Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR155C49548618390.0
KLLA0C11913g52941110591e-139
Kwal_56.2339053340910421e-137
Scas_576.0d48941510201e-134
CAGL0I08613g5594109911e-129
Kwal_55.221736591171032e-04
CAGL0K03157g724188910.006
YHL016C (DUR3)735188850.031
Kwal_26.8136721184760.30
ABR043W686115750.45
KLLA0F28083g69896730.79
Kwal_14.803693101647.9
KLLA0C17468g723180648.1
Scas_709.61738184648.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR155C
         (486 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp...   712   0.0  
KLLA0C11913g complement(1024233..1025822) similar to ca|CA4263|I...   412   e-139
Kwal_56.23390                                                         405   e-137
Scas_576.0d                                                           397   e-134
CAGL0I08613g complement(839912..841591) weakly similar to sp|P33...   386   e-129
Kwal_55.22173                                                          44   2e-04
CAGL0K03157g 290552..292726 highly similar to sp|P33413 Saccharo...    40   0.006
YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permeas...    37   0.031
Kwal_26.8136                                                           34   0.30 
ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH] complement(4...    33   0.45 
KLLA0F28083g complement(2594274..2596370) similar to ca|CA5245|C...    33   0.79 
Kwal_14.803                                                            29   7.9  
KLLA0C17468g complement(1532768..1534939) similar to sp|P33413 S...    29   8.1  
Scas_709.61                                                            29   8.7  

>AGR155C [4466] [Homologous to NOHBY] (1041283..1042770) [1488 bp,
           495 aa]
          Length = 495

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/486 (77%), Positives = 379/486 (77%)

Query: 1   MHSTLSPITRWLPRTEGDAWRPQQKLELPTTTVPLCFDSPATSIYIGSHPAHNQHHTDGT 60
           MHSTLSPITRWLPRTEGDAWRPQQKLELPTTTVPLCFDSPATSIYIGSHPAHNQHHTDGT
Sbjct: 1   MHSTLSPITRWLPRTEGDAWRPQQKLELPTTTVPLCFDSPATSIYIGSHPAHNQHHTDGT 60

Query: 61  EMGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLG 120
           EMGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLG
Sbjct: 61  EMGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLG 120

Query: 121 CGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGR 180
           CGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGR
Sbjct: 121 CGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGR 180

Query: 181 VAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHIS 240
           VAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIP        TTIYTAIGGFHIS
Sbjct: 181 VAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPVVVVQCVVTTIYTAIGGFHIS 240

Query: 241 FVTDSLQXXXXXXXXXXXXXXXXXSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTND 300
           FVTDSLQ                 SVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTND
Sbjct: 241 FVTDSLQATVVLLLVVVGAVAVGTSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTND 300

Query: 301 FFMSGFWLRTFAARSNRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPVXXXXXXXX 360
           FFMSGFWLRTFAARSNRD                              YAPV        
Sbjct: 301 FFMSGFWLRTFAARSNRDLLLGCSLAAVLLAVVLLLVGVTGLLAVWAGYAPVADLDSASF 360

Query: 361 XXXXXXXPAWANGXXXXXXXXXSTCTLDSFQSALVSTISNDLFRNRLPPLYXXXXXXXXX 420
                  PAWANG         STCTLDSFQSALVSTISNDLFRNRLPPLY         
Sbjct: 361 FLLLAALPAWANGVVLALVVVLSTCTLDSFQSALVSTISNDLFRNRLPPLYARAAVAVVM 420

Query: 421 XXXXXXGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELIXXXXXXXXXXXX 480
                 GLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELI            
Sbjct: 421 VPVVVVGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELIGGGLGGCSASSS 480

Query: 481 XAPSTT 486
            APSTT
Sbjct: 481 SAPSTT 486

>KLLA0C11913g complement(1024233..1025822) similar to
           ca|CA4263|IPF2277 Candida albicans unknown function,
           start by similarity
          Length = 529

 Score =  412 bits (1059), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 212/411 (51%), Positives = 264/411 (64%), Gaps = 4/411 (0%)

