Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR158C26726213220.0
Kwal_56.234052802628151e-110
YDR087C (RRP1)2782627167e-95
Scas_636.102882567063e-93
CAGL0M11110g2702516897e-91
KLLA0C11979g2612426861e-90
Sklu_1568.32202016422e-84
Sklu_2261.663362662.4
YDR325W (YCG1)1035129644.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR158C
         (262 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH] (1043874..1...   513   0.0  
Kwal_56.23405                                                         318   e-110
YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein inv...   280   7e-95
Scas_636.10                                                           276   3e-93
CAGL0M11110g complement(1095317..1096129) similar to sp|P35178 S...   270   7e-91
KLLA0C11979g complement(1027919..1028704) similar to sp|P35178 S...   268   1e-90
Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement        251   2e-84
Sklu_2261.6 YMR032W, Contig c2261 11239-13140                          30   2.4  
YDR325W (YCG1) [1155] chr4 (1117117..1120224) Subunit of condens...    29   4.3  

>AGR158C [4469] [Homologous to ScYDR087C (RRP1) - SH]
           (1043874..1044677) [804 bp, 267 aa]
          Length = 267

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/262 (98%), Positives = 257/262 (98%)

Query: 1   MTGVQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSD 60
           MTGVQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSD
Sbjct: 1   MTGVQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSD 60

Query: 61  RPRPQQRLAAQLGELSLLFLDGDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKYLLL 120
           RPRPQQRLAAQLGELSLLFLDGDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKYLLL
Sbjct: 61  RPRPQQRLAAQLGELSLLFLDGDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKYLLL 120

Query: 121 VRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEWERL 180
           VRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEWERL
Sbjct: 121 VRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEWERL 180

Query: 181 VLRDGRDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLLADQ 240
           VLRDGRDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLLADQ
Sbjct: 181 VLRDGRDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLLADQ 240

Query: 241 RLYDWGVLARDSPESXXXXXVE 262
           RLYDWGVLARDSPES     VE
Sbjct: 241 RLYDWGVLARDSPESDDDDDVE 262

>Kwal_56.23405
          Length = 280

 Score =  318 bits (815), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 152/262 (58%), Positives = 197/262 (75%), Gaps = 17/262 (6%)

Query: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63
           +++S FV+QLASN+R+VRE+AL+SL+ YL ++Q ++  Q  FD+LWKGLY+AMWFSDRPR
Sbjct: 1   MESSAFVKQLASNTRTVREEALDSLKKYLTTKQFKENKQASFDKLWKGLYYAMWFSDRPR 60

Query: 64  PQQRLAAQLGELSLLFLD--------GDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLD 115
           PQQRLA  LGEL +L+ D        G+  L DRAF++FSKAFW+V+CLEWY IDHHRLD
Sbjct: 61  PQQRLANSLGELHVLYFDKADNQKSNGELTLNDRAFLKFSKAFWRVICLEWYGIDHHRLD 120

Query: 116 KYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVD 175
           KYLLLVRRVL +QLR+L+ R WD  +V  Y+  VL+ LPLSG  KVYNGIPFHIIDIFVD
Sbjct: 121 KYLLLVRRVLAHQLRYLQLREWDEEVVSNYIRAVLRKLPLSGDKKVYNGIPFHIIDIFVD 180

Query: 176 EWERLVLRDG---------RDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIK 226
           EWE+L+L +G         +  ++ +  +L E+   IA TPL +FV +F+ LA+NI NIK
Sbjct: 181 EWEKLILHNGEDEDEEDDEKTNQEDEEAKLQEECARIAETPLAQFVEIFEDLASNINNIK 240

Query: 227 ILREKIKQDLLADQRLYDWGVL 248
            LR+KIK+D+  D+RL  WGVL
Sbjct: 241 SLRDKIKEDIFKDERLKKWGVL 262

>YDR087C (RRP1) [939] chr4 complement(617464..618300) Protein
           involved in maturation of 25S rRNA [837 bp, 278 aa]
          Length = 278

 Score =  280 bits (716), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 136/262 (51%), Positives = 191/262 (72%), Gaps = 11/262 (4%)

Query: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63
           ++TS FV+QL+SN+R  R  ALE+L+ YL ++Q ++  Q++F++LWKGLY+AMWFSDRPR
Sbjct: 1   METSNFVKQLSSNNRKTRVNALEALKKYLTAKQFKENKQIEFNKLWKGLYYAMWFSDRPR 60

Query: 64  PQQRLAAQLGELSLLFLD-------GDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDK 116
           PQQRLA +LGEL  L+ D        +    D+AF++FS+ FWKVMC EW+NID +RLDK
Sbjct: 61  PQQRLANELGELHGLYFDPKDNSTADELTTNDKAFIKFSRGFWKVMCFEWFNIDRYRLDK 120

Query: 117 YLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDE 176
           YLLL+RRVL++QL++L+ R WD  LV+ Y+ KVL+ LPLSGSPKVY GIP HI+DI +DE
Sbjct: 121 YLLLIRRVLFSQLKYLQSRNWDKKLVDEYIKKVLRWLPLSGSPKVYTGIPIHIVDILLDE 180

