Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR160W83682141950.0
Kwal_56.234108258409101e-110
YDR089W8698938781e-104
Scas_636.128378668393e-99
KLLA0F14509g8518847641e-88
CAGL0C03696g8318586791e-76
Scas_633.29789152750.83
Sklu_2369.8101570741.2
Scas_670.243533721.5
AFR092W142347721.9
Sklu_2066.263967693.6
KLLA0E15378g72485678.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR160W
         (821 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR160W [4471] [Homologous to ScYDR089W - SH] complement(1045983...  1620   0.0  
Kwal_56.23410                                                         355   e-110
YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing...   342   e-104
Scas_636.12                                                           327   3e-99
KLLA0F14509g complement(1345334..1347889) weakly similar to sp|P...   298   1e-88
CAGL0C03696g complement(367135..369630) similar to sp|P38966 Sac...   266   1e-76
Scas_633.29                                                            33   0.83 
Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement        33   1.2  
Scas_670.2                                                             32   1.5  
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    32   1.9  
Sklu_2066.2 YJL128C, Contig c2066 5081-7000                            31   3.6  
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    30   8.2  

>AGR160W [4471] [Homologous to ScYDR089W - SH]
           complement(1045983..1048493) [2511 bp, 836 aa]
          Length = 836

 Score = 1620 bits (4195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 783/821 (95%), Positives = 783/821 (95%)

Query: 1   MAALASTTGAGMKLRGRRGPAAEWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLL 60
           MAALASTTGAGMKLRGRRGPAAEWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLL
Sbjct: 1   MAALASTTGAGMKLRGRRGPAAEWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLL 60

Query: 61  GAFRAELSNVNLFVSLKMREITARLETVEAGIVEWRRRKVGEPXXXXXXXXXXXXXXXXC 120
           GAFRAELSNVNLFVSLKMREITARLETVEAGIVEWRRRKVGEP                C
Sbjct: 61  GAFRAELSNVNLFVSLKMREITARLETVEAGIVEWRRRKVGEPGARALRLRRANGQLAQC 120

Query: 121 SADLQRLARYLLLQKAALRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTA 180
           SADLQRLARYLLLQKAALRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTA
Sbjct: 121 SADLQRLARYLLLQKAALRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTA 180

Query: 181 VDLEPYLLEVSLIMGVLYDLEMKDRSVERAREPPNNVLGRPITSCLTFDTLFLGKYHLLQ 240
           VDLEPYLLEVSLIMGVLYDLEMKDRSVERAREPPNNVLGRPITSCLTFDTLFLGKYHLLQ
Sbjct: 181 VDLEPYLLEVSLIMGVLYDLEMKDRSVERAREPPNNVLGRPITSCLTFDTLFLGKYHLLQ 240

Query: 241 RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF 300
           RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF
Sbjct: 241 RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF 300

Query: 301 GAARPARMRRNSSLPDKLRTLSQLRTHMYPLDKQFMTDEAYNQHPNIFVRGQQDDACLLM 360
           GAARPARMRRNSSLPDKLRTLSQLRTHMYPLDKQFMTDEAYNQHPNIFVRGQQDDACLLM
Sbjct: 301 GAARPARMRRNSSLPDKLRTLSQLRTHMYPLDKQFMTDEAYNQHPNIFVRGQQDDACLLM 360

Query: 361 CHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSALDKLCLDWVRTNNLGLSDFVIS 420
           CHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSALDKLCLDWVRTNNLGLSDFVIS
Sbjct: 361 CHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSALDKLCLDWVRTNNLGLSDFVIS 420

Query: 421 VKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLTNTVVTPNKST 480
           VKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLTNTVVTPNKST
Sbjct: 421 VKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLTNTVVTPNKST 480

Query: 481 NKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMYAALAAADFQD 540
           NKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMYAALAAADFQD
Sbjct: 481 NKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMYAALAAADFQD 540

Query: 541 SSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQSPSSSGETPQRKRYWNE 600
           SSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQSPSSSGETPQRKRYWNE
Sbjct: 541 SSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQSPSSSGETPQRKRYWNE 600

Query: 601 LDEQNDADAQDCFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPP 660
           LDEQNDADAQDCFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPP
Sbjct: 601 LDEQNDADAQDCFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPP 660

Query: 661 KEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALV 720
           KEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALV
Sbjct: 661 KEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALV 720

Query: 721 CYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQTEFEGSNYIT 780
           CYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQTEFEGSNYIT
Sbjct: 721 CYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQTEFEGSNYIT 780

Query: 781 AXXXXXXXXXXXXXXXXXXXXXXRYHMAPWWHYSSCIIVFI 821
           A                      RYHMAPWWHYSSCIIVFI
Sbjct: 781 ALILVSLVVSLMLSSFSLLLLFSRYHMAPWWHYSSCIIVFI 821

