Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR157C70693554e-46
Sklu_1568.270692833e-35
Kwal_56.23403111692771e-33
Scas_636.9*72672573e-31
KLLA0C11957g70692513e-30
YDR086C (SSS1)80672514e-30
Scas_688.552836610.42
AFR005C71331571.7
Scas_718.28101339543.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR157C
         (69 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH] (1043498..1...   141   4e-46
Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement        113   3e-35
Kwal_56.23403                                                         111   1e-33
Scas_636.9*                                                           103   3e-31
KLLA0C11957g complement(1027449..1027661) similar to sp|P35179 S...   101   3e-30
YDR086C (SSS1) [938] chr4 complement(616922..617164) Component o...   101   4e-30
Scas_688.5                                                             28   0.42 
AFR005C [3197] [Homologous to NOHBY] (445053..447194) [2142 bp, ...    27   1.7  
Scas_718.28                                                            25   3.8  

>AGR157C [4468] [Homologous to ScYDR086C (SSS1) - SH]
          (1043498..1043710) [213 bp, 70 aa]
          Length = 70

 Score =  141 bits (355), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%)

Query: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60
          MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL
Sbjct: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60

Query: 61 IHIPIRHLI 69
          IHIPIRHLI
Sbjct: 61 IHIPIRHLI 69

>Sklu_1568.2 YDR086C, Contig c1568 3228-3440 reverse complement
          Length = 70

 Score =  113 bits (283), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 63/69 (91%)

Query: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60
          MAK NN +E+L++APLEF KDG+AF+ KC KPN +E+L+I+RAVGIGF+AVGVIGYAIKL
Sbjct: 1  MAKGNNQIEQLAEAPLEFVKDGSAFIQKCKKPNNKEYLKIVRAVGIGFVAVGVIGYAIKL 60

Query: 61 IHIPIRHLI 69
          +HIPIR+LI
Sbjct: 61 VHIPIRYLI 69

>Kwal_56.23403
          Length = 111

 Score =  111 bits (277), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 63/69 (91%)

Query: 1   MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60
           M+K+NN +EKL++AP+EF K+G+AF+ KC KP  ++FLQI+RAVGIGF+AVG+IGYAIKL
Sbjct: 42  MSKSNNQIEKLAEAPVEFVKEGSAFIQKCKKPTNKDFLQIVRAVGIGFVAVGIIGYAIKL 101

Query: 61  IHIPIRHLI 69
           +HIPIR+LI
Sbjct: 102 VHIPIRYLI 110

>Scas_636.9*
          Length = 72

 Score =  103 bits (257), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 59/67 (88%)

Query: 3  KNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKLIH 62
          K++N +EKL DAPLEF KDG  FL+KC KP+ +E+ +I+RAVGIGF+AVG+IGYAIKLIH
Sbjct: 5  KSDNQIEKLMDAPLEFVKDGNQFLNKCKKPDLKEYTRIVRAVGIGFVAVGIIGYAIKLIH 64

Query: 63 IPIRHLI 69
          IPIR++I
Sbjct: 65 IPIRYVI 71

>KLLA0C11957g complement(1027449..1027661) similar to sp|P35179
          Saccharomyces cerevisiae YDR086c SSS1 ER
          protein-translocase complex subunit singleton, start by
          similarity
          Length = 70

 Score =  101 bits (251), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 46/69 (66%), Positives = 57/69 (82%)

Query: 1  MAKNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKL 60
          MAK N   +KL + PLEF K+G  FL KC KP+++E+L+II+AVGIGF+AVGVIGY IKL
Sbjct: 1  MAKQNAQFDKLVETPLEFVKEGNQFLQKCKKPSKKEYLKIIQAVGIGFVAVGVIGYIIKL 60

Query: 61 IHIPIRHLI 69
          IHIPIR+LI
Sbjct: 61 IHIPIRYLI 69

>YDR086C (SSS1) [938] chr4 complement(616922..617164) Component of
          the Sec61p-Sss1p-Sbh1p complex and the
          Ssh1p-Sss1p-Sbh2p complex, involved in protein
          translocation into the endoplasmic reticulum [243 bp,
          80 aa]
          Length = 80

 Score =  101 bits (251), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 60/67 (89%)

Query: 3  KNNNNLEKLSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFLAVGVIGYAIKLIH 62
          ++NN +EKL +AP+EF ++GT FL+KC KP+ +E+ +I++AVGIGF+AVG+IGYAIKLIH
Sbjct: 13 QSNNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIH 72

Query: 63 IPIRHLI 69
          IPIR++I
Sbjct: 73 IPIRYVI 79

>Scas_688.5
          Length = 528

 Score = 28.1 bits (61), Expect = 0.42,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 14  APLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFL 49
           APLE  K  T+F+S     ++R FL ++R   +G L
Sbjct: 289 APLEITKKETSFMSSVFLSSKRPFLLLVRDPMMGVL 324

>AFR005C [3197] [Homologous to NOHBY] (445053..447194) [2142 bp, 713
           aa]
          Length = 713

 Score = 26.6 bits (57), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 3   KNNNNLEKLSDAPLEFFKDGTAFLSKCNKPN 33
           KN + L + + AP+E   D   +LS+C   N
Sbjct: 218 KNVDVLHRSASAPVELINDSDIYLSRCPTVN 248

>Scas_718.28
          Length = 1013

 Score = 25.4 bits (54), Expect = 3.8,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 11  LSDAPLEFFKDGTAFLSKCNKPNQREFLQIIRAVGIGFL 49
           + D+PL   K     LS CNK ++   LQ + A+   FL
Sbjct: 275 IQDSPLHNTKSLDTLLSYCNKKSRNSQLQSLNALKDLFL 313

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.144    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,332,802
Number of extensions: 74214
Number of successful extensions: 223
Number of sequences better than 10.0: 9
Number of HSP's gapped: 223
Number of HSP's successfully gapped: 9
Length of query: 69
Length of database: 16,596,109
Length adjustment: 42
Effective length of query: 27
Effective length of database: 15,142,153
Effective search space: 408838131
Effective search space used: 408838131
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)