Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR125W60759630710.0
KLLA0C17556g60759628070.0
YDR091C60859727930.0
CAGL0G08041g60759627390.0
Scas_636.1460859726780.0
Kwal_56.2342953953924690.0
Scas_618.37931901329e-08
AEL032W7531891321e-07
Sklu_2187.27521881311e-07
Kwal_34.162407521881249e-07
Kwal_33.156235621961231e-06
Scas_566.14662241211e-06
KLLA0D03432g14832141203e-06
KLLA0A10857g7521911184e-06
Kwal_27.1271112462061185e-06
Scas_716.8115651991185e-06
YFR009W (GCN20)7521891167e-06
CAGL0K00363g1227611151e-05
Kwal_0.32710191841132e-05
CAGL0I08019g12852351132e-05
AFR232C6071921113e-05
Scas_712.296105301113e-05
Scas_288.14942141103e-05
YER036C6101941113e-05
KLLA0D04554g10222861104e-05
Kwal_33.155611297741104e-05
CAGL0K10472g7521801095e-05
CAGL0M13739g7271371095e-05
CAGL0B03487g10451951095e-05
Sklu_2152.56081961086e-05
KLLA0C04477g12532161087e-05
Kwal_0.16710441861071e-04
ABR126W15122131061e-04
CAGL0I04862g15072161061e-04
YLR249W (YEF3)1044791051e-04
YOL075C12941571052e-04
Sklu_2442.2010441861042e-04
Scas_108.13351311022e-04
Scas_573.11689731032e-04
YPL226W (NEW1)11961851033e-04
YNL014W (HEF3)10441971033e-04
KLLA0A01452g6071931023e-04
Scas_40.1203225984e-04
CAGL0C02343g6101961014e-04
YDR011W (SNQ2)15012131015e-04
CAGL0M07293g15151881015e-04
Kwal_47.191166071621006e-04
Scas_703.171046791007e-04
YMR301C (ATM1)690156998e-04
Scas_720.361190191999e-04
Kwal_26.9480719126980.001
ABR125C1488217980.001
CAGL0D03674g118694980.001
CAGL0E00385g608215970.001
AFL131W1189185970.001
YCR011C (ADP1)1049215970.001
AAL028W104479970.001
KLLA0F12210g1044186970.001
Scas_574.8702122960.002
YNR070W1333212960.002
KLLA0F21692g1525228950.002
CAGL0L07744g1055181950.002
YKR104W (NFT1)306208930.003
YKL209C (STE6)1290231950.003
Sklu_2403.5117981940.003
KLLA0C16115g1183188940.003
YPL058C (PDR12)1511196940.003
Scas_628.131060177920.005
KLLA0A10131g720122920.005
AGL142C1497199910.007
AGR047W1492184900.010
AGL335W69175890.011
KLLA0B14256g127159890.013
KLLA0C01991g706204880.015
Sklu_2316.11310182880.019
AFR432W1284189880.020
AER190W1011184870.024
YLR188W (MDL1)695230860.027
KLLA0A00286g128080860.029
Sklu_2343.377464840.043
Scas_710.50602159840.045
Scas_468.169164840.046
Kwal_23.51611489180840.049
CAGL0G00242g1477212830.066
Scas_716.82675186830.068
KLLA0B09702g1518193830.071
Kwal_56.22329776142820.073
Kwal_14.24351247117820.087
Scas_552.4720194810.11
Scas_695.241288190810.11
AFR683C677201810.12
Kwal_27.96661474193810.12
CAGL0E03355g153565810.12
Scas_711.39122753800.15
YGR281W (YOR1)1477215800.17
KLLA0D03476g1560192800.18
ACR022W75474790.20
CAGL0E03982g165981790.21
Scas_587.871555780.22
YHL035C1592193790.23
Scas_472.1*393106780.24
YPL270W (MDL2)77364780.24
Scas_567.1810178770.29
Kwal_56.22747153865780.29
KLLA0C14234g1454133780.30
YJL074C (SMC3)1230108770.33
Kwal_26.670261784770.35
Scas_707.829432750.47
KLLA0D00748g78974760.49
CAGL0A01133g80173750.52
Scas_714.421520208750.56
Kwal_26.95321471211750.57
Scas_622.91657192750.58
YDR406W (PDR15)1529197750.66
AAL182W123153750.68
KLLA0E00462g1650195740.82
CAGL0F02717g1542197740.86
YLL015W (BPT1)155965740.86
CAGL0C03289g1648209740.89
KLLA0A04961g78589730.97
CAGL0H02805g121953731.00
ACL072C162782731.1
KLLA0F20075g1516126731.1
YFL028C (CAF16)289167711.2
Sklu_1870.3265160711.3
Scas_612.11*1506195721.4
Kwal_14.124226920701.6
ADR028W83280711.7
YDR135C (YCF1)1515100711.8
Kwal_56.23844149432712.0
AFR152C27020692.1
YOR328W (PDR10)1564192702.2
KLLA0F08833g27320692.3
CAGL0K12474g29420682.7
Scas_643.1128960692.8
YOR153W (PDR5)1511193692.8
CAGL0L06402g153534693.1
YGL009C (LEU1)77928693.2
YOR011W (AUS1)139466693.2
KLLA0B02563g80869683.6
Sklu_1859.282445683.8
Scas_167.1*279160673.8
YLL048C (YBT1)1661195684.1
Scas_693.42151234684.3
CAGL0M01760g1499192675.3
AER091W801129675.6
YFR031C (SMC2)117074666.3
KLLA0D04059g156843667.6
Kwal_34.15770143681658.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR125W
         (596 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...  1187   0.0  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...  1085   0.0  
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...  1080   0.0  
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...  1059   0.0  
Scas_636.14                                                          1036   0.0  
Kwal_56.23429                                                         955   0.0  
Scas_618.3                                                             55   9e-08
AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH] complement...    55   1e-07
Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement         55   1e-07
Kwal_34.16240                                                          52   9e-07
Kwal_33.15623                                                          52   1e-06
Scas_566.1                                                             51   1e-06
KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces c...    51   3e-06
KLLA0A10857g complement(941784..944042) highly similar to sp|P43...    50   4e-06
Kwal_27.12711                                                          50   5e-06
Scas_716.81                                                            50   5e-06
YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a prot...    49   7e-06
