to tr|Q06665 Saccharomyces
           cerevisiae YDR314c, hypothetical start
          Length = 668

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 134/617 (21%), Positives = 230/617 (37%), Gaps = 103/617 (16%)

Query: 121 ETDAAGDVSVTLAASRARPARAKV--VDSETRAFRRSFHMLHVAALLAHYHVRNTWLNDG 178
           + D AGD++V L A   + A  K    D+     R   H++ +  L+A    R  W  D 
Sbjct: 49  DIDLAGDITVKLKAPLHQNATNKRRRKDNFYHRLRYGLHIIAIPILVATLIKRTNWTQDE 108

Query: 179 RLQSRLAALVPDEVYASMH--PERDEQLPLRSTRKLLDALRKCMK-------------LW 223
           RL+ RL   VP ++   +    +  + + + S R LL  L    +              +
Sbjct: 109 RLRRRLKRSVPKQITKKVKNWSKSSQDIRISSIRTLLLGLVMWFRANYQINSNGFRQNFY 168

Query: 224 EKHCKRIIGRDGGLYMRPWAQLGQR-----YSSGAALLTRKAFNRALQKGAPMPRSVAQE 278
             H   I   D G  M+P+ +   R     Y     +       R   +     R     
Sbjct: 169 RLHY--IFRLDDGNVMKPYREACLRDQHKYYGERPDIAGNIEDIRTFVRNKKANRDYLTL 226

Query: 279 GFVALLRGCGLNARLVASLQ-------------PPDLTDMKPAGDARGSDPPGDSEDDTD 325
            F+ +LR   L A  + SL+             P ++T  K A    G  P   +  DTD
Sbjct: 227 FFITILREI-LPADQIKSLRLCFSLPLHNFQISPRNIT--KLASRDAGKVP---NRFDTD 280

Query: 326 KYEFPLVWCEV--WDRYSKAWITVDPLCKQLVEQVRNKSKL-EPTGKF-------ARFNQ 375
             + P  W E+   D   K ++ +DP+       +  K  + EP   F          NQ
Sbjct: 281 LLQ-PYFWIELHTIDEPDKLYV-IDPVVHIEEGNIVKKYNIDEPVDIFEPIKDLNLNVNQ 338

Query: 376 -MRYVVGFDRK-MGCRDITRRYC--AQYNAKVRRR-RITRDTHGAAWYDALLRALHQRKR 430
             +YV+  D K M  RD++ RY     Y    R R  +   T  +  +   +R L    R
Sbjct: 339 WFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRVLKSTSR 398

Query: 431 MKTDD-YEDEYFARRDEVEGIPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFKT 489
            + D+    +  A ++    +P ++++L+  P++   + L+Q E +    +  G V++  
Sbjct: 399 YRNDNTVLMKTIAAKNY--KLPKSISELKRSPNFKGLRILKQSETVSSKAKPVGKVQY-- 454

Query: 490 TKRSAGSTLKVFRRTDIVPCYSGRHWFLQGKVLRKNCRAAKT-VIVKDHRTGXXXXXXXX 548
                G   K++R +DI+P  + +HW+L G+ ++++ +  +T  I    R          
Sbjct: 455 ----GGKKDKIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSAQELN 510

Query: 549 XXXXXXXYVPPPVAP-----------------DGTIPTNSFGNIDIYKPSMIPAGC---- 587
                  Y    + P                 D     N + N++IY  S+IP G     
Sbjct: 511 FARELFSYEQTDLTPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTGFRLMR 570

Query: 588 -----------VLIENPNAVRAAAFIG-VPFAKAVTGFSFERGRTVKPKFSGVVVQSCYR 635
                       LI+N N  +       + +   V+GF F +G+    K   +V    YR
Sbjct: 571 TFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQATPIKTHILVNYMDYR 630

Query: 636 DAVCAMIDGIETIGDEA 652
             +    D IE +  E+
Sbjct: 631 KILSLQKDYIELLRLES 647

>YDR314C (YDR314C) [1142] chr4 complement(1090426..1092504) Member
           of the DNA repair protein Rad4 family, has low
           similarity to uncharacterized C. albicans Orf6.3103p
           [2079 bp, 692 aa]
          Length = 692

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/222 (19%), Positives = 83/222 (37%), Gaps = 36/222 (16%)

Query: 450 IPNNMADLRNHPHYVLEKDLRQHEILRPATEQCGYVRFKTTKRSAGSTLKVFRRTDIVPC 509
           +P ++ +++   ++V+   L+ +E+L+   +Q       T  +   S   +F R D++  
Sbjct: 434 LPKSVTEIKRTDNFVIPSLLKSNEVLKACAKQAA-----TFTKGDNSQEPIFWRRDVIQL 488

Query: 510 YSGRHWFLQGKVLRKN---CRAAKTVIVKDHRTGXXXXXXXXXXXXXXXYVPPPVAP--- 563
            S +HW + G+ +  N    +  K + +++                    +  P  P   
Sbjct: 489 KSKQHWAILGRSILPNAQPLKRKKYLPMRERMVRNLDKYVIKELFSYEQTMKSPKYPSTY 548

