Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR153C20119810461e-147
Kwal_56.233791951985914e-78
KLLA0C11869g1951965899e-78
YDR084C1992005776e-76
Sklu_501.11951985769e-76
Scas_636.82011995646e-74
CAGL0K09988g1961985602e-73
Scas_654.350280642.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR153C
         (198 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)...   407   e-147
Kwal_56.23379                                                         232   4e-78
KLLA0C11869g complement(1020415..1021002) similar to sp|P38962 S...   231   9e-78
YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein ...   226   6e-76
Sklu_501.1 YDR084C, Contig c501 280-867                               226   9e-76
Scas_636.8                                                            221   6e-74
CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces c...   220   2e-73
Scas_654.3                                                             29   2.1  

>AGR153C [4464] [Homologous to ScYDR084C - SH] (1037657..1038262)
           [606 bp, 201 aa]
          Length = 201

 Score =  407 bits (1046), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 198/198 (100%), Positives = 198/198 (100%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY
Sbjct: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
           LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA
Sbjct: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180
           PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP
Sbjct: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180

Query: 181 TFTNVENIQRLFTFQTFF 198
           TFTNVENIQRLFTFQTFF
Sbjct: 181 TFTNVENIQRLFTFQTFF 198

>Kwal_56.23379
          Length = 195

 Score =  232 bits (591), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 112/198 (56%), Positives = 147/198 (74%), Gaps = 6/198 (3%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MD  +NFY TI+KSSHPLVLSLH+AGKA P+  YL+G WF+S+T+HF I  +LLLAVDFY
Sbjct: 1   MDHAKNFYQTILKSSHPLVLSLHIAGKAGPLVIYLIGSWFLSFTAHF-ITVLLLLAVDFY 59

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
           LTKNI+GRKLV LRWW++++ + +  SP  FESYK+Y    GP +NP+DSKLFW S Y +
Sbjct: 60  LTKNINGRKLVQLRWWYDSSSSKD--SPLTFESYKEYA--PGPPINPVDSKLFWWSLYVS 115

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180
           PALW +FG+LC+ + +F+ L L+  A  LTG+N +GFRSCD+W+P   SS+T + W Q+P
Sbjct: 116 PALWVIFGLLCLFQAKFLYLILIGMAVCLTGWNLHGFRSCDKWDPAANSSKTET-WFQLP 174

Query: 181 TFTNVENIQRLFTFQTFF 198
                EN+ R  T Q FF
Sbjct: 175 NIATFENLGRFATVQNFF 192

>KLLA0C11869g complement(1020415..1021002) similar to sp|P38962
           Saccharomyces cerevisiae YDR084c singleton, start by
           similarity
          Length = 195

 Score =  231 bits (589), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 141/196 (71%), Gaps = 3/196 (1%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MDS RNFY TI+ SSHPL+L++HL GKA+P+ FYLLG WF+S T  F II IL LA DFY
Sbjct: 1   MDSARNFYKTILASSHPLILTIHLLGKAVPIVFYLLGSWFLSSTVQF-IIVILTLAADFY 59

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
            TKNI+GRKL+  RWW++ +G  ED + F FES+K+YPD +   +NPIDSKLFW+S Y A
Sbjct: 60  FTKNINGRKLIQQRWWYDVSG--EDTTTFRFESFKEYPDVAAAPINPIDSKLFWLSLYVA 117

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180
           P +W +FG LC+++ QF+ L LV+FA GL  +NAY +R CD+WEP   +       P +P
Sbjct: 118 PTIWVVFGFLCLIKFQFVYLILVIFAGGLNLWNAYAYRLCDQWEPGHTAEAPLFQLPMLP 177

Query: 181 TFTNVENIQRLFTFQT 196
           +F N++ + RL +F T
Sbjct: 178 SFANLDRVTRLQSFFT 193

>YDR084C (YDR084C) [936] chr4 complement(613399..613998) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spbc2a9.05cp [600 bp, 199 aa]
          Length = 199

 Score =  226 bits (577), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 143/200 (71%), Gaps = 6/200 (3%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MD  RNFY+TI+KSSHPL+LS HLAGKA+P+ FY++G  F+++T  F+ + +LLL+ DFY
Sbjct: 1   MDQARNFYNTILKSSHPLLLSFHLAGKAVPIVFYIIGSMFLNFTPQFITV-VLLLSFDFY 59

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
           LTKNI+GRKLV LRWW+++T  N+D S F FESYKQY    GP +N IDSKLFW S Y  
Sbjct: 60  LTKNITGRKLVQLRWWYDSTDVNKD-SNFTFESYKQYA--PGPPINAIDSKLFWWSMYVT 116

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSS--ETSSIWPQ 178
           P +W +F VLC+LRL+   L LV+ A  LT +N YGFR CDRWEPN   S  + ++ W  
Sbjct: 117 PVIWGVFAVLCLLRLKIFYLILVIVAMCLTAWNTYGFRCCDRWEPNSGQSDGQDTNNWFA 176