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    49   1e-05
Kwal_0.327                                                             48   2e-05
CAGL0I08019g complement(782863..786720) highly similar to sp|Q08...    48   2e-05
AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH] (859615..8...    47   3e-05
Scas_712.29                                                            47   3e-05
Scas_288.1                                                             47   3e-05
YER036C (YER036C) [1461] chr5 complement(223366..225198) Member ...    47   3e-05
KLLA0D04554g complement(385733..388801) similar to sp|P25371 Sac...    47   4e-05
Kwal_33.15561                                                          47   4e-05
CAGL0K10472g 1020016..1022274 highly similar to sp|P43535 Saccha...    47   5e-05
CAGL0M13739g complement(1346231..1348414) similar to sp|P40416 S...    47   5e-05
CAGL0B03487g complement(345399..348536) highly similar to sp|P16...    47   5e-05
Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement         46   6e-05
KLLA0C04477g complement(409543..413304) similar to sp|Q08234 Sac...    46   7e-05
Kwal_0.167                                                             46   1e-04
ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W (...    45   1e-04
CAGL0I04862g complement(438338..442861) highly similar to sp|P32...    45   1e-04
YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongat...    45   1e-04
YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member...    45   2e-04
Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement      45   2e-04
Scas_108.1                                                             44   2e-04
Scas_573.11                                                            44   2e-04
YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the non-t...    44   3e-04
YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongat...    44   3e-04
KLLA0A01452g 130078..131901 highly similar to sp|P40024 Saccharo...    44   3e-04
Scas_40.1                                                              42   4e-04
CAGL0C02343g 236840..238672 highly similar to sp|P40024 Saccharo...    44   4e-04
YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump invo...    44   5e-04
CAGL0M07293g complement(733072..737619) similar to sp|Q02785 Sac...    44   5e-04
Kwal_47.19116                                                          43   6e-04
Scas_703.17                                                            43   7e-04
YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of...    43   8e-04
Scas_720.36                                                            43   9e-04
Kwal_26.9480                                                           42   0.001
ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W ...    42   0.001
CAGL0D03674g 370066..373626 highly similar to tr|Q08972 Saccharo...    42   0.001
CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces cer...    42   0.001
AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH] complement(...    42   0.001
YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of t...    42   0.001
AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W (H...    42   0.001
KLLA0F12210g 1125630..1128764 highly similar to sp|P16521 Saccha...    42   0.001
Scas_574.8                                                             42   0.002
YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidr...    42   0.002
KLLA0F21692g complement(2014152..2018729) gi|14571818|gb|AAK6729...    41   0.002
CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces c...    41   0.002
YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the ATP-b...    40   0.003
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    41   0.003
Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement       41   0.003
KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomy...    41   0.003
YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein ...    41   0.003
Scas_628.13                                                            40   0.005
KLLA0A10131g complement(889688..891850) similar to sp|P40416 Sac...    40   0.005
AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH] (434247.....    40   0.007
AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH] complement(...    39   0.010
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    39   0.011
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    39   0.013
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    39   0.015
Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement           39   0.019
AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH] complement(...    39   0.020
AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -...    38   0.024
YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the ATP-b...    38   0.027
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...    38   0.029
Sklu_2343.3 YPL270W, Contig c2343 2058-4382                            37   0.043
Scas_710.50                                                            37   0.045
Scas_468.1                                                             37   0.046
Kwal_23.5161                                                           37   0.049