Query: 564 -----------DGTIPTNSFGNIDIYKPSMIPAGCVLIENPNAVRAAAFI---------- 602
                      D +   N FGNI+IY     P G  LI     V     I          
Sbjct: 549 CDHLGQEHVITDLSHYKNKFGNIEIYSKETKPDGFELIPLSKEVDIKCLIKEYNKGKRKM 608

Query: 603 -GVPFAKAVTGFSF--ERGRTVKPKFSGVVVQSCYRDAVCAM 641
             + +   V+GF F  ++G  + PK   ++V+     AV  +
Sbjct: 609 QKIKYLDVVSGFDFKQKKGHAI-PKIESILVKETDYKAVQLL 649

>ABR193W [787] [Homologous to ScYPL096W (PNG1) - SH]
           complement(768355..769407) [1053 bp, 350 aa]
          Length = 350

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 18/120 (15%)

Query: 332 VWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFNQ-MRYVVGFDRKMGCRD 390
           VWCEV+    K W+ VD            KS  EP      +N+ M YV+ F  +   +D
Sbjct: 211 VWCEVYSNALKRWVHVDSC---------EKSFDEPHIYSVNWNKAMSYVIAFSNR-SVKD 260

Query: 391 ITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGI 450
           ++RRY       + R R+ RD         L + L +  R++  D E      RDE+E I
Sbjct: 261 VSRRY-------IVRNRLPRDQIDEDDLQFLTKYLTKLLRLQLPDEERYLLHCRDELEAI 313

>CAGL0H05753g complement(569862..570908) similar to tr|Q02890
           Saccharomyces cerevisiae YPL096w PNG1, hypothetical
           start
          Length = 348

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 53/123 (43%), Gaps = 18/123 (14%)

Query: 332 VWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFNQ-MRYVVGFDRKMGCRD 390
           VWCE +  Y K WI VD  C+Q  +        EP      +N+ M Y +GF R  G  D
Sbjct: 205 VWCEYYSPYLKRWIHVDS-CEQSFD--------EPFIYSKNWNKSMSYCIGFWR-YGVVD 254

Query: 391 ITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGI 450
           +++RY  Q        ++ RD         L  AL +R R    D E      RD++E +
Sbjct: 255 VSKRYILQ-------NQLPRDIIKEDDLQFLCHALTKRLRTGLSDDESYKMYCRDDLEQL 307

Query: 451 PNN 453
             N
Sbjct: 308 ELN 310

>Kwal_27.12204
          Length = 368

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 55/118 (46%), Gaps = 18/118 (15%)

Query: 332 VWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFN-QMRYVVGFDRKMGCRD 390
           VWCE +  + K W+ VD  C+Q  +        EP      +N +M YV+ F+    C D
Sbjct: 225 VWCEFYSTFLKRWVHVDA-CEQSFD--------EPHIYSVNWNKKMSYVIAFE-PYSCVD 274

Query: 391 ITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVE 448
           +++RY  Q   ++ R +I  D         LL  + +R+RM   D E    A RDE E
Sbjct: 275 VSKRYIIQ--NQLPRDQIKEDD-----LQFLLDMITRRQRMLLTDDEVYVQACRDEQE 325

>YPL096W (PNG1) [5348] chr16 (366922..368013) Peptide:N-glycanase
           enzyme, may be involved in degradation of misfolded
           glycoproteins [1092 bp, 363 aa]
          Length = 363

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 50/120 (41%), Gaps = 18/120 (15%)

Query: 332 VWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFN-QMRYVVGFDRKMGCRD 390
           VWCE +  +   W+ VD  C+Q  +Q        P      +N +M Y + F  K G  D
Sbjct: 219 VWCEYFSNFLNRWVHVDS-CEQSFDQ--------PYIYSINWNKKMSYCIAFG-KDGVVD 268

Query: 391 ITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQRKRMKTDDYEDEYFARRDEVEGI 450
           +++RY  Q         + RD         L + + +R R   +D E    A RDE E I
Sbjct: 269 VSKRYILQ-------NELPRDQIKEEDLKFLCQFITKRLRYSLNDDEIYQLACRDEQEQI 321

>Scas_700.2
          Length = 351

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 21/139 (15%)

Query: 332 VWCEVWDRYSKAWITVDPLCKQLVEQVRNKSKLEPTGKFARFNQ-MRYVVGFDRKMGCRD 390
           VWCE +  Y   W+ VD  C+Q  +Q        P      +N+ M Y + F  K    D
Sbjct: 209 VWCEYYSPYLNRWVHVDS-CEQSFDQ--------PYIYSINWNKSMSYCIAFS-KDDVTD 258

Query: 391 ITRRYCAQYNAKVRRRRITRDTHGAAWYDALLRALHQR-KRMKTDDYEDEYFAR--RDEV 447
           +++RY       + +  + RD         +   L +R +R +TDD   E F R  R+  
Sbjct: 259 VSKRY-------ILKNELPRDQISELDLQFICTYLTKRLRRQRTDDELFELFKRDERERF 311

Query: 448 EGIPNNMADLRNHPHYVLE 466
           E +P      +  P   LE
Sbjct: 312 EWMPKVKKTEQKSPTKTLE 330

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 21,322,993
Number of extensions: 844041
Number of successful extensions: 2020
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2026
Number of HSP's successfully gapped: 16
Length of query: 749
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 640
Effective length of database: 12,822,747
Effective search space: 8206558080
Effective search space used: 8206558080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)