>Kwal_56.23410
          Length = 825

 Score =  355 bits (910), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 258/840 (30%), Positives = 412/840 (49%), Gaps = 84/840 (10%)

Query: 23  EWTLNGMDYEYLREEVRRATTYAGGREET----DGRVLGRLLGAFRAELSNVNLFVSLKM 78
           EW LN +DY++L+E V+  TT+   ++      +   L  L  AF+ +  NVN FV +K+
Sbjct: 14  EWRLNNIDYKHLKEAVKTVTTFKPEKQPASSVNEDAELMWLYRAFQTQFRNVNDFVGMKI 73

Query: 79  REITARLETVEAGIVEWRRRKVGEPXXXXXXXXXXXXXXXXCSADLQRLARYLLLQKAAL 138
           +E + RL +VE+ I+  +R+                     C+ +L R+ R+L+LQK AL
Sbjct: 74  KEASTRLVSVESSIIRLQRQMQEPHRNKRRQLALISSHLDHCNMELLRICRFLILQKIAL 133

Query: 139 RKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHE-GVVFTAVDLEPYLLEVSLIMGVL 197
           RKL ++ ++YYPYD+A  E FV  +  C EL+   E G+ FT +DL+PYLLEVSL++ VL
Sbjct: 134 RKLLKKFLKYYPYDKAVAEKFVEQITNCPELRGDQENGLSFTKLDLDPYLLEVSLVVDVL 193

Query: 198 YDLE--------------MKDR---SVERAREPPNNVLGRPITSCLTFDTLFLGKYHLLQ 240
            +LE              MK      +E A   P   +     S L FD++FLGK   LQ
Sbjct: 194 QELEQAASGRKGSLTHETMKSEMPGEIEGAHSAP---MASHADSDLAFDSIFLGKASRLQ 250

Query: 241 RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF 300
             L++ +++ ++KFLL++L + ++DDD++  S+Q    +        G+          F
Sbjct: 251 AFLVADESISQMKFLLLQLGFHVVDDDMILVSQQSLKDSSSTSLTANGTSGKTPRTVKSF 310

Query: 301 GAARPAR-MRRNSSLPDKLRTLSQLRTHMYPLDKQ----FMTDEAYNQHPNIFVRGQQDD 355
              R A     N +LP      S  +T +  LD +    F+ D+A N+HP I V G +  
Sbjct: 311 HDLRLASDQNENVALPMISDIRSSQQTEIAMLDSKPVPSFLEDDAINRHPTIVVNGSRTC 370

Query: 356 ACLLMCHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSA-----LDKLCLDWVRTN 410
            CL+MCHVGG+RNHI+++N+    +   L+ +                + KLCL+W++++
Sbjct: 371 KCLVMCHVGGLRNHIVSENVSKKKLASVLSNKSLDTLETESETEVTTPIGKLCLEWIKSH 430

Query: 411 NLGLSDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLT 470
           +L      IS +RTR FTK      G    + YL+ +DE + +  + K+PHA VE+R   
Sbjct: 431 SLHQCGPKISTQRTR-FTK----AVGEPNLTEYLVCVDESIVLAGSKKVPHAVVEIRSQQ 485

Query: 471 NTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMY 530
           +  +   K   K D  ++ LI+ + +  +SCYPL    TLWK+ Y   +  AE+++  ++
Sbjct: 486 SGGMLHRKEGYK-DELITTLIEKMYENHISCYPLKEDQTLWKLLYQAAN--AEDLKSGLF 542

Query: 531 AALAAADFQDSSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQ----SPS 586
           +A   +     ++ + + +F IG   L +M      QR  S A    KS+  +    SP 
Sbjct: 543 SAACPS----LTSFNSESIFEIGESELSRMIAAKGEQRRASFAGKKPKSRKTKEQLISPQ 598

Query: 587 SSGETPQRKRYWNELDEQNDADAQDCFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYL 646
           ++ + P   RYWNE D   +A   + FYRD E +   + E ++GFI F++NFI   Y + 
Sbjct: 599 ANSKPP--IRYWNEFDNGEEA-GNESFYRDTEAM-PFEGEMDNGFIVFNRNFINATYNFS 654

Query: 647 HKLNHIFCYQKKPPKEYTVVPCSGDSEITRS-----ELTPLIRQNSEARSYSALEVQSTL 701
             L          P++    P   DS+  +S       + L   +S  R Y+   +  T+
Sbjct: 655 ESLRRFLTLSSDEPEKR---PLLTDSQHRQSINSFTTSSSLNTTSSAERDYNRY-INYTI 710

Query: 702 PGGGSQLQVPNWDDEAALVCYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFS 761
               SQ                    +Y +KHD+VV+ FYL++LLVSCIT+G ++GI+ S
Sbjct: 711 EQEDSQ-------------------SVYEFKHDQVVTFFYLSSLLVSCITSGISLGIVAS 751