CAGL0G00242g complement(20428..24861) highly similar to sp|P5304...    37   0.066
Scas_716.82                                                            37   0.068
KLLA0B09702g complement(842245..846801) highly similar to sp|Q02...    37   0.071
Kwal_56.22329                                                          36   0.073
Kwal_14.2435                                                           36   0.087
Scas_552.4                                                             36   0.11 
Scas_695.24                                                            36   0.11 
AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH] (1697345..1...    36   0.12 
Kwal_27.9666                                                           36   0.12 
CAGL0E03355g complement(307242..311849) similar to sp|P14772 Sac...    36   0.12 
Scas_711.39                                                            35   0.15 
YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resista...    35   0.17 
KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces c...    35   0.18 
ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH] complement(...    35   0.20 
CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces c...    35   0.21 
Scas_587.8                                                             35   0.22 
YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of...    35   0.23 
Scas_472.1*                                                            35   0.24 
YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the ATP-bin...    35   0.24 
Scas_567.1                                                             34   0.29 
Kwal_56.22747                                                          35   0.29 
KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces...    35   0.30 
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...    34   0.33 
Kwal_26.6702                                                           34   0.35 
Scas_707.8                                                             33   0.47 
KLLA0D00748g complement(69839..72208) similar to sp|P33311 Sacch...    34   0.49 
CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces c...    33   0.52 
Scas_714.42                                                            33   0.56 
Kwal_26.9532                                                           33   0.57 
Scas_622.9                                                             33   0.58 
YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-bin...    33   0.66 
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...    33   0.68 
KLLA0E00462g complement(39173..44125) similar to sp|P32386 Sacch...    33   0.82 
CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-bindi...    33   0.86 
YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporte...    33   0.86 
CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces c...    33   0.89 
KLLA0A04961g 442461..444818 highly similar to sp|P07264 Saccharo...    33   0.97 
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...    33   1.00 
ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - ...    33   1.1  
KLLA0F20075g complement(1868786..1873336) similar to sp|P39109 S...    33   1.1  
YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein tha...    32   1.2  
Sklu_1870.3 YFL028C, Contig c1870 3336-4133                            32   1.3  
Scas_612.11*                                                           32   1.4  
Kwal_14.1242                                                           32   1.6  
ADR028W [1769] [Homologous to ScYGR089W - SH] complement(753948....    32   1.7  
YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar gl...    32   1.8  
Kwal_56.23844                                                          32   2.0  
AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH] (710017..7...    31   2.1  
YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-bind...    32   2.2  
KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces c...    31   2.3  
CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces...    31   2.7  
Scas_643.1                                                             31   2.8  
YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump in...    31   2.8  
CAGL0L06402g 718726..723333 highly similar to sp|P39109 Saccharo...    31   3.1  
YGL009C (LEU1) [1964] chr7 complement(476316..478655) 3-Isopropy...    31   3.2  
YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in...    31   3.2  
KLLA0B02563g complement(222951..225377) similar to sp|P34230 Sac...    31   3.6  
Sklu_1859.2 YDL148C, Contig c1859 1033-3507 reverse complement         31   3.8  
Scas_167.1*                                                            30   3.8  
YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein wit...    31   4.1  
Scas_693.42                                                            31   4.3  
CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharo...    30   5.3  
AER091W [2596] [Homologous to ScYKL188C (PXA2) - SH] complement(...    30   5.6  
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    30   6.3  
KLLA0D04059g complement(338422..343128) similar to sp|P14772 Sac...    30   7.6  
Kwal_34.15770                                                          30   8.8  