Query: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAY-RLRNV-RTFLSANGTQKAVPLALNFIASGL 119
           MG +S  AA+ IVWPTY VML  AS+LA+ +  +  +TFLSANGTQ+ VPLA NF+AS L
Sbjct: 1   MGSISEAAAHGIVWPTYIVMLVCASLLAFWKFSDKPKTFLSANGTQRGVPLAFNFVASAL 60

Query: 120 GCGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFG 179
           GCGVL AYPQ+AN+ GLQGLLVY L  +LPM++FAFFGP+I++ CPDGFVLTEWV+RRFG
Sbjct: 61  GCGVLSAYPQIANIDGLQGLLVYSLAGSLPMFIFAFFGPIIRKKCPDGFVLTEWVIRRFG 120

Query: 180 RVAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHI 239
            +   YLSACTI+T++LFMVSE+ SL+ A+++L+ IK +P        TTIYT+IGGFHI
Sbjct: 121 IICGWYLSACTIITIFLFMVSELASLKYAIESLTKIKALPVIIVECVVTTIYTSIGGFHI 180

Query: 240 SFVTDSLQXXXXXXXXXXXXXXXXXSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTN 299
           SF+TD++Q                  V ID + I  SGLL+ S LGWQLVYILTVAIFTN
Sbjct: 181 SFITDTIQVSIVFILLIIVSCAMGSYVHIDKSLIAESGLLKASTLGWQLVYILTVAIFTN 240

Query: 300 DFFMSGFWLRTFAARSNRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPVX--XXXX 357
           DFFMSGFWLRTFAAR+++D                              Y PV       
Sbjct: 241 DFFMSGFWLRTFAARTDKDLMIGCSIAAVILAVFVTVIGVTGMIAVWAGYMPVADQENSG 300

Query: 358 XXXXXXXXXXPAWANGXXXXXXXXXSTCTLDSFQSALVSTISNDLFRNRLPPLYXXXXXX 417
                     P W  G         STCTLDS QSALVSTISND+FRN+LP ++      
Sbjct: 301 AAFFIVLTQMPGWVIGFVLAFVVMLSTCTLDSLQSALVSTISNDIFRNKLPIIWIRGIVV 360

Query: 418 XXXXXXXXXGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELI 468
                    GL+A D+L IYLIVDLLS++VVP+++LG   +   L+AWE+I
Sbjct: 361 LIMVPVVVVGLIADDVLTIYLIVDLLSSSVVPILMLGLSSKFDFLTAWEII 411

>Kwal_56.23390
          Length = 533

 Score =  405 bits (1042), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 204/409 (49%), Positives = 258/409 (63%), Gaps = 2/409 (0%)

Query: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLGC 121
           MG LS  AA+ I+WP Y V+L  A  +AY  ++ +TFLSANGTQK VPLA NF+AS LG 
Sbjct: 1   MGHLSVPAAHGIIWPMYGVLLLTACAVAYWKKDAKTFLSANGTQKGVPLAFNFVASALGV 60

Query: 122 GVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRV 181
           GV   YPQ+AN++GL GLLVY L   LPM++FAFFGP+I++  P GFVLTEWV  R+G V
Sbjct: 61  GVFSTYPQIANISGLHGLLVYALAGGLPMFLFAFFGPIIRKKVPHGFVLTEWVFHRYGVV 120

Query: 182 AALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISF 241
             LYLSACTILTL+LFMVSE+ SL+  +++L++IK +P        TTIYT +GGFHISF
Sbjct: 121 GGLYLSACTILTLFLFMVSELASLKFCIESLTSIKALPVVIVECVITTIYTTVGGFHISF 180

Query: 242 VTDSLQXXXXXXXXXXXXXXXXXSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDF 301
           +TD++Q                  ++ID ++IGPSGLL+ ++LGWQLVYIL VAIFTNDF
Sbjct: 181 LTDTMQVSVVFVILVIVACAMGNYIEIDTSKIGPSGLLKQNKLGWQLVYILVVAIFTNDF 240

Query: 302 FMSGFWLRTFAARSNRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPVXXXXX--XX 359
           F+SGFWLRTFAAR+++D                                 V         
Sbjct: 241 FLSGFWLRTFAARTDKDLLIGCSLAFAVLVAIVALIGVTGFLAVWAGLVEVADQELGGSS 300

Query: 360 XXXXXXXXPAWANGXXXXXXXXXSTCTLDSFQSALVSTISNDLFRNRLPPLYXXXXXXXX 419
                   P+W  G         STCTLDS QSA+VSTISNDLFRN+LP +Y        
Sbjct: 301 FFILLTAMPSWVMGFVLAFITILSTCTLDSLQSAMVSTISNDLFRNKLPLIYVRGLVALI 360

Query: 420 XXXXXXXGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARLSAWELI 468
                  GL+A D+L+I+LIVDLLS+AVVPV++LG W R   LSAWE++
Sbjct: 361 MVPVVVVGLIAEDVLSIFLIVDLLSSAVVPVLMLGLWSRLFFLSAWEIV 409

>Scas_576.0d
          Length = 489

 Score =  397 bits (1020), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 207/415 (49%), Positives = 261/415 (62%), Gaps = 3/415 (0%)

Query: 56  HTDGTEMGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFI 115
           +T   +MG LS V ANAI+WPTY V+L  AS +AY  R+ ++FLS+NGTQKA+PLA NF+
Sbjct: 6   NTVKRKMGILSAVTANAIIWPTYMVLLISASAIAYWKRDSKSFLSSNGTQKALPLAFNFV 65

Query: 116 ASGLGCGVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVL 175
           ASGLGCGVL AYPQ+AN+ GL GLLVY ++  LPM+VFA+ GPLI++  P GFVLTEWV 
Sbjct: 66  ASGLGCGVLSAYPQIANIDGLHGLLVYAISGGLPMFVFAWLGPLIRKKTPKGFVLTEWVF 125

Query: 176 RRFGRVAALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIG 235
            RFG +   YLSACTILT+YLF+VSE+ SL+  ++ ++ IK +P        TTIYT+IG
Sbjct: 126 HRFGLICGWYLSACTILTVYLFLVSEVASLKYCIETMTTIKALPVIIIECVVTTIYTSIG 185

Query: 236 GFHISFVTDSLQXXXXXXXXXXXXXXXXXSVKIDPARIGPSGLLRPSRLGWQLVYILTVA 295
           GF+ISF+TD LQ                  ++ID + IGPSGLL+ ++LGWQLVYILT A
Sbjct: 186 GFNISFITDFLQVSTVFVLLIIVACAMGSYIEIDRSLIGPSGLLKQNKLGWQLVYILTFA 245

Query: 296 IFTNDFFMSGFWLRTFAARSNRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPVX-- 353
           IFTNDFFMSGFWLRTFA+RS++D                                 V   
Sbjct: 246 IFTNDFFMSGFWLRTFASRSDKDLMIGCSVACVILVVFCTVVGVTGFIAVWAGLVQVADE 305

Query: 354 XXXXXXXXXXXXXXPAWANGXXXXXXXXXSTCTLDSFQSALVSTISNDLFRNRLPPLYXX 413
                         P W  G         STCTLDS QSALVSTISND+FRNRL  ++  
Sbjct: 306 ENSGAAFFILLAQLPTWVMGFTMVFVTVLSTCTLDSLQSALVSTISNDVFRNRLHIMWVR 365

Query: 414 XXXXXXXXXXXXXGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARL-SAWEL 467
                        GL+A ++L IYLIVDLLS++VVPV++LGFW +   L +AWE+
Sbjct: 366 GIVVLIMVPVVVVGLIAENVLNIYLIVDLLSSSVVPVLVLGFWSKFDDLWTAWEV 420

>CAGL0I08613g complement(839912..841591) weakly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3, hypothetical
           start
          Length = 559

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 213/410 (51%), Positives = 258/410 (62%), Gaps = 3/410 (0%)