Query: 177 WERLVLRDGRDAEDADMPELPEQRDLIAA---TPLPRFVAVFQGLAANIANIKILREKIK 233
           WERL L+DG + ++ +  +  E R +  +   TPL   +A+FQ + A+  N K+LREKIK
Sbjct: 181 WERL-LKDGDEDDEDEENKEEEMRKIAESAKKTPLADVIAIFQDIVADYNNSKVLREKIK 239

Query: 234 QDLLADQRLYDWGVLARDSPES 255
           +DL +D RL  W +L  ++  +
Sbjct: 240 EDLFSDTRLVSWDILEGETQHN 261

>Scas_636.10
          Length = 288

 Score =  276 bits (706), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 137/256 (53%), Positives = 183/256 (71%), Gaps = 11/256 (4%)

Query: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63
           + TS FV+QL+SN+R VRE++LE+L  +L S++     Q QF++LWKGLYFAMWFSDRPR
Sbjct: 1   MDTSTFVKQLSSNNRVVREKSLEALEKFLVSKKCLSFKQSQFNKLWKGLYFAMWFSDRPR 60

Query: 64  PQQRLAAQLGELSLLFLD--------GDTAL--GDRAFVRFSKAFWKVMCLEWYNIDHHR 113
           PQQRLA +LG+L  L+ +         +T L   D+AF++FSKAFWK++CLEWY+ID  R
Sbjct: 61  PQQRLANKLGQLYGLYFNEKDNENQENETRLSDNDKAFIKFSKAFWKILCLEWYSIDRFR 120

Query: 114 LDKYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIF 173
           +DKYLLL RRV +NQL++L+ R W+A LVE+Y   VL  LPLSG  KVY+GIPFHIIDI 
Sbjct: 121 MDKYLLLTRRVFFNQLKYLQSRNWNAKLVEQYCQGVLVDLPLSGDAKVYSGIPFHIIDIL 180

Query: 174 VDEWERLVLRDGRDAEDADMPELPEQRDL-IAATPLPRFVAVFQGLAANIANIKILREKI 232
           +DEWERL+     + +D +         + +  TPL  F+ +F GL +N+ N KILR KI
Sbjct: 181 LDEWERLLTDKDDEHDDEEKETDEVDIVIAVKETPLNNFIKIFYGLVSNVNNSKILRTKI 240

Query: 233 KQDLLADQRLYDWGVL 248
           K+DLLAD RL +WG++
Sbjct: 241 KEDLLADPRLIEWGII 256

>CAGL0M11110g complement(1095317..1096129) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs, start
           by similarity
          Length = 270

 Score =  270 bits (689), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 181/251 (72%), Gaps = 7/251 (2%)

Query: 4   VQTSPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPR 63
           ++TS FV+QLASN+R VRE+ALE+L  ++ S Q +K+ Q+QFD+LWKGLY+AMWF DRPR
Sbjct: 1   METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDKLWKGLYYAMWFCDRPR 60

Query: 64  PQQRLAAQLGELSLLFLDG------DTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKY 117
           PQQRLA+ LG L + F D       +  + D+AFVRFSKAFW++MCLEW  ID  RLDKY
Sbjct: 61  PQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFWRIMCLEWLGIDRFRLDKY 120

Query: 118 LLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEW 177
           LLL+RR L+NQ ++L+ R W A LV +Y+ +VL  +PLSG PKVYNGIP H++DI +DEW
Sbjct: 121 LLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSGDPKVYNGIPIHVMDIMLDEW 180

Query: 178 ERLVLRDGRDAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLL 237
           ERL L D  +  + D       ++ ++ +PL + + + + L  N  N KILR+KIK+++L
Sbjct: 181 ERLALEDEEEELEEDKKLEI-MKEFVSGSPLDQVLDILRNLLKNYDNSKILRDKIKKEVL 239

Query: 238 ADQRLYDWGVL 248
            D+RL  WG++
Sbjct: 240 TDKRLAQWGIV 250

>KLLA0C11979g complement(1027919..1028704) similar to sp|P35178
           Saccharomyces cerevisiae YDR087c RRP1 involved in
           processing rRNA precursor species to mature rRNAs
           singleton, start by similarity
          Length = 261

 Score =  268 bits (686), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 177/242 (73%), Gaps = 3/242 (1%)

Query: 7   SPFVRQLASNSRSVREQALESLRSYLASQQLRKAPQLQFDQLWKGLYFAMWFSDRPRPQQ 66
           +  V+QLA + +  REQA ESLR YL ++  + A Q QFD+LWKGLY++MW  D+P PQQ
Sbjct: 3   NTLVKQLAGHRKETREQAFESLRKYLTTRNFQNAKQSQFDKLWKGLYYSMWHCDKPIPQQ 62

Query: 67  RLAAQLGELSLLFLDGDTALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKYLLLVRRVLY 126
            LA  LGEL LL+L G      +AF+RFSKAFWKV+C+EWY IDHHRLDK+LLL+RR L+
Sbjct: 63  SLAYSLGELHLLYLKGK---NQQAFIRFSKAFWKVICIEWYRIDHHRLDKFLLLIRRCLH 119