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
           complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 1187 bits (3071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/596 (97%), Positives = 579/596 (97%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI
Sbjct: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA
Sbjct: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV
Sbjct: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360
           YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360

Query: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQK 420
           TQGDFVLNVEPGEFSDSEILVMMGENGTGKTT                 PKLNVSMKPQK
Sbjct: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTLIKLLAGAIAADDGKDIPKLNVSMKPQK 420

Query: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480
           IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA
Sbjct: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480

Query: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS
Sbjct: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596

>KLLA0C17556g complement(1544404..1546227) highly similar to
           sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1,
           start by similarity
          Length = 607

 Score = 1085 bits (2807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/596 (88%), Positives = 552/596 (92%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MS KNTRIAIVS+DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISENLCIGCGI
Sbjct: 1   MSSKNTRIAIVSEDKCKPKKCRQECKRSCPVVKTGKLCIEVMPTSKIAFISENLCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR++DPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFEDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGP+QKVGELLK R+EK + D K YI IL+L+NVL R+VSALSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLEKSKDDAKRYIDILQLKNVLNREVSALSGGELQRFAIGMSCVQEA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAALIIRSLL+PTTYVICVEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLNPTTYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360
           YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFR+A+AG+EL +DA RAF YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRMADAGDELEADASRAFTYPDMKR 360

Query: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQK 420
           TQGDF L VE GEFSDS+ILVMMGENGTGKTT                 PKLNVSMKPQK
Sbjct: 361 TQGDFSLTVEAGEFSDSQILVMMGENGTGKTTLIKLLAGAIPADDGQDIPKLNVSMKPQK 420

Query: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480
           IAPKF GTVRQLFFKRIRAQFLNPQFQTDV KPL+IDDIIDQEVQHLSGGELQRVAIVL+
Sbjct: 421 IAPKFTGTVRQLFFKRIRAQFLNPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVLS 480

Query: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+ ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGMNADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           +G PSK A+AR PESLLTGCNKFLKNLNVTFRRDP SFRPRINKLDSQMDKEQK S
Sbjct: 541 DGIPSKQAFARAPESLLTGCNKFLKNLNVTFRRDPTSFRPRINKLDSQMDKEQKSS 596

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
           ortholog of human Rnase L inhibitor (RLI) of the
           interferon-regulated 2-5A pathway, putative ortholog of
           C. elegans Y39E4B.1, member of the non-transporter group
           in the ATP-binding cassette (ABC) superfamily [1827 bp,
           608 aa]
          Length = 608

