Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR154C62861625970.0
Kwal_56.233806553612425e-21
KLLA0C11891g6172651952e-15
YDR085C (AFR1)6202751159e-06
Scas_459.1*648281061e-04
YER158C573781042e-04
CAGL0I08591g51729870.021
Scas_636.8d43364840.040
Sklu_2422.585267770.30
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR154C
         (616 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -...  1004   0.0  
Kwal_56.23380                                                          98   5e-21
KLLA0C11891g complement(1021360..1023213) some similarities with...    80   2e-15
YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein inv...    49   9e-06
Scas_459.1*                                                            45   1e-04
YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein...    45   2e-04
CAGL0I08591g complement(837496..839049) some similarities with s...    38   0.021
Scas_636.8d                                                            37   0.040
Sklu_2422.5 YNL233W, Contig c2422 10639-13197                          34   0.30 

>AGR154C [4465] [Homologous to ScYER158C - SH; ScYDR085C (AFR1) -
           SH] (1038731..1040617) [1887 bp, 628 aa]
          Length = 628

 Score = 1004 bits (2597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/616 (81%), Positives = 502/616 (81%)

Query: 1   MSQLKDGAAGPHGQGPVYHIPRSQSTGDLFLIPELDXXXXXXXXXGAHSMSSVSLQERAR 60
           MSQLKDGAAGPHGQGPVYHIPRSQSTGDLFLIPELD         GAHSMSSVSLQERAR
Sbjct: 1   MSQLKDGAAGPHGQGPVYHIPRSQSTGDLFLIPELDQERERRRRQGAHSMSSVSLQERAR 60

Query: 61  APTAYQRLRTQMKQSFQFPNGESFTPRAQLRPGGERAHSLCGARPEAAAWPRRSASLQKP 120
           APTAYQRLRTQMKQSFQFPNGESFTPRAQLRPGGERAHSLCGARPEAAAWPRRSASLQKP
Sbjct: 61  APTAYQRLRTQMKQSFQFPNGESFTPRAQLRPGGERAHSLCGARPEAAAWPRRSASLQKP 120

Query: 121 XXXXXXXXXXXXESLVRRPPGDASQEHXXXXXXXXXXXXXXXCHVTKSQSCTSIKXXXXX 180
                       ESLVRRPPGDASQEH               CHVTKSQSCTSIK     
Sbjct: 121 AGRGYAAKAASAESLVRRPPGDASQEHASPGRAAAPAALPAACHVTKSQSCTSIKTLSNP 180

Query: 181 XXXXXXXXXXXXXLIRENASGSITSASEISQKTDGQRMDIPGLDADRKPFDTEQDYQACL 240
                        LIRENASGSITSASEISQKTDGQRMDIPGLDADRKPFDTEQDYQACL
Sbjct: 181 TTSSSSISQSSGSLIRENASGSITSASEISQKTDGQRMDIPGLDADRKPFDTEQDYQACL 240

Query: 241 TPVVSHHSGXXXXXXXXXXXXXXXXXXXXXKRANSRLGLFFKKLLPSIKRKPKQQSGLPS 300
           TPVVSHHSG                     KRANSRLGLFFKKLLPSIKRKPKQQSGLPS
Sbjct: 241 TPVVSHHSGSEQTPPTPTAAAEQASADASPKRANSRLGLFFKKLLPSIKRKPKQQSGLPS 300

Query: 301 TPTHSYASTADSMHRSPLTVGPEPFSQSYLDLTEENNDNSSLSSYEREPASLFDIDLVFD 360
           TPTHSYASTADSMHRSPLTVGPEPFSQSYLDLTEENNDNSSLSSYEREPASLFDIDLVFD
Sbjct: 301 TPTHSYASTADSMHRSPLTVGPEPFSQSYLDLTEENNDNSSLSSYEREPASLFDIDLVFD 360

Query: 361 TLLLKSDRHDEPKKDCKGLAKEESTKTKQCVVIKHDTPPAANRTSLTHELDYELIHEFSK 420
           TLLLKSDRHDEPKKDCKGLAKEESTKTKQCVVIKHDTPPAANRTSLTHELDYELIHEFSK
Sbjct: 361 TLLLKSDRHDEPKKDCKGLAKEESTKTKQCVVIKHDTPPAANRTSLTHELDYELIHEFSK 420

Query: 421 LGEYIRTGTEGQELGATXXXXXXXXXXTPPPRSNRRPVFRQPDVSQSFYHSNMTLSPDFA 480
           LGEYIRTGTEGQELGAT          TPPPRSNRRPVFRQPDVSQSFYHSNMTLSPDFA
Sbjct: 421 LGEYIRTGTEGQELGATLLSLSSFSNLTPPPRSNRRPVFRQPDVSQSFYHSNMTLSPDFA 480