Query: 762 LFSALGNDQTEFEGSNYITAXXXXXXXXXXXXXXXXXXXXXXRYHMAPWWHYSSCIIVFI 821
           LF  L +D     G   +T                       R+  APWWHY  C ++F+
Sbjct: 752 LFRELNDDIVFGAGPGLLTV-IIATLLTSLILSCASLLLLFSRFKFAPWWHYVGCFLIFL 810

>YDR089W (YDR089W) [941] chr4 (622106..624715) Protein containing a
           SYG1, Pho81 and XPR1 (SPX) N-terminal domain, which may
           be involved in G protein associated signal transduction,
           has weak similarity to uncharacterized C. albicans
           Orf6.8826p [2610 bp, 869 aa]
          Length = 869

 Score =  342 bits (878), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 255/893 (28%), Positives = 415/893 (46%), Gaps = 124/893 (13%)

Query: 12  MKLRGR--RGPAAEWTLNGMDYEYLREEVRRATTYAGGREETDG--RVLGRLLGAFRAEL 67
           MK   R       EW    ++YE L+  +++ T Y        G  ++L +   AF  E 
Sbjct: 1   MKFEDRILNKSIPEWKFYNINYEKLKVAIKKVTAYDYDNPNDSGMEKLLNQCSVAFDQEF 60

Query: 68  SNVNLFVSLKMREITARLETVEAGIVEWRR--RKVGEPXXXXXXXXXXXXXXXXCSADLQ 125
            NVNLFVSLK++EI+ R+ +VE+ I+++ +   K                    C+ +LQ
Sbjct: 61  QNVNLFVSLKIKEISTRILSVESSIIDFSKGLNKTSRNRFNLRKLKIINAHVDDCNFELQ 120

Query: 126 RLARYLLLQKAALRKLTRRLVRYYPYDEAE---VEGFVAALYACDELQQGHEGVVFTAVD 182
            L+R+L++Q+ ALRKL ++L+  +P D         +V ++   + L+ GHEG+ F  +D
Sbjct: 121 LLSRFLIIQRIALRKLFKKLLNEFPQDSENPLTASEYVTSIRNSESLRNGHEGISFMKLD 180

Query: 183 LEPYLLEVSLIMGVLYDLEMK----------DRSVERAREPP------------------ 214
           L+PYLLEVSLI+ VL+DLE K           RS+ R+ E                    
Sbjct: 181 LDPYLLEVSLIVDVLHDLENKLEDATEPAVEQRSLNRSDESAHTSSSPEANNSSLPASPR 240

Query: 215 ------NNVLGRPITSCLTFDTLFLGKYHLLQRLLISQDNVGELKFLLMKLDYQMIDDDV 268
                 N    + I S L FDT  + K   L R L+S +++  LKF+L+ + +++IDD +
Sbjct: 241 SIPLLSNKKTSKMIDSSLEFDTALIDKAENLGRFLLSSEDIEGLKFMLLNIGFRIIDDSI 300

Query: 269 LSTSRQLANGALPGGDPIK--GSCKAQSLRFFDFGAARPARMRRNSSLP------DKLRT 320
           +STS+++    L   D I   G+   +S + F+      +  ++ + LP      +K  +
Sbjct: 301 ISTSKEI----LDTTDNINSAGNKSIRSAKSFNDLQHTLSLSKQKNILPSAVQSNEKYVS 356

Query: 321 LSQLRTHMYPLDKQFMTDEAYNQHPNIFVRGQQDDACLLMCHVGGMRNHIITQNLPLPLV 380
           +S L T         +TD+  NQHPN+ V    +D C++MCHVGG+RNH++T +L L  V
Sbjct: 357 ISILDTVGNEGSPLLLTDDNINQHPNMIVSSTAEDTCIVMCHVGGLRNHVVTNDLLLRDV 416

Query: 381 LECLTKRQWSHKNIPLSAL---------DKLCLDWVRTNNLGLSDFVISVKRTRFFTKRD 431
              L+  +  +    +SAL          K+ L+W++++ L   +  +  KRTRF +   
Sbjct: 417 KNILSAMRSGNDTKNISALINSLDPSPISKIALEWIQSHRLKTIEPKLDFKRTRFISAD- 475

Query: 432 EVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKLTNTVVTPNKSTNKIDTELSHLI 491
              NG     +YLI LDE + I N   LP   +E++KL+ +      + N+ D +   L+
Sbjct: 476 ---NG----DIYLIALDESITIGNVSTLPFPILEIKKLSRSSGLSQTAINE-DNKFKQLM 527

Query: 492 DVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEEIERSMYAALAAADFQDSSN--ISGDIL 549
             ++     C  + P  T WK+   L    + E++  ++  L    ++ +S+  +S D  
Sbjct: 528 KSVVTNEFQCSLIPPDLTTWKICLEL--VHSNELQNDLFQLLLRDQYKLNSDDSLSPDEF 585