 Score = 1080 bits (2793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/597 (87%), Positives = 551/597 (92%), Gaps = 1/597 (0%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MSDKN+RIAIVS DKCKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNL++ VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGP+QKVGELLK RMEK   DVK YIKIL+L+NVLKRD+  LSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAA IIRSLL PT YVICVEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSD-AMRAFQYPPMK 359
           YGVVTLP+SVREGINIFLDGHIP+ENLRFRTEALQFR+A+A E+L +D A RAF YP +K
Sbjct: 301 YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK 360

Query: 360 RTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQ 419
           +TQGDFVLNVE GEFSDSEILVMMGENGTGKTT                 PKLNVSMKPQ
Sbjct: 361 KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ 420

Query: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479
           KIAPKFPGTVRQLFFK+IR QFLNPQFQTDV KPLRIDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 540

Query: 540 FEGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           FEG PSKNA+AR PESLLTGCN+FLKNLNVTFRRDPNSFRPRINKLDSQMDKEQK S
Sbjct: 541 FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSS 597

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
           Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/596 (85%), Positives = 544/596 (91%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MSDK +RIA+V+ D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEVLCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AITIINLPTNL+S VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDN+PRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNLPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGP+QKVGELLK RMEKP+  VK YIK L+L ++L R++  LSGGELQRFAI MSCVQ A
Sbjct: 181 KGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNREIGLLSGGELQRFAIAMSCVQDA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAALIIRSLL+P+ YVI VEHDLSVLDYLSDF+CILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIAVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360
           YGVVTLPSSVREGINIFLDGHIPSEN+RFRTEALQFR+A++  ++  DA RA+ YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPSENMRFRTEALQFRIADSAADIIVDATRAYSYPDMKR 360

Query: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQK 420
           TQGDF LNV+ GEFSDSEILVMMGENGTGKTT                 PKLNVSMKPQ 
Sbjct: 361 TQGDFTLNVQSGEFSDSEILVMMGENGTGKTTLIKLLAGAIPADDGTSVPKLNVSMKPQT 420

Query: 421 IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVLA 480
           IAPKFPGTVRQLFFK+IRAQFLNPQFQTDV KPL+IDDIIDQEV+HLSGGELQRVAIVL+
Sbjct: 421 IAPKFPGTVRQLFFKKIRAQFLNPQFQTDVVKPLKIDDIIDQEVKHLSGGELQRVAIVLS 480

Query: 481 LGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540
           LG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF
Sbjct: 481 LGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIVF 540

Query: 541 EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           +GTPS+N  A  PESLLTGCN+FLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS
Sbjct: 541 DGTPSQNTTATAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596

>Scas_636.14
          Length = 608

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/597 (83%), Positives = 536/597 (89%), Gaps = 1/597 (0%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MS+KN+RIAIVS D+CKPKKCRQECKRSCPVVKTGKLCIEV PTSK+AFISE LCIGCGI
Sbjct: 1   MSEKNSRIAIVSADRCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AITIINLPTNL+  VTHRYS NSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAITIINLPTNLEQHVTHRYSVNSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGR+DDPPEW +IIKYFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGP+QKVGELLK RMEK    VK YIK L+L++VL R++  LSGGELQRFAIG+SCVQ A
Sbjct: 181 KGPVQKVGELLKLRMEKDSETVKGYIKTLQLEHVLNREIGKLSGGELQRFAIGLSCVQDA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAA IIR LL PT YVI VEHDLSVLDYLSDF+CI+YGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAAQIIRDLLTPTKYVIAVEHDLSVLDYLSDFVCIIYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHSDAMRAFQYPPMKR 360
           YGVVTLPSSVREGINIFLDGHIP+EN+RFR+EALQFRL +A E+   +A + F+YP MKR
Sbjct: 301 YGVVTLPSSVREGINIFLDGHIPAENIRFRSEALQFRLHDATEDTKGEANKTFEYPAMKR 360