Query: 481 KGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRXXXXXXXXXXXXXXLEFANXXXX 540
           KGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPR              LEFAN    
Sbjct: 481 KGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRQSSPSKSIISSQPSLEFANSSSS 540

Query: 541 XXXXXXXXXXXVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMTSAHGLPFVQ 600
                      VKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMTSAHGLPFVQ
Sbjct: 541 RSSSPLDSAKSVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMTSAHGLPFVQ 600

Query: 601 AVKWELNEYKRHEMMV 616
           AVKWELNEYKRHEMMV
Sbjct: 601 AVKWELNEYKRHEMMV 616

>Kwal_56.23380
          Length = 655

 Score = 97.8 bits (242), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 96/361 (26%), Positives = 167/361 (46%), Gaps = 81/361 (22%)

Query: 271 KRANSRLGLFFKKLLPSIKRKPKQQSGLPST-PTHSYA-------STADSMHRSPLTVGP 322
           +  +SR+G FF+KLLPS ++KP  Q+  P   P  S A       +TA++   + + + P
Sbjct: 349 RSTSSRIGSFFRKLLPSKRKKPVPQTPAPQVAPPPSKAVQKISSDNTANATSTTDM-LPP 407

Query: 323 EPFSQSYLDLTEENNDNSSLSSYEREPASLFDIDLVFDTLLLKSDRHDEPKKDCKGLAKE 382
            P   +  D   ++ ++      + +   L DIDLVFD+LLLK+D H   K     L+++
Sbjct: 408 SPTKSTSGDQFFDDIEDHENEDDDDDDDQLLDIDLVFDSLLLKND-HATLKPLRLPLSEK 466

Query: 383 ESTKTKQCVVIKHDTPPAANRTSLTHE--LDYELIHEFSKLGEYIRTGTEGQELGATXXX 440
           +ST   +    + ++      +  T E  +D +LI EFS+LG +I  G   Q+  +    
Sbjct: 467 DSTAKDE----RPESQALDQHSGTTDEGVIDQDLIREFSRLGSFITDGITHQQTAS---- 518

Query: 441 XXXXXXXTPPPRSNRRPVFRQPDVSQSFY-----HSNMTLSPDFAKGIRANDKLSAFQYK 495
                   PPPRS +RP     +    FY      +++ L PD                 
Sbjct: 519 -------VPPPRSQKRPRLSNKESVVGFYRHQASQNHLALDPD----------------- 554

Query: 496 DRILSNLQQHWKVVHVNETMPRXXXXXXXXXXXXXXLEFANXXXXXXXXXXXXXXXVKST 555
           +R+  +LQ+ W+ V+ +  +                                    V + 
Sbjct: 555 ERLAHSLQRDWESVYYDAVV-------------------------------ATSTDVTAG 583

Query: 556 KRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMTSAHGLPFVQAVKWELNEYKRHEMM 615
           K++ FS  +YV DTY+  +Y RSDK+F+R R+++M + + + +++AV  +LN++K+ EM 
Sbjct: 584 KKLRFSTAVYVKDTYAAAEYERSDKKFIRTRRRMMQTKN-MAYIEAVTSQLNQFKKGEMK 642

Query: 616 V 616
           V
Sbjct: 643 V 643

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 41/83 (49%), Gaps = 16/83 (19%)

Query: 21  PRSQSTGDLFLIP--ELDXXXXXXXXXGAHSMSSVS-------LQERARAPT-------A 64
           PR++ST DLF +P   +            H  SS         + E+ + PT        
Sbjct: 32  PRARSTSDLFEVPASRMRPKPYKRSSSARHVFSSPQPNNSLSLIPEQQQVPTHLLHSLTP 91

Query: 65  YQRLRTQMKQSFQFPNGESFTPR 87
           YQ+ R +MK SFQFPNGESFTPR
Sbjct: 92  YQKQRRRMKNSFQFPNGESFTPR 114

>KLLA0C11891g complement(1021360..1023213) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c singleton,
           hypothetical start
          Length = 617

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/265 (26%), Positives = 101/265 (38%), Gaps = 100/265 (37%)

Query: 352 LFDIDLVFDTLLLKSDRHDEPKKDCKGLAKEESTKTKQCVVIKHDTPPAANRTSLTHELD 411
           L DIDLVFD+LLLKS++H +                                       D
Sbjct: 441 LMDIDLVFDSLLLKSEQHQQ-------------------------------------NSD 463

Query: 412 YELIHEFSKLGEYIRTGTEGQELGATXXXXXXXXXXTPPPRSNRRPVFRQPDVSQSFYHS 471
             LI++F    E  R      E               PP RS++RP+  +    +  +H 
Sbjct: 464 IALINQF---NESTRISPPTVE---------------PPLRSSKRPLLVKDYQGRLIHHH 505