Query: 179 MPTFTNVENIQRLFTFQTFF 198
           +P+    EN+ RL   Q+FF
Sbjct: 177 LPSVPGFENLSRLANIQSFF 196

>Sklu_501.1 YDR084C, Contig c501 280-867
          Length = 195

 Score =  226 bits (576), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 147/198 (74%), Gaps = 6/198 (3%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MD ++NFY+TI+KSSHPL+LSLHL GKA P+  YLLG WF+   +   I+ ILLLA DFY
Sbjct: 1   MDQIKNFYETILKSSHPLILSLHLLGKAAPILSYLLGSWFIHSFAALFILVILLLAADFY 60

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
           LTKNISGRKLV LRWW+++ G  +  +PF FESYKQYP  +G  +NPIDSKLFW S Y  
Sbjct: 61  LTKNISGRKLVQLRWWYDSMG--QAKTPFTFESYKQYP--AGNPINPIDSKLFWWSIYLT 116

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180
           P +WA+FG+LC+L+ QF+ L LV+ A GL G+NA+GFRSCD+WEP + S   S  W  +P
Sbjct: 117 PVVWAIFGILCILKFQFLYLLLVVLALGLNGWNAHGFRSCDKWEPGQDSGNNS--WIXLP 174

Query: 181 TFTNVENIQRLFTFQTFF 198
             +++EN+ R+  F +FF
Sbjct: 175 NLSSLENLSRIARFXSFF 192

>Scas_636.8
          Length = 201

 Score =  221 bits (564), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 151/199 (75%), Gaps = 4/199 (2%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           M+ + NFY+TI+KSSHP++L LHLAGKA P+ FY++G  F+ +T+ F+ + +LLLA DFY
Sbjct: 1   MEHLSNFYNTILKSSHPILLGLHLAGKAAPIVFYIIGSLFLGFTAQFICV-VLLLAFDFY 59

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
           LTKNISGRKLV LRWW+++T   E+   F FESYKQYP   GP +NPIDS+LFW S YA 
Sbjct: 60  LTKNISGRKLVQLRWWYDST--TENTETFRFESYKQYPPSLGPPINPIDSRLFWWSMYAT 117

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSS-IWPQM 179
           P +WA+FG+LC+LRL+   L LV+ A  LTG+N YGFR CD+W+P  K+++ S+  W Q+
Sbjct: 118 PIVWAVFGILCILRLKLFYLVLVVVAVFLTGWNTYGFRCCDKWDPIAKNADNSTESWFQL 177

Query: 180 PTFTNVENIQRLFTFQTFF 198
           P+   ++N+QR+  FQ+FF
Sbjct: 178 PSIPGLDNLQRMARFQSFF 196

>CAGL0K09988g 977017..977607 similar to sp|P38962 Saccharomyces
           cerevisiae YDR084c, start by similarity
          Length = 196

 Score =  220 bits (560), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 7/198 (3%)

Query: 1   MDSVRNFYDTIIKSSHPLVLSLHLAGKAIPVAFYLLGGWFVSYTSHFLIITILLLAVDFY 60
           MD VRNFYDTI++SSHPL+++ HLAGKA P+AFY+ G  F S+T+ F+ I +LLLA DFY
Sbjct: 1   MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTALFITI-VLLLAADFY 59

Query: 61  LTKNISGRKLVHLRWWHNATGTNEDGSPFVFESYKQYPDYSGPAVNPIDSKLFWISTYAA 120
            TKNISGR+LV LRWW++++ T+ +   F FES+KQY   +GP +NPIDSKLFW S Y  
Sbjct: 60  FTKNISGRRLVQLRWWYDSSATSTET--FTFESHKQYT--AGPPINPIDSKLFWWSMYLT 115

Query: 121 PALWALFGVLCVLRLQFISLFLVLFAAGLTGYNAYGFRSCDRWEPNKKSSETSSIWPQMP 180
           PA+W + G+L +LRL+ I+  L+  A  +TG+N YGFR CDRW PN  +S+++  + Q+P
Sbjct: 116 PAIWFVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNPN--NSQSTEPFFQLP 173

Query: 181 TFTNVENIQRLFTFQTFF 198
           +   ++NI RL  FQ+FF
Sbjct: 174 SIPGLDNITRLARFQSFF 191

>Scas_654.3
          Length = 502

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 33/80 (41%), Gaps = 19/80 (23%)

Query: 97  YPDYSGPAVNPIDSKLFWISTYAAPALW-------------------ALFGVLCVLRLQF 137
           YP Y   + +P+D++L++   Y AP  +                    LF V    +  F
Sbjct: 324 YPSYRMASTDPVDTELYFAVIYLAPGDYHHFHSPIDWVCKVRRHFPGDLFSVAPYFQRNF 383

Query: 138 ISLFLVLFAAGLTGYNAYGF 157
            +LF++     L GY  +GF
Sbjct: 384 PNLFVLNERVSLLGYWKHGF 403

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.326    0.140    0.456 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,712,918
Number of extensions: 275812
Number of successful extensions: 868
Number of sequences better than 10.0: 18
Number of HSP's gapped: 847
Number of HSP's successfully gapped: 18
Length of query: 198
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 102
Effective length of database: 13,272,781
Effective search space: 1353823662
Effective search space used: 1353823662
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)