Query: 361 TQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXX-XXXXXXXXXXXPKLNVSMKPQ 419
           TQGDF L VE G+FSDSEILVMMGENGTGKTT                   KLNVSMKPQ
Sbjct: 361 TQGDFSLTVESGDFSDSEILVMMGENGTGKTTLIKLLAGVIQSDENSEKVQKLNVSMKPQ 420

Query: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479
            IAPKFPGTVRQLFFK+IR QFL+PQFQTDV KPL+IDDIIDQEVQHLSGGELQRVAIVL
Sbjct: 421 TIAPKFPGTVRQLFFKKIRGQFLSPQFQTDVVKPLKIDDIIDQEVQHLSGGELQRVAIVL 480

Query: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV 539
           ALG+PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVIV
Sbjct: 481 ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFVVEHDFIMATYLADKVIV 540

Query: 540 FEGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           FEGTPSK+A AR PESLLTGCN+FLKNLNVTFRRD  SFRPRINKLDSQMD+EQKLS
Sbjct: 541 FEGTPSKHANARAPESLLTGCNRFLKNLNVTFRRDTTSFRPRINKLDSQMDREQKLS 597

>Kwal_56.23429
          Length = 539

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/539 (85%), Positives = 491/539 (91%), Gaps = 1/539 (0%)

Query: 1   MSDKNTRIAIVSDDKCKPKKCRQECKRSCPVVKTGKLCIEVAPTSKVAFISENLCIGCGI 60
           MS KN RIAIV++DKCKPKKCRQECKRSCPVVKTGKLCIEV PT+K+AFISE LCIGCGI
Sbjct: 1   MSTKNARIAIVNEDKCKPKKCRQECKRSCPVVKTGKLCIEVTPTNKIAFISETLCIGCGI 60

Query: 61  CVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120
           CVKKCPF AI IINLPTNL+ +VTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
Sbjct: 61  CVKKCPFDAIQIINLPTNLEGEVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL 120

Query: 121 KILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI 180
           KILAGKQKPNLGRYDDPPEW DII+YFRGSELQNYFTKMLED+IKAIIKPQYVDNIPRAI
Sbjct: 121 KILAGKQKPNLGRYDDPPEWQDIIRYFRGSELQNYFTKMLEDNIKAIIKPQYVDNIPRAI 180

Query: 181 KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQA 240
           KGP+QKVGELLK R+E+ + D K  IK L+LQ+VLKRDV ALSGGELQRFAIGMSCVQ+A
Sbjct: 181 KGPVQKVGELLKLRLERSQDDAKYVIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEA 240

Query: 241 NVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSV 300
           +VYMFDEPSSYLDVKQRLNAAL+IRSLL+ TTYVI VEHDLSVLDYLSDF+CILYGVPSV
Sbjct: 241 DVYMFDEPSSYLDVKQRLNAALVIRSLLNATTYVISVEHDLSVLDYLSDFVCILYGVPSV 300

Query: 301 YGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLAEAGEELHS-DAMRAFQYPPMK 359
           YGVVTLPSSVREGINIFL+GHIPSEN+RFR EALQFR+ +A E+L + DA R+F YP MK
Sbjct: 301 YGVVTLPSSVREGINIFLEGHIPSENMRFRQEALQFRMVDAQEQLEAEDATRSFAYPSMK 360

Query: 360 RTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQ 419
           RTQGDFVLNVE G FSDSEILVMMGENGTGKTT                 PKLNVSMKPQ
Sbjct: 361 RTQGDFVLNVESGSFSDSEILVMMGENGTGKTTLIKLLAGALSPDDGQKVPKLNVSMKPQ 420

Query: 420 KIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIIDQEVQHLSGGELQRVAIVL 479
           KIAPKFPGTVRQLFFKRIR QFLNPQFQTDV KPL+I+ IIDQEVQHLSGGELQRVAIVL
Sbjct: 421 KIAPKFPGTVRQLFFKRIRGQFLNPQFQTDVVKPLKIESIIDQEVQHLSGGELQRVAIVL 480