Query: 472 NMTLSPDFAKGIRANDKLSAFQYKDRILSNLQQHWKVVHVNETMPRXXXXXXXXXXXXXX 531
           N             N + +   + DRI+ +L Q+WK VH N  +P               
Sbjct: 506 N-------------NGQTT---HSDRIIEHLHQNWKAVHFNAVVPSVVRSNDSSSPV--- 546

Query: 532 LEFANXXXXXXXXXXXXXXXVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMT 591
                                 S K+  F++ IYVNDT+S  +Y RSDK F   RKQL  
Sbjct: 547 ----------------------SAKKCRFNEEIYVNDTFSPTEYLRSDKAFPESRKQLSK 584

Query: 592 SAHGLPFVQAVKWELNEYKRHEMMV 616
           S     ++  +K ELNE+K+ EM+V
Sbjct: 585 SR----YIDGIKMELNEFKKREMLV 605

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 51/112 (45%), Gaps = 17/112 (15%)

Query: 20  IPRSQSTGDLFLIPELDXXXX---XXXXXGAHSMSSVSLQERARAP--------TAYQRL 68
           +PRS ST DLF  P               G     SVS+   A  P        T YQ  
Sbjct: 25  LPRSTSTSDLFAFPSYSHSQKRLFQNSENGVELSKSVSIPNLALIPEHKAHHRLTPYQIQ 84

Query: 69  RTQMKQSFQFPNGESFTPRAQLRPGGERAHSL-----CGARPEAAAWPRRSA 115
           R+ MKQSFQFPNGESFTPR QL P    + SL       + P+  A  R S+
Sbjct: 85  RSHMKQSFQFPNGESFTPRRQL-PKSASSVSLHRQRSANSHPKITAMHRSSS 135

>YDR085C (AFR1) [937] chr4 complement(614282..616144) Protein
           involved in morphogenesis of the mating projection
           (shmoo) [1863 bp, 620 aa]
          Length = 620

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 64/275 (23%), Positives = 110/275 (40%), Gaps = 58/275 (21%)

Query: 351 SLFDIDLVFDTLLLK-SDRHDEPKKDCKGLAK-EESTKTKQCVVIKHDTPPAANRTSLTH 408
           +L D D +FD LL K +D++D  ++  +   K  E++      V   DT        L  
Sbjct: 383 TLMDTDSIFDDLLSKENDKYDLRRRQLEIRQKLHETSHNDDGKVSFRDTEKHNVNEGL-- 440

Query: 409 ELDYELIHEFSKLGEYIRTGTEGQELGATXXXXXXXXXXTPPPRSNRRPVFRQPDVSQSF 468
            +D  +I EFSKLGEYI   T  Q                PPPRS++RP     + ++ F
Sbjct: 441 -IDKTIIEEFSKLGEYI-IDTRNQ----------------PPPRSSKRPSLDDNESARYF 482

Query: 469 YHSNMTLSPDFAKGIRANDKLSAFQYKDRILSNLQQHWKVVHVNE---TMPRXXXXXXXX 525
           Y+    +S D  + +     L      D +++ L+  W+ +   +   ++P         
Sbjct: 483 YN----ISTDLRQSLSGPISLPMHVGND-MVNRLRNDWEYIRFEDRRNSLPDSSFDKVET 537

Query: 526 XXXXXXLEFANXXXXXXXXXXXXXXXVKSTKRIEFSDVIYVNDTYSHWDYRRSDKRFLRE 585
                                         K + F+  + +  T+S   Y R++  F+  
Sbjct: 538 PPKPIK------------------------KDVRFAKEVCLASTWSSNAYERANPEFIMN 573

Query: 586 RKQLMTSAHGLPFVQA----VKWELNEYKRHEMMV 616
           R +L+      P + +    +K ELN YK++EM+V
Sbjct: 574 RHRLLWMMKVHPSMNSAMNEIKLELNSYKKNEMVV 608

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 9/57 (15%)

Query: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQLRPGGERAHSLCGARPEAAAWPRRSASLQK 119
           T YQ  R++MK+SFQFPNGE + P+      G+  HSL   +PE  +   R +SL K
Sbjct: 128 TPYQLQRSKMKRSFQFPNGEIYKPKLD----GKCTHSL--KKPELNS---RDSSLFK 175

>Scas_459.1*
          Length = 648

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 21/28 (75%)

Query: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQL 90
           T YQ  + QMK SFQFPNGESFTPR Q 
Sbjct: 260 TPYQLQKKQMKASFQFPNGESFTPRNQF 287

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 73/180 (40%), Gaps = 17/180 (9%)

