Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR159C2662618271e-112
Scas_636.113532352104e-19
Kwal_56.234073411311876e-16
YDR088C (SLU7)3821541575e-12
CAGL0H04917g3182791283e-08
KLLA0F14531g341234982e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR159C
         (261 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH] (1044766..1...   323   e-112
Scas_636.11                                                            86   4e-19
Kwal_56.23407                                                          77   6e-16
YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA sp...    65   5e-12
CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces c...    54   3e-08
KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775 Saccha...    42   2e-04

>AGR159C [4470] [Homologous to ScYDR088C (SLU7) - SH]
           (1044766..1045566) [801 bp, 266 aa]
          Length = 266

 Score =  323 bits (827), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 173/261 (66%), Positives = 173/261 (66%)

Query: 1   MEENKHIPKYIRDKPWYVESGDDDADYLGHHRREPGEGAQDFSVAQQGSVISDRFVXXXX 60
           MEENKHIPKYIRDKPWYVESGDDDADYLGHHRREPGEGAQDFSVAQQGSVISDRFV    
Sbjct: 1   MEENKHIPKYIRDKPWYVESGDDDADYLGHHRREPGEGAQDFSVAQQGSVISDRFVAGSA 60

Query: 61  XXXXXXXXXCTNCGANHDRRDCLLRPRKQARGDGGERAFQVRDENALSFEAKRDRWYGFE 120
                    CTNCGANHDRRDCLLRPRKQARGDGGERAFQVRDENALSFEAKRDRWYGFE
Sbjct: 61  PRAGRGRGRCTNCGANHDRRDCLLRPRKQARGDGGERAFQVRDENALSFEAKRDRWYGFE 120

Query: 121 GXXXXXXXXXXXXXXXXXXXXXXXXXRYKLGLDXXXXXXXXXXXXXXXXHDRARYLDDVR 180
           G                         RYKLGLD                HDRARYLDDVR
Sbjct: 121 GPVAPAVAAAAAEPPAAAEDAAAAVERYKLGLDARAARAGVGAPAIRPRHDRARYLDDVR 180

Query: 181 GEETRYDPKSRVYXXXXXXXXXXXXXXXXXXXXSTVDHVISANPTRLELGRQTPERGARQ 240
           GEETRYDPKSRVY                    STVDHVISANPTRLELGRQTPERGARQ
Sbjct: 181 GEETRYDPKSRVYRGDGAAGEAPAAPDRAGRDGSTVDHVISANPTRLELGRQTPERGARQ 240

Query: 241 PEGXXXXXXXXXXXXXXYGNS 261
           PEG              YGNS
Sbjct: 241 PEGQAQSAAARASLLQRYGNS 261

>Scas_636.11
          Length = 353

 Score = 85.5 bits (210), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 96/235 (40%), Gaps = 50/235 (21%)

Query: 2   EENKHIPKYIRDKPWYVESGD------DDADYLGHHRREPGEGAQDFSVAQQ-----GSV 50
           +EN+HIP+YI+ +PWY + G+      DD DYL HHR       +D ++        G+ 
Sbjct: 14  KENQHIPRYIKTQPWYYKDGNAKPEGKDDEDYLKHHRN------KDHTLDHNDEPSIGAG 67

Query: 51  ISDRFVXXXXXXXXXXXX------XCTNCGA-NHDRRDCLLRPRKQARGD--GGERAFQV 101
           ISD+F+                   CTNCG   H  +DC  RP+K  + D   G++  ++
Sbjct: 68  ISDKFITTETKTLKTTMSDNGDVRKCTNCGTMGHLAKDCFERPKKFKKLDSYSGDQ-IKI 126

Query: 102 RDENALSFEAKRDRWYGFEGXXXXXXXXXXXXXXXXXXXXXXXXXR-------------Y 148
           R++  L ++AK+DRW+G+EG                                        
Sbjct: 127 RNDEELDWDAKKDRWFGYEGKEYNELLQNWENKKKNELKMPSNGENEVNIWDSDEEIELM 186

Query: 149 KLGL----------DXXXXXXXXXXXXXXXXHDRARYLDDVRGEETRYDPKSRVY 193
           KLGL          D                 DRA YL+DV      YDPKSR+Y
Sbjct: 187 KLGLYKDSVGLLKKDDYNNTHLKNRTSVRLREDRAAYLNDVNSGTINYDPKSRIY 241

>Kwal_56.23407
          Length = 341

 Score = 76.6 bits (187), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 71/131 (54%), Gaps = 11/131 (8%)

Query: 2   EENKHIPKYIRDKPWY---VESGDDDA-DYLGHHRR----EPGEGAQDFSVAQQGSVISD 53
           +EN HIPKYI+D+PW+   ++SGDD + DYL HHRR    +      + +  + G  I D
Sbjct: 12  QENVHIPKYIKDQPWFYKDLKSGDDQSNDYLSHHRRLNRPDSDLDIDNNAEPKIGRGIKD 71

Query: 54  RFVXXXXXXXXXXXXXCTNC-GANHDRRDCLLRPRKQARGDGG--ERAFQVRDENALSFE 110
            +              C NC G +H RRDCL  PRK+        + +   R + + +++
Sbjct: 72  EYEGYSEVVTSRVRPKCNNCGGMDHIRRDCLEAPRKRPATTKSVLKSSILRRKDMSGNWD 131

Query: 111 AKRDRWYGFEG 121
           A+RDRW+G+EG
Sbjct: 132 AQRDRWFGYEG 142

 Score = 34.3 bits (77), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 17/23 (73%)