Query: 480 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVI 538
           ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF+VEHDFIMATYLADKVI
Sbjct: 481 ALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFLVEHDFIMATYLADKVI 539

 Score = 88.6 bits (218), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 7/135 (5%)

Query: 450 VCKPLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 509
           V K L +  ++ ++V  LSGGELQR AI ++    AD+Y+ DEPS+YLD +QR+  + VI
Sbjct: 205 VIKALDLQHVLKRDVGALSGGELQRFAIGMSCVQEADVYMFDEPSSYLDVKQRLNAALVI 264

Query: 510 RRFILHNKKTAFI-VEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLK--- 565
           R  +  N  T  I VEHD  +  YL+D V +  G PS       P S+  G N FL+   
Sbjct: 265 RSLL--NATTYVISVEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLEGHI 322

Query: 566 -NLNVTFRRDPNSFR 579
            + N+ FR++   FR
Sbjct: 323 PSENMRFRQEALQFR 337

>Scas_618.3
          Length = 793

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 33/190 (17%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQ-NYFTKMLEDDI 164
           + LVG NG GK+T LK++  + +P  G               R   L+  YFT+   D +
Sbjct: 602 IALVGANGCGKTTLLKVMMEELRPTKGFVS------------RNGRLRIGYFTQHHVDSM 649

Query: 165 KAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK-RDVSALS 223
              +    VD + +A  G              K + + + ++    +   L  + +  LS
Sbjct: 650 D--LTTSAVDWMSKAYPG--------------KTDEEYRHHLGSFGITGTLGLQKMELLS 693

Query: 224 GGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSV 283
           GG+  R A    C+   ++ + DEPS++LD    L+A  ++ SL + +  V+ V HD+S+
Sbjct: 694 GGQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVESLKNFSGGVLMVSHDISI 750

Query: 284 LDYLSDFICI 293
           +D++ + I +
Sbjct: 751 IDHVCNEIWV 760

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 90/212 (42%), Gaps = 37/212 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEW-- 140
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 266 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHVSILHVEQELRGDETLALQSVLDADVWRK 325

Query: 141 ---SDIIKYF-RGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARME 196
              S+  K   R  E+    ++  ED ++     + +DN    +   L ++ E L A ME
Sbjct: 326 QLLSEEAKINERLKEMDKLRSEFEEDSLEV----KKLDNEREDLDKHLIQIDEKL-ADME 380

Query: 197 KPEADVKMYIKILEL---QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
             +A+ +    +  L       ++  ++ SGG   R ++  +   Q ++ + DEPS+ LD
Sbjct: 381 SDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD 440

Query: 254 VKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           V      A  +++   P+T V+ V HD + L+
Sbjct: 441 VPSIAYLAEYLKTY--PST-VLTVSHDRAFLN 469

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 462 QEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           Q+++ LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F        
Sbjct: 687 QKMELLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTTGLDALVESLKNF----SGGV 741

Query: 521 FIVEHDFIMATYLADKVIVFEGTPSK 546
            +V HD  +  ++ +++ V E    K
Sbjct: 742 LMVSHDISIIDHVCNEIWVSENGTVK 767

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T   V HD
Sbjct: 409 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PSTVLTVSHD 464

Query: 527 FIMATYLADKVI 538
                 +A  +I
Sbjct: 465 RAFLNEVATDII 476

>AEL032W [2474] [Homologous to ScYFR009W (GCN20) - SH]
           complement(572196..574457) [2262 bp, 753 aa]
          Length = 753

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 88/189 (46%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P     I YF     Q++   M   D+ 
Sbjct: 562 IALVGANGCGKTTLLKVMMEQLRPITGHVSRNPRLR--IGYF----TQHHIDSM---DLN 612