Query: 550 FSIGRRRLDQMSTPTVPQRTPSLAKSS------HKSQDAQSPSSSGETPQRK-RYWNELD 602
           F +G+ RL++    T P      +  S      HK    +S  S  ET ++  RYWNE D
Sbjct: 586 FQLGKDRLEEEFDLTGPINNSQGSVDSGRRVRIHK----KSKQSDNETKKKPIRYWNEFD 641

Query: 603 EQNDADAQDCFYRD----------PEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHI 652
           EQ + +  + FY D           E L   +   ++GFI F +NFI   Y +  KL ++
Sbjct: 642 EQEEDNLDNAFYIDTNGSRSTTDNEESLLLRNSPPDYGFILFSRNFINRTYDFCEKLRNL 701

Query: 653 FCYQKKPPKEYTVVPCSGDSEITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQVPN 712
             + KK                     +P + QNS+    S+    S +   GSQ    +
Sbjct: 702 IRHDKKT--------------------SPDLFQNSKHPHCSSTNYGS-VASFGSQSTSAS 740

Query: 713 WDDEAALVCYDELDV-----LYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALG 767
           +DD    + Y + D+     +Y Y+HDEVV+  YL+ LL SCI     +GI+ SLF    
Sbjct: 741 YDDVQRYLQYQQQDIEDSQSIYEYRHDEVVTFLYLSALLTSCIMASVCLGIVLSLFRGQS 800

Query: 768 NDQTEFEGSNYITAXXXXXXXXXXXXXXXXXXXXXXRYHMAPWWHYSSCIIVF 820
           N++ + E  N + A                      R+ +AP WHY  C  +F
Sbjct: 801 NNEIDLEIQNILIAIIIISLLVSLILICACLLLLFSRFTLAPIWHYVGCFTMF 853

>Scas_636.12
          Length = 837

 Score =  327 bits (839), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 244/866 (28%), Positives = 418/866 (48%), Gaps = 124/866 (14%)

Query: 23  EWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLLGAFRAELSNVNLFVSLKMREIT 82
           +W    ++Y+ L++ + R T     R ET       L   F+ +  N+NLFVSLK++EI+
Sbjct: 14  QWKHQNLEYDKLKKAIMRHT-----RLET-------LDAMFKEQFQNINLFVSLKIKEIS 61

Query: 83  ARLETVEAGIVEWRRRKVGEPXXXXXXXXXXXXXXXXCSADLQRLARYLLLQKAALRKLT 142
            R+ +VEA I++   RK                    C+ +LQ L+RYL++QK A++KL 
Sbjct: 62  TRIMSVEASILQQTMRK------GPSNFKIVFSHVNDCNEELQMLSRYLIVQKLAVKKLL 115

Query: 143 RRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDLEPYLLEVSLIMGVLYDLEM 202
           RRL+  +    A VE +V  LY  D+ Q G++GV F  +DL+PYL+E+SLI+ VL DL++
Sbjct: 116 RRLISSHD-GSAVVEEWVTELYQSDDYQNGYQGVSFAKLDLDPYLIEISLIVDVLNDLKL 174

Query: 203 K-----DRSVE--------------RAREPPNNVLGRP---ITSCLTFDTLFLGKYHLLQ 240
           K     +  V               R+ E P ++       I S + FDT+F+ K   L 
Sbjct: 175 KVTTNNNNDVSSTLLTSKHNETLNLRSNENPPSIQNNGEDIIRSAIDFDTIFMDKCLPLH 234

Query: 241 RLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDF 300
           RL++S +N+ E KF+L+  +++++DD ++STS+ +          +       S+R   F
Sbjct: 235 RLIVSNENIEEFKFMLLSNEFRIVDDQLISTSKDIIVSTEQNRPNLNVKKSMASIR--SF 292

Query: 301 GAARPARMRRNSS--------LPDKLRTLSQLRTHMYPLD----KQFMTDEAYNQHPNIF 348
              + +  +RN+S        LP    + + L   +  LD     +FM D+A+NQ P + 
Sbjct: 293 QTFQSSTKQRNNSATSTSHGGLPSLRLSQNMLSISLLDLDPTGVPRFMKDDAFNQSPTLL 352

Query: 349 VRGQQDDA---CLLMCHVGGMRNHIITQNLPLPLVLECLT---KRQWSHKNIPLSALDKL 402
           +  Q  +    C+LMCH+GG+R+H++T N+PL ++ + L+   K      N   + +D +
Sbjct: 353 IHLQDTNISPNCILMCHMGGLRDHLVTNNIPLEVINQVLSQDVKGSIPPSNSNFNPIDNM 412

Query: 403 CLDWVRTNNLGLSDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEV---FINNTLKL 459
            L+W+    L  +   I +KRTR     +E      FT  YLI++DE++   F +     
Sbjct: 413 ALEWIMNQKLRHTGMKIDIKRTRLIFSTEE------FT--YLISIDEKICITFNDEKFYF 464

Query: 460 PHAFVEVRKLT---------NTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTL 510
           PH+ VE++ L+         N +  P KS N+   +L H+   + + ++ C+ L  + TL
Sbjct: 465 PHSIVEIKLLSKKSPSSMHANNINNPTKSMNE---KLQHIFREVYEKNIQCFSLDRNWTL 521

Query: 511 WKMAYSLKDTPAEEIERSMYAALAAADFQDSSN--ISGDILFSIGRRRLDQMSTPTVPQ- 567
           WK+ YS+   P    +  ++  L   D+    N  +S +  F++G   + ++  P   + 
Sbjct: 522 WKICYSICQLPNVN-DNDLFKLLLQCDYTLPPNDSLSTEEFFALGHDGILELCYPPFQEE 580

Query: 568 -RTPSLAKSSHKSQDAQSPSSSGETPQRK---RYWNELDEQNDADAQDC--FYRDPEELH 621
            R  S ++S+H +      + S    Q++   RYWNE D+   +  ++   FY+D +E  
Sbjct: 581 IRNKSQSQSTHSNFKPHPYNESKANKQKERTFRYWNEFDDDQASINRENQHFYQDEDESI 640

Query: 622 TGDYEAEHGFIKFDKNFILNFYQYLHKLNHIFCYQKKPPKEYTVVPCSGDSEITRSELTP 681
               + +HG + F++ FI + +              K  K   +       +  + + T 
Sbjct: 641 CS--QEDHGLVTFNRPFIDSMFDKF-----------KSIKSMIIPRKRKQRKKRQQDGTS 687

Query: 682 LIRQNSEARSYSALEVQSTLPGGGSQLQVPNWDDEAALVCYD-----ELDVLYGYKHDEV 736
           +        S S L +    PG  S L+        AL+ YD     E + +Y +KHD+V
Sbjct: 688 IYGSTYVLGSRSTLTLS---PGSESDLE--------ALLEYDPSNVQESESIYEFKHDQV 736

Query: 737 VSLFYLTTLLVSCITTGTTVGIMFSLFSALGNDQT-EFEGSNYITAXXXXXXXXXXXXXX 795
           +++FYL +LL+SC+T+G  +GI+ +LF    ND    F+G N++ A              
Sbjct: 737 LTVFYLASLLISCMTSGLCLGIVLALFRESENDDVIVFDGINFLLAVIIGSLLVSLILII 796

Query: 796 XXXXXXXXRYHMAPWWHYSSCIIVFI 821
                   R+ +AP WHY SC + FI
Sbjct: 797 VSLLLLFSRFTLAPLWHYISCFVFFI 822

>KLLA0F14509g complement(1345334..1347889) weakly similar to
           sp|P38966 Saccharomyces cerevisiae YDR089w singleton,
           start by similarity
          Length = 851

 Score =  298 bits (764), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 249/884 (28%), Positives = 403/884 (45%), Gaps = 140/884 (15%)

Query: 11  GMKLRGRRGPAAEWTLNGMDYEYLREEVRRATTYAGGREET-------DGRVLGRLLGAF 63
           G ++  +  P  EW L+ +DY+ L+  +RR TT   G++         D   L  L   F
Sbjct: 4   GTQILDKSVP--EWKLHNIDYQQLKVGIRRCTTVREGQDPEFRPNSIEDDPELRSLKKLF 61

Query: 64  RAELSNVNLFVSLKMREITARLETVEAGIVEWRRRKVGEPXXXXXXXXXXXXXXXXCSAD 123
           R++   +N+F+S+K++E + R+ ++E  + +     + +                 C+ +
Sbjct: 62  RSQFEMINVFISMKLKECSTRIVSIENYLTQLHL--IKDENKKLRRIKLINQHLDRCNLE 119

Query: 124 LQRLARYLLLQKAALRKLTRRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDL 183
           LQ+L+RYL+LQK A+RKL ++ +++YPY     + F+ +L  C E ++GHEGV    VDL
Sbjct: 120 LQKLSRYLILQKIAVRKLFKKFLKHYPYGTQLAQEFINSLKNCPEFKEGHEGVSMLTVDL 179

Query: 184 EPYLLEVSLIMGVLYDLEM----------KDRSVERAREPPNNVLGRPITS--------- 224
           +PYLLE+SLI+ +L+++E             ++   +    N+ +G  ITS         
Sbjct: 180 DPYLLEISLIVDLLHEMEQDADQQPVDSGNTKTGNTSNSRANSNVG--ITSGTAPSSRKS 237

