Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR161C33732310691e-146
YER161C (SPT2)3333522268e-21
Scas_576.23493662206e-20
Kwal_56.234133153422152e-19
CAGL0L11704g3363452073e-18
KLLA0F14487g3021501348e-09
AFR277W587104800.066
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR161C
         (331 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH] (1048663..1...   416   e-146
YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like c...    92   8e-21
Scas_576.2                                                             89   6e-20
Kwal_56.23413                                                          87   2e-19
CAGL0L11704g complement(1248417..1249427) similar to sp|P06843 S...    84   3e-18
KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843 Saccha...    56   8e-09
AFR277W [3469] [Homologous to ScYGL252C (RTG2) - SH] complement(...    35   0.066

>AGR161C [4472] [Homologous to ScYER161C (SPT2) - SH]
           (1048663..1049676) [1014 bp, 337 aa]
          Length = 337

 Score =  416 bits (1069), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 226/323 (69%), Positives = 226/323 (69%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXXXXXXEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60
           MSFLAKLSQL                   EDNPSLDFKSPILPEYYVRKEDPAIRRLKEK
Sbjct: 1   MSFLAKLSQLKKSTTSSTDTGSGSKATKKEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60

Query: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTVVXXXXXXXXLK 120
           RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTVV        LK
Sbjct: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTVVAAAAPAPPLK 120

Query: 121 KLSFEELMKQAEEKAKSPAASGKRTAPAGPSAPAVSKPGFKPRSNSXXXXXXXXXXXXXX 180
           KLSFEELMKQAEEKAKSPAASGKRTAPAGPSAPAVSKPGFKPRSNS              
Sbjct: 121 KLSFEELMKQAEEKAKSPAASGKRTAPAGPSAPAVSKPGFKPRSNSGAAVVGGKVAGADK 180

Query: 181 XXRNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILEKQERRKRSAXXX 240
             RNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILEKQERRKRSA   
Sbjct: 181 GARNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILEKQERRKRSAGEY 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWSIFNKGRRRLYQXXXXXXXXXXXXXXXXX 300
                                        IWSIFNKGRRRLYQ                 
Sbjct: 241 EEDDSDLDDFIADDDGEEEGGSYGYDKEEIWSIFNKGRRRLYQEDDDNDFDDDMEANEME 300

Query: 301 XXXXXDYSSKMARREDKMEEEWI 323
                DYSSKMARREDKMEEEWI
Sbjct: 301 ILEEEDYSSKMARREDKMEEEWI 323

>YER161C (SPT2) [1589] chr5 complement(499342..500343) HMG-like
           chromatin protein that interacts with Snf1p through a
           conserved domain, negative regulator of HO gene
           transcription [1002 bp, 333 aa]
          Length = 333

 Score = 91.7 bits (226), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 97/352 (27%), Positives = 144/352 (40%), Gaps = 47/352 (13%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXXXXXXEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60
           MSFL+KLSQ+                   ++  SL      LP+ Y+R EDPA++RLKE 
Sbjct: 1   MSFLSKLSQIRKSTTASKAQVQDPLPKKNDEEYSL------LPKNYIRDEDPAVKRLKEL 54

Query: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQ--------EGSTRWKLPR-------P 105
           RRQE L+ G L K S  +R +      +SG  ++        EG    +  R       P
Sbjct: 55  RRQELLKNGALAKKSGVKRKRG----TSSGSEKKKIERNDDDEGGLGIRFKRSIGASHAP 110

Query: 106 KSTVVXXXXXXXXLKKLSFEELMKQAEEKAKSPAASGKRTAPAGPSAPAVSKPGFKPRSN 165
              VV        +KK+SFEELMKQAE   K P    K + P     P  +KPGFK   +
Sbjct: 111 LKPVV--RKKPEPIKKMSFEELMKQAENNEKQPPKV-KSSEPVTKERPHFNKPGFK---S 164

Query: 166 SXXXXXXXXXXXXXXXXRNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRR 225
           S                 +GG        NS +   + + + ++LP+  G A+PN +L+ 
Sbjct: 165 SKRPQKKASPGATLRGVSSGG--------NSIKSSDSPKPVKLNLPT-NGFAQPNRRLKE 215

Query: 226 ILEKQERRKRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------XXIWSIFNKGRR 279
            LE ++++ R                                        IW++FN+G++
Sbjct: 216 KLESRKQKSRYQDDYDEEDNDMDDFIEDDEDEGYHSKSKHSNGPGYDRDEIWAMFNRGKK 275

Query: 280 RLYQXXXXXXXXXXXXXXXXXXXXXXDYSSKMARREDKMEEEWIRKYEREKK 331
           R  +                      + + KMAR EDK EE W++K+E EK+
Sbjct: 276 R-SEYDYDELEDDDMEANEMEILEEEEMARKMARLEDKREEAWLKKHEEEKR 326