Query: 62  MGKLSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLGC 121
           MG LS  AA+AI+WPTY V+L  AS++AY  R+ +TFLSANGTQKA+PLA NF+ASGLGC
Sbjct: 1   MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQKAIPLAFNFVASGLGC 60

Query: 122 GVLLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRV 181
           GVL  YPQ+AN+ GL GLLVY L   LPM+VFAF GPLI++  P GFVLTEWV  RFG +
Sbjct: 61  GVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKKTPSGFVLTEWVFHRFGLL 120

Query: 182 AALYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISF 241
              YLSACTILT+YLF+VSE+ SL+ A+  L+NI  +P        TTIYT+IGGFHISF
Sbjct: 121 CGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVIIIECVVTTIYTSIGGFHISF 180

Query: 242 VTDSLQXXXXXXXXXXXXXXXXXSVKIDPARIGPSGLLRPSRLGWQLVYILTVAIFTNDF 301
           +TDSLQ                  + ID   IGPSGLL+ ++LGWQLVYILTVAIFTNDF
Sbjct: 181 MTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLLKGNKLGWQLVYILTVAIFTNDF 240

Query: 302 FMSGFWLRTFAARSNRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAPV--XXXXXXX 359
           FMSGFWLRTFA+RSN+D                                P          
Sbjct: 241 FMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVVGVTGFIAVWAGLLPARDQENSGAA 300

Query: 360 XXXXXXXXPAWANGXXXXXXXXXSTCTLDSFQSALVSTISNDLFRNRLPPLYXXXXXXXX 419
                   P+W  G         STCTLDS QSALVSTISND+FRN+L  +         
Sbjct: 301 FYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSALVSTISNDVFRNKLHIMLVRGIVVAI 360

Query: 420 XXXXXXXGLLATDILAIYLIVDLLSAAVVPVMLLGFWPRAARL-SAWELI 468
                  GL+A D+L+IYLIVDLLS++VVPV+++G W +   + SAWE+I
Sbjct: 361 MVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVLVVGLWGKLDEIWSAWEVI 410

>Kwal_55.22173
          Length = 659

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 131 ANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVA-ALYLSAC 189
           A + G+ G  +Y +   + + +FAF    IKQ  P    ++E +  RFG+    +YL  C
Sbjct: 79  AYLHGISGAWLYAVGGTIQITLFAFLALQIKQRAPSAHTVSEMLYVRFGKSGHIMYLCYC 138

Query: 190 TILTLYLFMVSEIVSL--RLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISFVTD 244
               +   MVS ++ L    A  A + +  +           +YTA+GG   +F++D
Sbjct: 139 AATNV---MVSSLLLLGGSQAFAAATGMHTVAASFLLPLNVVVYTALGGLKATFISD 192

>CAGL0K03157g 290552..292726 highly similar to sp|P33413
           Saccharomyces cerevisiae YHL016c Urea active
           transporter, start by similarity
          Length = 724

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 71/188 (37%), Gaps = 23/188 (12%)

Query: 78  YAVMLAVASVLA-------YRLR-------NVRTFLSANGTQKAVPLALNFIASGLGCGV 123
           YA++L + +V A       Y LR           F +A  T K   +A   ++S + C  
Sbjct: 14  YAIVLGLGTVFAVGMILTTYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWCST 73

Query: 124 LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 183
           LL       + G+ G   Y   +   +  FA      KQ  P+     E V +R+G++  
Sbjct: 74  LLTSAS-KQLDGMLGGYSYSAGACFQIVAFAILAIKTKQKAPNAHTYLELVRKRYGKIGH 132

Query: 184 ----LYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHI 239
                Y  A  IL   + + S         ++++ +  +           IYT  GG   
Sbjct: 133 CCYLFYAFATNILVTAMLLTSGAAVF----ESMTGMNSVASCFLLPVGVVIYTLFGGIKA 188