Query: 171 DRARYLDDVRGEETRYDPKSRVY 193
           DRA YL+D+  E   YDPKSR+Y
Sbjct: 211 DRAAYLNDINSETLNYDPKSRLY 233

>YDR088C (SLU7) [940] chr4 complement(618491..619639) Pre-mRNA
           splicing factor affecting 3' splice site choice,
           required for the second catalytic step of splicing [1149
           bp, 382 aa]
          Length = 382

 Score = 65.1 bits (157), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 71/154 (46%), Gaps = 38/154 (24%)

Query: 3   ENKHIPKYIRDKPWYVES----------GDDD---------ADYLGHHRREPGEGAQDF- 42
           EN HIP+YIR++PWY +           G+DD         +DYL HHR++   GA D  
Sbjct: 29  ENIHIPRYIRNQPWYYKDTPKEQEGKKPGNDDTSTAEGGEKSDYLVHHRQKAKGGALDID 88

Query: 43  --SVAQQGSVISDRFV----XXXXXXXXXXXXXCTNCG-ANHDRRDCLLRPRKQ------ 89
             S  + G  I D F                  C NCG A H  +DC+ +PRK       
Sbjct: 89  NNSEPKIGMGIKDEFKLIRPQKMSVRDSHSLSFCRNCGEAGHKEKDCMEKPRKMQKLVPD 148

Query: 90  --ARGDGGERAFQVRDENALSFEAKRDRWYGFEG 121
             ++ + G    +  D++   +++++DRWYG+ G
Sbjct: 149 LNSQKNNGTVLVRATDDD---WDSRKDRWYGYSG 179

 Score = 33.9 bits (76), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 171 DRARYLDDVRGEETRYDPKSRVY 193
           D+A YL+D+   E+ YDPKSR+Y
Sbjct: 251 DKAAYLNDINSTESNYDPKSRLY 273

>CAGL0H04917g 469160..470116 similar to sp|Q02775 Saccharomyces
           cerevisiae YDR088c SLU7, hypothetical start
          Length = 318

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 60/279 (21%), Positives = 87/279 (31%), Gaps = 77/279 (27%)

Query: 4   NKHIPKYIRDKPWYVESGDDDA-------DYLGHHRREPGEGAQDFSVAQQGSV---ISD 53
           N+HIP YI++ PWY +  D ++       DYL HHR+   +   D     Q  +   I D
Sbjct: 20  NEHIPNYIKNLPWYYQDIDKNSKNNSKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKD 79

Query: 54  RFVXXXXXXXXXXXXXCTNCGANHDRRDCLLRPRKQARGDGGERAFQVRDENALSFEAKR 113
            F                           ++   K+   DG       R ++   ++A++
Sbjct: 80  EF--------------------------EVIVENKKTTIDG----IIKRRKDEKDWDARK 109

Query: 114 DRWYGFEGXX--------XXXXXXXXXXXXXXXXXXXXXXXRYKLGLDXXXXXXXXXXXX 165
           DRWYG+ G                                   KLGL             
Sbjct: 110 DRWYGYSGKEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKDLEQNIKGSS 169

Query: 166 XXXXHDRARYLDDVRGEETRYDPKSRVYXXX----------------------------- 196
                D+A YL D+    T YDPKSR+Y                                
Sbjct: 170 VRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTGEGKELNDLNKF 229

Query: 197 XXXXXXXXXXXXXXXXXSTVDHVISANPTRLELGRQTPE 235
                              V+HV+ ANPT+LE+ R+  E
Sbjct: 230 ARENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQKE 268

>KLLA0F14531g 1349155..1350180 weakly similar to sp|Q02775
           Saccharomyces cerevisiae YDR088c SLU7 pre-mRNA splicing
           factor affecting 3 splice site choice singleton,
           hypothetical start
          Length = 341

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 77/234 (32%), Gaps = 73/234 (31%)

Query: 3   ENKHIPKYIRDKPWYVESGDD--------------------------DADYLGHHRREPG 36
           +N+HIP +I++KPWY+    +                          + DYL HHR    
Sbjct: 21  QNEHIPNFIKNKPWYLAEESEVSASTSAINSNSTISGTGTGTGTELEEKDYLSHHR---- 76

Query: 37  EGAQDFSVAQQGSV-ISDRFVXXXXXXXXXXXXXCTNCGANHDRRDC----LLRPRKQAR 91
              +  SV   G+  I D F                  G N  ++D     L  P ++  
Sbjct: 77  --LKKSSVPDSGTAEIDDAFTY------------VRPSGRNRKKKDSYDLDLDAPVRR-- 120

Query: 92  GDGGERAFQVRDENAL--SFEAKRDRWYGFEGXXXXXXXXXXXXXXXXXXXXXXXXXRYK 149
                     RDE  +  +++AKRDRWYG+                             +
Sbjct: 121 ----------RDEKVIESNYDAKRDRWYGYTPDIKEIERNHKGPDTSHREMDEVQIQEME 170

Query: 150 --------LGLDXXXXXX--XXXXXXXXXXHDRARYLDDVRGEETRYDPKSRVY 193
                   +G D                   D+A YL D+  EE  YDPKSR+Y
Sbjct: 171 RLGLKPEDVGFDATQPLSGPKEKYNPVRLREDKAAYLQDMSSEEMLYDPKSRIY 224

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,820,237
Number of extensions: 166884
Number of successful extensions: 291
Number of sequences better than 10.0: 6
Number of HSP's gapped: 279
Number of HSP's successfully gapped: 12
Length of query: 261
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 161
Effective length of database: 13,134,309
Effective search space: 2114623749
Effective search space used: 2114623749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)