Query: 225 -----------CLTFDTLFLGKYHLLQRLLISQDNVGELKFLLMKLDYQMIDDDVLSTSR 273
                       L FD  FL K++ L   LIS+++  E+KFLL+ L + + DD V++TS+
Sbjct: 238 SVVSSSHVIDSTLKFDHYFLSKFNPLGSFLISKESEDEIKFLLINLGFCLFDDSVIATSK 297

Query: 274 QLANG-ALPGGDPIKGSCKAQSLRFFDFG----AARPARMRRNSSLP------------- 315
           ++ +G AL      KGS K  SLR F       AA  ++ R   S P             
Sbjct: 298 KILSGDALLSKR--KGSIK--SLRMFRDAQREEAASSSQRRDTESSPPVGSPESDPGSNR 353

Query: 316 DKLRTLSQLRTH---MYPLDK------QFMTDEAYNQHPNIFVRGQQDDACLLMCHVGGM 366
            +  + S    H     PL K              N  PN+ V     +  +L+CHVGG+
Sbjct: 354 SQQLSNSSSSAHNILFEPLAKPGADVTNLYNSTEENLFPNLLVSYPSSNDSILLCHVGGL 413

Query: 367 RNHIITQNLPLPLVLECLTKRQWSHKNIPLSA-LDKLCLDWVRTNNLGLSDFVISVKRTR 425
           RNHI T  +    +   L   + S   +P+S  LD+ C DW  ++NL  +D VI  +R+R
Sbjct: 414 RNHISTDTIEYTDIKAVLNGCEPSL--MPVSNRLDEFCRDWCYSHNLKTTDLVIKCRRSR 471

Query: 426 FFTKRDEVINGTAFTSVYLITLDEEVFINNTLKLPHAFVEVRKL--TNTVVTPNKSTNK- 482
           F      +         YLI +D+ + IN+  KLP A +EV+ L  T++   PNK+ +K 
Sbjct: 472 FIISHSSIETNND----YLICIDDNIEINDN-KLPFAVLEVKILEATSSSSVPNKTYSKK 526

Query: 483 -IDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLK--DTPAEEIERSMYAALAAADFQ 539
            ID  +  L + ++  +LS YP   + TLW+MA  +     P   ++ ++        F 
Sbjct: 527 HIDPIMVDLTEKLVTDNLSVYPTGRNFTLWEMAGKIAGGSNPLACLDGNLNFESVEEMFG 586

Query: 540 DSSNISGDILFSIGRRRLDQMSTPTVPQRTPSLAKSSHKSQDAQ---SPSSSGETPQRKR 596
                +G+ L      R   +  P      P++  S   SQ+     SP+ +     R R
Sbjct: 587 -----AGNALLKKTHDRYQSLLNP------PTIEFSQSSSQNTAVNISPTVTEREKPRIR 635

Query: 597 YWNELDEQNDADAQD---CFYRDPEELHTGDYEAEHGFIKFDKNFILNFYQYLHKLNHIF 653
           YWNE D+  +A  QD   C   D +E     Y  + G I+F+ +FI+  Y  L K    F
Sbjct: 636 YWNEFDDGEEAMDQDFYSCLDEDDDE-----YTHDTGLIRFNPSFIIAIYHLLSKFQIAF 690

Query: 654 CYQKKPPKEYTVVPCSGDS----EITRSELTPLIRQNSEARSYSALEVQSTLPGGGSQLQ 709
                     +++  +G S    +   S LT    + ++   +  LE Q++         
Sbjct: 691 GIIDDVQARKSLLRDAGKSYNSIDTDTSILTSSSSERNDVNKFWELEEQNS--------- 741

Query: 710 VPNWDDEAALVCYDELDVLYGYKHDEVVSLFYLTTLLVSCITTGTTVGIMFSLFSALGND 769
                           + +Y ++HD+V+S FY+++LL+SC+TTG T+GIM SLF +L ND
Sbjct: 742 ----------------ESIYEFEHDQVISFFYVSSLLISCLTTGVTIGIMTSLFKSL-ND 784

Query: 770 QTEFEGSNYITAXXXXXXXXXXXXXXXXXXXXXXRYHMAPWWHY 813
            T+ E    I                        R+  AP WHY
Sbjct: 785 DTQLENETSILTMIFISLSISLILGAWSLLLMFSRFTFAPTWHY 828

>CAGL0C03696g complement(367135..369630) similar to sp|P38966
           Saccharomyces cerevisiae YDR089w, start by similarity
          Length = 831

 Score =  266 bits (679), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 217/858 (25%), Positives = 390/858 (45%), Gaps = 114/858 (13%)

Query: 23  EWTLNGMDYEYLREEVRRATTYAGGREETDGRVLGRLLGAFRAELSNVNLFVSLKMREIT 82
           +W LN +DYE L++ +++ T+        D      L  +F+  +  +NLFVSLK++EI+
Sbjct: 14  DWKLNNIDYEELKKIIKQVTSKKTAPNSND---FEGLEVSFKQNIVQINLFVSLKLKEIS 70