Query: 448 TPPPRSNRRPVFRQPDVSQSFYHS-----NMTLSPDFAKGIRANDKLS-AFQYKDRILSN 501
           +PP RS  RP     + ++ FYHS     + T   D       N ++S      ++ L  
Sbjct: 463 SPPVRSPNRPALENNETAKLFYHSLDGSLSSTTMTDTESSKPNNLEVSDTLMIPEKTLKR 522

Query: 502 LQQHWKVVHVNETMPRXXXXXXXXXXXXXXLEFANXXXXXXXXXXXXXXXVKSTKRIEFS 561
           L Q W+ V +N    +                  +                 ++K + F+
Sbjct: 523 LYQDWEKVTIN----KPKIKILTSTSVNSSTSSTSLPSSLNTGYSSATSSSTASKSLRFA 578

Query: 562 DVIYVNDTYSHWDYRRSD-----KRFLRERKQLMTSAHGLPFVQAVKWELNEYKRHEMMV 616
             I +++TYS ++Y R+D      + L     +    HG  F+  +K+E+N+YKR+EM V
Sbjct: 579 KEITISETYSPFEYLRADPDTSTTKSLYGDNLVYLKGHG--FINEIKFEINQYKRNEMSV 636

>YER158C (YER158C) [1587] chr5 complement(488852..490573) Protein of
           unknown function [1722 bp, 573 aa]
          Length = 573

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 16/78 (20%)

Query: 554 STKRIEFSDVIYVNDTYSHWDYRRSDKRFL----RERKQLMT-----------SAHGLPF 598
           + K + F+D IYVNDT+S  DY R D  FL    + + Q +T           S   +  
Sbjct: 485 AVKSLRFADEIYVNDTWSAADYCRCDNTFLNNFFKGKSQDITNPSTFVGNNLSSTKNISN 544

Query: 599 VQAVKWELNEYKRHEMMV 616
           ++ +K E+NE+KR EM V
Sbjct: 545 IE-IKMEVNEFKRKEMRV 561

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%)

Query: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQL 90
           T +Q  R QMK +FQFPNGE+FTPR Q+
Sbjct: 178 TPFQLQRKQMKSAFQFPNGENFTPRNQI 205

>CAGL0I08591g complement(837496..839049) some similarities with
           sp|P40095 Saccharomyces cerevisiae YER158c, hypothetical
           start
          Length = 517

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 22/29 (75%)

Query: 63  TAYQRLRTQMKQSFQFPNGESFTPRAQLR 91
           +AYQ  + +MK SF+F NGE FTPR +L+
Sbjct: 215 SAYQLQKQKMKHSFKFENGEVFTPRRELQ 243

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 555 TKRIEFSDVIYVNDTYSHWDYRRSDKRFLRERKQLM--------TSAHGLPFVQAVKWEL 606
            K++ FS+ + + DT++   Y RS+  FL    ++         +SA+       +K E+
Sbjct: 436 NKKLRFSNEVLLTDTWAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEI 495

Query: 607 NEYKRHEMMV 616
           NE+K++EM+V
Sbjct: 496 NEFKKNEMVV 505

>Scas_636.8d
          Length = 433

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 5/64 (7%)

Query: 556 KRIEFSDVIYVNDTYSHWDYRR---SDKRFLRERKQLMTSAHGLPFVQAVKWELNEYKRH 612
           K + F   IYV+DT+S  +Y R   +  R ++E  +L+   H   F+  +K E+N +K +
Sbjct: 360 KTVRFDTDIYVDDTWSPLEYERHGTTIARNMKEMVRLIQRDHV--FIDNIKREINYFKMY 417

Query: 613 EMMV 616
           EM V
Sbjct: 418 EMQV 421

>Sklu_2422.5 YNL233W, Contig c2422 10639-13197
          Length = 852

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 34/67 (50%), Gaps = 11/67 (16%)

Query: 552 VKSTKRI-EFSDVIYVNDTYSHWDYRRSDKRFLRERKQLMTSAHGLP-FVQAVKWELNEY 609
           V+ TKR+ EFS  I + DTYS ++Y R           + T     P   Q +K ELNE 
Sbjct: 784 VRGTKRVVEFSSRIILYDTYSEYEYDR--------HPDIATCNQLTPQLAQMIKDELNEL 835

Query: 610 KRHEMMV 616
           K +EM +
Sbjct: 836 K-NEMEI 841

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.129    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,467,685
Number of extensions: 609384
Number of successful extensions: 1765
Number of sequences better than 10.0: 16
Number of HSP's gapped: 1795
Number of HSP's successfully gapped: 29
Length of query: 616
Length of database: 16,596,109
Length adjustment: 108
Effective length of query: 508
Effective length of database: 12,857,365
Effective search space: 6531541420
Effective search space used: 6531541420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)