>Scas_576.2
          Length = 349

 Score = 89.4 bits (220), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 103/366 (28%), Positives = 148/366 (40%), Gaps = 57/366 (15%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXX------XXXXEDNPSLDFKSPILPEYYVRKEDPAI 54
           MSFL+KLSQL                         ED PSL      LP  Y+R EDPA+
Sbjct: 1   MSFLSKLSQLKKASTTNTSMKNTSKESIPRKKSIEEDIPSL------LPTNYIRDEDPAV 54

Query: 55  RRLKEKRRQEQLRKGTLKK--------ASSQRRSKANGGEVASGGV----RQEGSTRWKL 102
           RRLKE RR+EQ++ G   K         +++R+SK +   +A+ G     ++ GST  + 
Sbjct: 55  RRLKELRRKEQIKNGEFAKKHKKTNPSTTTKRKSKKDDDNLAADGYSRFKKKLGSTHTR- 113

Query: 103 PRPKSTVVXXXXXXXXLKKLSFEELMKQAEEKAKSPAASGKRTAPAGPSA--PAVSKPGF 160
           P P  T+         +KK+SF+ELMKQAE  A S  +S   +    PSA  P + KPGF
Sbjct: 114 PTPVRTLT---RKMEPIKKISFDELMKQAENNASSKESSEGISKKESPSASRPHLHKPGF 170

Query: 161 KPRSNSXXXXXXXXXXXXXXXXRNGGADRTAHAPNSAR-GMKAKQAIAIDLPSGGGLAKP 219
             RS                  R     + + +P   R G +    I I LP    +A+P
Sbjct: 171 --RSARDRNRVSKPVKHQTTLPRK----KMSLSPIRNRPGSRDATPIKISLP----VAQP 220

Query: 220 NEKLRRILEKQERR--------------KRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXX 265
           N++L++ LE + +R                                              
Sbjct: 221 NQRLKQRLESKRQRPSGRDRYGRPEYDYDDEDDMDDFIEDDEEDSEVHRRMKLHRDDPGY 280

Query: 266 XXXXIWSIFNKGRRRLYQXXXXXXXXXXXXXXXXXXXXXXDYSSKMARREDKMEEEWIRK 325
               IW++FNKGR+R                         + + +MAR EDK E  W++K
Sbjct: 281 DRDEIWAMFNKGRKR--SEYAYDEEEDDMEANEMEILEEEERAEEMARLEDKREAAWLKK 338

Query: 326 YEREKK 331
           +E EK+
Sbjct: 339 HEEEKR 344

>Kwal_56.23413
          Length = 315

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 98/342 (28%), Positives = 149/342 (43%), Gaps = 44/342 (12%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXXXXXXEDNPS----LDFKSPILPEYYVRKEDPAIRR 56
           MSFLAK SQL                   + N S    L  +S +LP+ YVR+EDPAIRR
Sbjct: 1   MSFLAKFSQLRKKPAAGNDARGSEQKRQSKLNESQEDPLRDESSLLPQKYVREEDPAIRR 60

Query: 57  LKEKRRQEQLRKGTLKK--ASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTVVXXXX 114
           LKE RR+EQL+     K  A S++R   N     +   R+ G +  +  +P + V     
Sbjct: 61  LKELRRKEQLKNAPKNKPAAPSRKRKDENSANTETKFRRKVGES-LQSRKPVAPV----- 114

Query: 115 XXXXLKKLSFEELMKQAEEKAKSPAA----SGKRTAPAGPSAPA-VSKPGFKPRSNSXXX 169
               LKKLSF+ELMK+AEEK+K+P+     S  R+     + P  + +PGFK        
Sbjct: 115 KRTPLKKLSFDELMKEAEEKSKNPSTDPIDSTSRSKALQNNPPVRLQRPGFK-------- 166

Query: 170 XXXXXXXXXXXXXRNGGADRTAHAPNSARGMKAKQAIAIDLPSGGGLAKPNEKLRRILEK 229
                        R+     T         +++ Q +    PS   +A+P  KL+R LE 
Sbjct: 167 ---------SAARRDRKPLSTPKITKQKSPVESLQRLPAPRPS---IAQPGAKLKRKLEN 214

Query: 230 QERRKRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWSIFNKGRRRLYQXXXXXX 289
            ++ +++                                 IW++FNKG++R  +      
Sbjct: 215 LKKHRQT-----DRYRSSEEEDMDDFIEDDEEEQGFNRDEIWAMFNKGKKR--RDFENDY 267

Query: 290 XXXXXXXXXXXXXXXXDYSSKMARREDKMEEEWIRKYEREKK 331
                           + ++KMA+ EDK EEEW++K+E+EK+
Sbjct: 268 ESDDMEVNEMDIMEEEERATKMAKLEDKREEEWLKKHEQEKR 309

>CAGL0L11704g complement(1248417..1249427) similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein, start by similarity
          Length = 336

 Score = 84.3 bits (207), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 138/345 (40%), Gaps = 50/345 (14%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXXXXXXEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60
           MSFL+KLS+L                   E +        +LP+ YVR+EDPA+ RLKE 
Sbjct: 1   MSFLSKLSELKKTKPKTVISPPQKANKQEEIS--------LLPKNYVREEDPAVTRLKEL 52