Query: 240 SFVTDSLQ 247
           +F+TD + 
Sbjct: 189 TFLTDFIH 196

>YHL016C (DUR3) [2270] chr8 complement(72033..74240) Urea permease,
           member of the solute:sodium symporter (SSS) family of
           membrane transporters [2208 bp, 735 aa]
          Length = 735

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 67/188 (35%), Gaps = 22/188 (11%)

Query: 78  YAVMLAVASVLA-------YRLR-------NVRTFLSANGTQKAVPLALNFIASGLGCGV 123
           YA++L + +V A       Y L+           F +A  + K   +A   ++S + C  
Sbjct: 14  YAIVLGLGAVFAGMMVLTTYLLKRYQKEIITAEEFTTAGRSVKTGLVAAAVVSSWIWCST 73

Query: 124 LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 183
           LL         G+ G   Y   +   +  FA      KQ  P+     E V  R+G++  
Sbjct: 74  LLTSSTKEYADGIFGGYAYAAGACFQIIAFAILAIKTKQMAPNAHTYLELVRTRYGKIGH 133

Query: 184 ----LYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHI 239
                Y  A  IL   + + S           L+ +  I           +YT  GG   
Sbjct: 134 GCYLFYAIATNILVTSMLLTSG----SAVFSDLTGMNTIASCFLLPVGVVVYTLFGGIKA 189

Query: 240 SFVTDSLQ 247
           +F+TD + 
Sbjct: 190 TFLTDYMH 197

>Kwal_26.8136
          Length = 721

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 64/184 (34%), Gaps = 14/184 (7%)

Query: 78  YAVMLAVASVLA-------YRLR-------NVRTFLSANGTQKAVPLALNFIASGLGCGV 123
           YAV++ +  V A       Y LR           F +A  T K   +A   ++S      
Sbjct: 14  YAVVVGLGFVFAFGMILTTYMLRRYQKEIITAEEFATAGRTVKTGLIAAAVVSSWTWAAT 73

Query: 124 LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 183
           LL    M    G+ G   Y   +   +  FA      KQ  P+     E +  R+G+ A 
Sbjct: 74  LLESTSMVYKVGISGGYYYGAGACFQIIAFATLAIKAKQRAPNAHTFLEIINARYGKAAH 133

Query: 184 LYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISFVT 243
           +      + T  L     +      V  L+ +  +           IYT  GG   +F+T
Sbjct: 134 ICYMFYALATNILVTAMLLTGGSAVVNDLTGMDTVAACFLLPLGVIIYTLFGGIKATFLT 193

Query: 244 DSLQ 247
           D + 
Sbjct: 194 DYVH 197

>ABR043W [634] [Homologous to ScYHL016C (DUR3) - SH]
           complement(474297..476357) [2061 bp, 686 aa]
          Length = 686

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 43/115 (37%)

Query: 130 MANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAALYLSAC 189
           MA   G+ G   Y   + + + +F+      KQ  P+     E +  R+GR A +     
Sbjct: 80  MAYKVGVSGPFYYAAGACVQIILFSTLAIKCKQRAPNAHTFLEIIKARYGRKAHILHMCY 139

Query: 190 TILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISFVTD 244
            ++T  L     +      V  L+ +              IYT  GG   +F+TD
Sbjct: 140 ALVTNVLVTTMLLTGGSAVVSELTGMHTAAACFLLPVGVIIYTLFGGIKATFLTD 194

>KLLA0F28083g complement(2594274..2596370) similar to
           ca|CA5245|CaDUR32 Candida albicans Urea transport
           protein (by homology), start by similarity
          Length = 698

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 42/96 (43%), Gaps = 3/96 (3%)

Query: 154 AFFGPLIKQTCPDGFVLTEWVLRRFGRVAA-LYLSACTILTLYLFMVSEIVSLRLAVQAL 212
           A  G   K+  P+G    E V  R+G+ A  LY+  C +  L L   S I+    A+  +
Sbjct: 109 ALLGIQAKKKIPNGHTCLEIVELRYGKSAHILYMFMCLVNNL-LSSSSMILGSAAAISII 167