Query: 83  ARLETVEAGIVEWRRRKVGEPXXXXXXXXXXXXXXXXCSADLQRLARYLLLQKAALRKLT 142
           ++L ++E  I +    ++ +                 C+  LQ+L+R++++Q+ ALRKL 
Sbjct: 71  SKLVSIEHSITKLLDNEINDNRKVLRRIKTIKNYLETCNDLLQKLSRFVIVQRIALRKLF 130

Query: 143 RRLVRYYPYDEAEVEGFVAALYACDELQQGHEGVVFTAVDLEPYLLEVSLIMGVLYDLEM 202
           +++ ++Y  D+   + F++++  C+EL+ G+EGV F  +DL+ YL+EVSLIM +L D+  
Sbjct: 131 KKITKHYG-DKKIAQQFISSIQNCNELRDGYEGVSFKNLDLQSYLVEVSLIMDILTDMTN 189

Query: 203 KDRSVERAREPPNNVL------------GRPITSCLT---FDTLFLGKYHLLQRLLISQD 247
             +S    ++ P+ +              +P+ S  T   FD +   K  L+Q LL+  D
Sbjct: 190 AIKSTGNFKDLPSELFEKSKLITNATDNKKPLVSFTTNQQFDQVLWDKGELIQSLLVRSD 249

Query: 248 NVGELKFLLMKLDYQMIDDDVLSTSRQLANGALPGGDPIKGSCKAQSLRFFDFGAARPAR 307
           N  +LKFLL+ L +Q+ D ++   SR +        +P       +S + F + + RPA 
Sbjct: 250 NNEQLKFLLITLGFQVFDQNLQGISRDII-----ASEPNSEVRSLRSKKSF-YESDRPAL 303

Query: 308 MRRNSSLPDKLRTLSQLR---------THMYPLDKQFMTDEAYNQHPNIFVRGQQDDA-- 356
            R ++S  + L    ++          T    +D      +    +P++ +  ++++   
Sbjct: 304 KRLHTSSTEYLNNAEEMEQSKCKAVMLTPSGKVDSSIYDSKKITSYPSVLLEYEKNNVIA 363

Query: 357 --CLLMCHVGGMRNHIITQNLPLPLVLECLTKRQWSHKNIPLSALDKLCLDWVRTNNLGL 414
             C+++CHVGG+R  ++T  L +  + E L     S+K      L K+ LDW+  + +  
Sbjct: 364 NECIVICHVGGLRGKVVTDKLHINEISEYLKN---SNKQAISDPLAKIALDWICDHGMKE 420

Query: 415 SDFVISVKRTRFFTKRDEVINGTAFTSVYLITLDEEVFINN----TLKL-PHAFVEVRKL 469
               I  KRTR+F  +         +++Y+IT+DEE  +++    T KL  H+ +++R +
Sbjct: 421 CGIEIGFKRTRYFCNK--------HSNLYMITIDEEFTLSDSNGQTEKLMDHSIIDLRVV 472

Query: 470 TNTVVTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPSNTLWKMAYSLKDTPAEE--IER 527
           T    + NKS  K   E   + + I+   + C+P  P     K+  S+ +    +  I R
Sbjct: 473 TTNFSSDNKSLAKKSQE---IYEKIISSKIQCFPFQPDFHPVKLLLSIHENNGSKDVIHR 529

Query: 528 SMYAALAAADFQDSSNISGDILFSIGRRRLDQMSTPTV----------PQRTPSLAK--- 574
            M   +   +  +++ I+ D  F IG   L  + +             P RTP+  K   
Sbjct: 530 LMLENI--YELNENNKITEDEFFGIGFDLLLDICSSEFKDNYYQKVESPTRTPNDWKKNN 587

Query: 575 --SSHKSQDAQSPSSSGETPQRKRYWNELDEQNDADAQDCFY----RDPEELHTGDYEAE 628
             S +K+ +   P+         RYWNE D+  + +    FY     D  E +    E +
Sbjct: 588 LLSKNKNTENNKPAI--------RYWNEFDDLEEENGGGGFYIQDRTDDLESNELQQERD 639

Query: 629 HGFIKFDKNFILNFYQYLHKLNHIFCYQKKPPKEYTVVPCSGDSEITRSELTPLIRQNSE 688
           +GFI F K+FI + Y  L        ++                   R+ + P +   SE
Sbjct: 640 YGFIHFSKDFIESTYSSLQSFRDFLGFKDN----------------NRTAIDPALLDLSE 683

Query: 689 ARSYSALEVQSTLPGGGSQLQVPNWDDEAALVCYDELDV-----LYGYKHDEVVSLFYLT 743
               S      ++   GS L   + +D   L+ +   ++     +Y YKHD+V+SL YL 
Sbjct: 684 RFGNSNY---GSISSKGSILS-NSVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLF 739