Query: 61  RRQEQLRKGTL-KKASSQRRSKANGGEVASGGVRQEGSTRWKLPRPKSTV--------VX 111
           RRQE L+   L KK   Q R   +  + ++G   + G     + R K  V        + 
Sbjct: 53  RRQELLKNPELAKKKQKQVRKTPSSSKASTGKKDKNGDDNMLVSRFKRKVGSDKPAVPIQ 112

Query: 112 XXXXXXXLKKLSFEELMKQAEEKAKSPAASGKRTAPAGP---SAPAVSKPGFK---PRSN 165
                  +KKLSFEELMKQAE     P +   ++  AG     +  ++KPGFK   P+S 
Sbjct: 113 VKKKPQPIKKLSFEELMKQAENNQTIPVSKDTQSNGAGEKIKGSAKLNKPGFKTSRPKSL 172

Query: 166 SXXXXXXXXXXXXXXXXRNGGADRTAHAPN-SARGMKAKQAIAIDLPSGGGLAKPNEKLR 224
           S                     ++T H  + S    K++  + I +P     A+PNE+L+
Sbjct: 173 SP----------------TTHINKTDHGKDKSTAKEKSEPVVKIGIPK---FAQPNERLK 213

Query: 225 RILEKQER----RKRSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWSIFNKGRRR 280
           + LE ++R    R+                                   IW++FNKGR+R
Sbjct: 214 KKLEMRQRVNKSRRYEDEEDDMDDFIEDDEEEYSSYRTTSKDPGYDRDEIWAMFNKGRKR 273

Query: 281 LYQXXXXXXXX---XXXXXXXXXXXXXXDYSSKMARREDKMEEEW 322
            Y                          + +++MAR EDK EE W
Sbjct: 274 SYNEYMDYEEEDDFDAMEANEMEILEEEEEAARMARLEDKREEAW 318

>KLLA0F14487g 1344298..1345206 weakly similar to sp|P06843
           Saccharomyces cerevisiae YER161c SPT2 multifunctional
           HMG-like chromatin protein singleton, start by
           similarity
          Length = 302

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 74/150 (49%), Gaps = 14/150 (9%)

Query: 1   MSFLAKLSQLXXXXXXXXXXXXXXXXXXXEDNPSLDFKSPILPEYYVRKEDPAIRRLKEK 60
           MSFLAKL QL                       SL  +  +LP+ YVR+ DPAI+RLKE 
Sbjct: 1   MSFLAKLQQLKQTTKINEPNHSANQNKAK----SLQSEEKLLPKDYVREVDPAIQRLKEA 56

Query: 61  RRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQE---GSTRWKLPRPKSTVVXXXXXXX 117
           RR +Q    T  K +++ R KA+  +  +   +++    +T  K P     VV       
Sbjct: 57  RRLKQGISSTSTKPAAKARHKASSPKDEAPIYKKKPGVNTTSGKYP----VVV---PKRE 109

Query: 118 XLKKLSFEELMKQAEEKAKSPAASGKRTAP 147
            +KKLSF+ELMK+AE+K++      K+  P
Sbjct: 110 PIKKLSFDELMKRAEQKSREGPKEDKKPLP 139

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 23/53 (43%), Gaps = 3/53 (5%)

Query: 270 IWSIFNKGRRRLYQXXXXXXXXXXXXXXXXXXXXXXDYSSKMARREDKMEEEW 322
           IWSIFNKG +R Y                         ++KMA+ EDK E+ W
Sbjct: 237 IWSIFNKGSKRKYFDSDDDDDMEANEMEIFEEEER---ATKMAKLEDKREQAW 286

>AFR277W [3469] [Homologous to ScYGL252C (RTG2) - SH]
           complement(933338..935101) [1764 bp, 587 aa]
          Length = 587

 Score = 35.4 bits (80), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 4/104 (3%)

Query: 48  RKEDPAIRRLKEKRRQEQLRKGTLKKASSQRRSKANGGEVASGGVRQEGSTRWKLP---R 104
            K+D  I ++ ++R Q+    G L  A+ +   K N    + GGVR EG+    LP   R
Sbjct: 290 HKKDSKIFKVSQRRAQQLPAVGLLMSAALESLPKINIVHFSEGGVR-EGTLYSILPREIR 348

Query: 105 PKSTVVXXXXXXXXLKKLSFEELMKQAEEKAKSPAASGKRTAPA 148
            +  ++        L    + EL+K A  ++  PA    R APA
Sbjct: 349 AQDPLIIATRPYAPLLASKYLELLKAALPESDVPALVIDRIAPA 392

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.311    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,496,066
Number of extensions: 240911
Number of successful extensions: 990
Number of sequences better than 10.0: 22
Number of HSP's gapped: 971
Number of HSP's successfully gapped: 27
Length of query: 331
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 229
Effective length of database: 13,065,073
Effective search space: 2991901717
Effective search space used: 2991901717
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)