Query: 213 S-NIKPIPXXXXXXXXTTIYTAIGGFHISFVTDSLQ 247
           S N+  +            YT +GG   +F+TD + 
Sbjct: 168 SGNLHIVASTMLIPFGVMCYTVVGGLKATFLTDYMH 203

>Kwal_14.803
          Length = 693

 Score = 29.3 bits (64), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 15/101 (14%)

Query: 152 VFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAALYLSACTILTLYLFMVSEIVSLRLAVQA 211
           V A  G   K+  P G    E V  R+G+       +  IL ++L +V+ ++S    + A
Sbjct: 107 VMALLGIHAKKKIPKGHTCLEIVHLRYGK-------STHILYMFLCLVNNLLSTSAMILA 159

Query: 212 LSNIKPIPXXXXXXXXTTI--------YTAIGGFHISFVTD 244
            +    I         +T+        YT +GG   +F+TD
Sbjct: 160 AAGAISIICGDLHIVASTMLIPFGVMAYTVVGGLKATFLTD 200

>KLLA0C17468g complement(1532768..1534939) similar to sp|P33413
           Saccharomyces cerevisiae YHL016c DUR3 urea transport
           protein singleton, start by similarity
          Length = 723

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 35/180 (19%), Positives = 63/180 (35%), Gaps = 5/180 (2%)

Query: 65  LSYVAANAIVWPTYAVMLAVASVLAYRLRNVRTFLSANGTQKAVPLALNFIASGLGCGVL 124
           L +V A A++  TY +      ++         F +A  + K   +A   ++S      L
Sbjct: 20  LGFVFAFAMILTTYVLRRYQKEII-----TAEEFATAGRSVKTGLIAAAVVSSWTWAATL 74

Query: 125 LAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAAL 184
           L    M    G+ G   Y   +   + +F+      KQ  P+     E +  R+G +   
Sbjct: 75  LQSTTMVYKVGISGGYFYAAGAGYQVILFSALAIKCKQRAPNAHTYLEIIKARYGTIGHF 134

Query: 185 YLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISFVTD 244
                 + T  L     +      V  L+ +  +           +YT  GG   +F+TD
Sbjct: 135 CYMFYALATNVLVTAMLLTGGSAVVSDLTGMHTVAACFLLPVGVVLYTIFGGIKATFLTD 194

>Scas_709.61
          Length = 738

 Score = 29.3 bits (64), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 64/184 (34%), Gaps = 14/184 (7%)

Query: 78  YAVMLAVASVLA-------YRLR-------NVRTFLSANGTQKAVPLALNFIASGLGCGV 123
           YA++L + +V A       Y LR           F +A  T K   +A   ++S +    
Sbjct: 14  YAIILGLGAVFAFGMVLITYMLRRYQKEIITAEEFTTAGRTVKTGLVAAAVVSSWIWAST 73

Query: 124 LLAYPQMANVAGLQGLLVYVLTSALPMYVFAFFGPLIKQTCPDGFVLTEWVLRRFGRVAA 183
           LL         G+ G   Y   +   +  FA      KQ  P+     E V  R+G    
Sbjct: 74  LLTSVSKQYTGGMFGGYSYSAGACFQIIAFAIIAIKTKQKAPNAHTYLEIVKARYGTPGH 133

Query: 184 LYLSACTILTLYLFMVSEIVSLRLAVQALSNIKPIPXXXXXXXXTTIYTAIGGFHISFVT 243
           L      + T  L     + S       ++ + PI           +YT  GG   +F+T
Sbjct: 134 LTFLFYALATNILVTAMLLTSGSAVFSDITGMSPIASCFLLPVGVVVYTLFGGIKATFLT 193

Query: 244 DSLQ 247
           D L 
Sbjct: 194 DYLH 197

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,590,013
Number of extensions: 344501
Number of successful extensions: 886
Number of sequences better than 10.0: 17
Number of HSP's gapped: 881
Number of HSP's successfully gapped: 21
Length of query: 486
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 380
Effective length of database: 12,926,601
Effective search space: 4912108380
Effective search space used: 4912108380
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)