Query: 127 NQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHIIDIFVDEWERLVLRDGR 186
            Q+++L E  W+ ALV+ Y+ KVL+ +PLSG  KVYNGIPFHIIDI +DEW ++   +  
Sbjct: 120 FQIKYLHECEWEQALVDDYINKVLKKIPLSGDRKVYNGIPFHIIDILLDEWVKVCYGEEE 179

Query: 187 DAEDADMPELPEQRDLIAATPLPRFVAVFQGLAANIANIKILREKIKQDLLADQRLYDWG 246
           D ED +  +  E ++ ++ TPL  F+++FQ L+++  NIKILR+KIK+DLL DQRL  W 
Sbjct: 180 DEEDNEDDKEEEIKEAVSKTPLSDFISIFQELSSDTNNIKILRDKIKEDLLKDQRLRAWD 239

Query: 247 VL 248
           VL
Sbjct: 240 VL 241

>Sklu_1568.3 YDR087C, Contig c1568 3651-4313 reverse complement
          Length = 220

 Score =  251 bits (642), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 155/201 (77%), Gaps = 6/201 (2%)

Query: 56  MWFSDRPRPQQRLAAQLGELSLLFLDG-----DTALGDRAFVRFSKAFWKVMCLEWYNID 110
           MWFSDRPRPQ RL  +LGEL LLF        +  L D+AF++F+  FWKV+CLEWY+ID
Sbjct: 1   MWFSDRPRPQHRLGNELGELHLLFFAAVENKQEITLVDKAFIKFTNGFWKVICLEWYSID 60

Query: 111 HHRLDKYLLLVRRVLYNQLRFLRERGWDAALVERYVAKVLQGLPLSGSPKVYNGIPFHII 170
           HHRLDKY+LLVRRVL+NQL++L+ R W+  LV +Y+  VL+ LPLSG  KVYNGIPFHII
Sbjct: 61  HHRLDKYILLVRRVLFNQLKYLKLRNWNEELVLKYIDSVLKKLPLSGDKKVYNGIPFHII 120

Query: 171 DIFVDEWERLVLRDGRDAEDADMPELPEQ-RDLIAATPLPRFVAVFQGLAANIANIKILR 229
           DIFVDEWE+LV+RDG D  +    +  E+ + LIAATPL  FV +FQ L++NI NIK+LR
Sbjct: 121 DIFVDEWEKLVIRDGEDEGEDGEEKDSEECKQLIAATPLSLFVEIFQDLSSNIENIKVLR 180

Query: 230 EKIKQDLLADQRLYDWGVLAR 250
           EKIK+D+L DQRL+ WG+L +
Sbjct: 181 EKIKEDILGDQRLHLWGILTQ 201

>Sklu_2261.6 YMR032W, Contig c2261 11239-13140
          Length = 633

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 84  TALGDRAFVRFSKAFWKVMCLEWYNIDHHRLDKYLLLVRRVLYNQLRFLRERGWDAALVE 143
           T  G    ++++KA +  M     N+ + R+D Y+LL +R+  NQ  +L E      + +
Sbjct: 560 TVSGGEKVIKYAKALYTYMEPNENNLVNFRVDDYILLTKRL--NQDWYLGEVYNAGGIED 617

Query: 144 RY 145
           RY
Sbjct: 618 RY 619

>YDR325W (YCG1) [1155] chr4 (1117117..1120224) Subunit of condensin
           protein complex required for proper chromosome
           condensation and segregation [3108 bp, 1035 aa]
          Length = 1035

 Score = 29.3 bits (64), Expect = 4.3,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 59/129 (45%), Gaps = 22/129 (17%)

Query: 127 NQLRFLRERGWDAALVERYV--AKVLQGLPLSGSPKVYNGIPFHIIDIFVDEW------- 177
           N   ++ ER  D  +V R +  +++L+ +      K ++ I  HI D  + EW       
Sbjct: 235 NTRPYILERARDVNIVNRRLVYSRILKSM----GRKCFDDIEPHIFDQLI-EWGLEDREL 289

Query: 178 ------ERLVLRDGRDAEDADMPELPEQRDLIAATPLPRFV-AVFQGLAANIANIKILRE 230
                 +RL+  D  +A D D+ EL E+ D+  ++   + + A+FQ     ++ IK   E
Sbjct: 290 SVRNACKRLIAHDWLNALDGDLIELLEKLDVSRSSVCVKAIEALFQSRPDILSKIK-FPE 348

Query: 231 KIKQDLLAD 239
            I +D   +
Sbjct: 349 SIWKDFTVE 357

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,862,824
Number of extensions: 318063
Number of successful extensions: 939
Number of sequences better than 10.0: 11
Number of HSP's gapped: 928
Number of HSP's successfully gapped: 11
Length of query: 262
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 162
Effective length of database: 13,134,309
Effective search space: 2127758058
Effective search space used: 2127758058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 60 (27.7 bits)