Query: 744 TLLVSCITTGTTVGIMFSLFSALGNDQTEFEGSNYITAXXXXXXXXXXXXXXXXXXXXXX 803
            LL++C T+G  +GI+ S+F+   N   E +    +                        
Sbjct: 740 ALLMACATSGICMGIVLSVFNG-DNSDIEIDVGKTLIITVILSLGISLGLITLCLLLLFS 798

Query: 804 RYHMAPWWHYSSCIIVFI 821
           RY  AP WHY+    +FI
Sbjct: 799 RYTYAPIWHYALSFAIFI 816

>Scas_633.29
          Length = 789

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 9/152 (5%)

Query: 174 EGVVFTAVDLEPYLLEVSLIMGVLYDLEMKDRSVERAREPPNNVLGRPITSCLTFDTLFL 233
           E   F  + + P+ ++  +   V Y ++ ++ S E+  E  N+VLGR       F    +
Sbjct: 569 ESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGR----LTDFKM*LM 624

Query: 234 GKYHLLQRLLISQDNVGELKFLLMKLDYQMIDDDVLSTSRQLANGA---LPGGDPIKGSC 290
            KY    RL I +     L+ L   ++    DD+ +S    L+N A   L  GD    + 
Sbjct: 625 AKYSYHSRLSIHRRE--PLQNLGTNIEPDDSDDEKVSGPPVLSNFASAFLSEGDKNTSNI 682

Query: 291 KAQSLRFFDFGAARPARMRRNSSLPDKLRTLS 322
           + +    F+    + ++   NS  P++   LS
Sbjct: 683 REEETNVFNNSNMKLSQTPNNSIEPNQADDLS 714

>Sklu_2369.8 YER075C, Contig c2369 9770-12817 reverse complement
          Length = 1015

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 8/70 (11%)

Query: 707 QLQVPNWDDEAALVCYDELDVLYGYKHDEVVSLF--------YLTTLLVSCITTGTTVGI 758
           QLQ+ NW D   L+  DE+  + G K+  +  LF        Y+ T+LV C       G 
Sbjct: 818 QLQIKNWPDLGILMNPDEILQVIGLKNFVLDELFSKHVYQDDYVPTILVHCSAGCGRTGT 877

Query: 759 MFSLFSALGN 768
           + ++ S L N
Sbjct: 878 LCTIDSLLSN 887

>Scas_670.2
          Length = 435

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 320 TLSQLRTHMYPLDKQFMTDEAYNQHPN-IFVRG 351
           TL QL   MYP  KQ +  E  N HP+ IF RG
Sbjct: 346 TLIQLDMEMYPFKKQLINFETLNCHPSGIFSRG 378

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 6/47 (12%)

Query: 611  DCFYRDPEELHTGDYEAEHGFIKFDKNF------ILNFYQYLHKLNH 651
            DCF  DPEE  T D    H F +  K F      + NF +   KLN+
Sbjct: 1368 DCFMIDPEERPTADTLLSHPFCQVPKEFNFRDTDLYNFIKQNDKLNN 1414

>Sklu_2066.2 YJL128C, Contig c2066 5081-7000
          Length = 639

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 474 VTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPS--NTLWKMAYSLKDTPAEEIERSMYA 531
           + P+KST  + +++  L   IL+M+L  YP  P   + ++    ++ D P  ++ ++ ++
Sbjct: 505 LNPDKSTYTVQSDIWSLGLSILEMALGAYPYPPETYDNIFSQLSAIVDGPPPKLPQAKFS 564

Query: 532 ALAAADF 538
           A  A DF
Sbjct: 565 A-DAQDF 570

>KLLA0E15378g 1362851..1365025 some similarities with sp|P08018
           Saccharomyces cerevisiae YJL128c PBS2 tyrosine protein
           kinase of the MAP kinase kinase family, hypothetical
           start
          Length = 724

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 9/85 (10%)

Query: 474 VTPNKSTNKIDTELSHLIDVILDMSLSCYPLAPS--NTLWKMAYSLKDTPAEEIERSMYA 531
           + P+KST  + +++  L   IL+M+L  YP  P   + ++    ++ D P  ++    ++
Sbjct: 591 LNPDKSTYSVQSDIWSLGLSILEMALGAYPYPPETFDNIFSQLSAIVDGPPPKLPEGKFS 650

Query: 532 ALAAADFQDSSNISGDILFSIGRRR 556
           A       D+ N     L  I  RR
Sbjct: 651 A-------DAQNFVSMCLQKIPERR 668

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,847,151
Number of extensions: 1124429
Number of successful extensions: 3185
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3213
Number of HSP's successfully gapped: 31
Length of query: 821
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 711
Effective length of database: 12,788,129
Effective search space: 9092359719
Effective search space used: 9092359719
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)