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK-RDVSALSG 224
           A      VD + +   G              K + + + ++    +   L  + +  LSG
Sbjct: 613 A----SAVDWMSKTFPG--------------KTDEEYRRHLGAFGITGSLGLQKMQLLSG 654

Query: 225 GELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVL 284
           G+  R A    C+   ++ + DEPS++LD    L+A  ++++L + +  V+ V HD+SV+
Sbjct: 655 GQKSRVAFAALCLNSPHILILDEPSNHLDTAG-LDA--LVQALKNFSGGVLMVSHDISVI 711

Query: 285 DYLSDFICI 293
           D + D I +
Sbjct: 712 DSVCDEIWV 720

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 101/215 (46%), Gaps = 43/215 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWS--DIIKYFRGSE---LQN--- 154
           G+  GLVG NGIGKST L+ L+ +++ N+     P   S   + +  RG +   LQ+   
Sbjct: 226 GRRYGLVGQNGIGKSTLLRALS-RRELNV-----PKHISILHVEQELRGDDTKVLQSVLD 279

Query: 155 ---YFTKMLEDDIKAIIKPQYVDNIPRA------------------IKGPLQKVGELLKA 193
              +  ++L +++K   + Q +D + RA                  ++  LQ++ E L A
Sbjct: 280 ADVWRKQLLSEELKINERLQDIDKL-RAEFDEDSLEVKKLDNERDDLESHLQQIAEKL-A 337

Query: 194 RMEKPEADVKMYIKILEL---QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSS 250
            ME  +A+ +    +  L       ++  ++ SGG   R ++  +   Q ++ + DEPS+
Sbjct: 338 DMESDKAEARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSN 397

Query: 251 YLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
            LDV      A  +++   P T V+ V HD S L+
Sbjct: 398 MLDVPSIAYLAEYLKTY--PAT-VLVVSHDRSFLN 429

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 42/86 (48%), Gaps = 6/86 (6%)

Query: 462 QEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F        
Sbjct: 647 QKMQLLSGGQKSRVAFAALCLNSPH-ILILDEPSNHLDTAGLDALVQALKNF----SGGV 701

Query: 521 FIVEHDFIMATYLADKVIVFEGTPSK 546
            +V HD  +   + D++ V E    K
Sbjct: 702 LMVSHDISVIDSVCDEIWVSESGTVK 727

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  +V HD
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVLVVSHD 424

Query: 527 FIMATYLADKVI 538
                 +A  +I
Sbjct: 425 RSFLNEVATDII 436

>Sklu_2187.2 YFR009W, Contig c2187 2884-5142 reverse complement
          Length = 752

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P     I YF    + +        D  
Sbjct: 561 IALVGANGCGKTTLLKVMMEQLRPTKGYVSRNPRLR--IGYFTQHHVDSMDLNTSAVDWM 618

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
           +   P   D   R   G     G L   +M+                         LSGG
Sbjct: 619 SKTFPGKTDEEYRRHLGAFGITGSLGLQKMQ------------------------LLSGG 654

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           +  R A    C+   ++ + DEPS++LD    L+A  +I +L + T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LIDALKNFTGGVLMVSHDISVID 711

Query: 286 YLSDFICI 293
           ++   I +
Sbjct: 712 HVCSEIWV 719

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 89/207 (42%), Gaps = 27/207 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEWSD 142
           G+  GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GRRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 143 --IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGE-LLKARMEKPE 199
             + +  + +E      K+ E+  +  ++ + +DN    +   L+++ E L+    +K E
Sbjct: 285 QLLSEESKINERLQEIEKLREEFDEDSLEVKKLDNEREDLDNHLEQISEKLVDMESDKAE 344

Query: 200 ADVKMYIKILELQN-VLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRL 258
           A     +  L       ++  ++ SGG   R ++  +   Q ++ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQKPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 259 NAALIIRSLLDPTTYVICVEHDLSVLD 285
             +  +++   P T V+ V HD + L+
Sbjct: 405 YLSEYLKTY--PAT-VLVVSHDRAFLN 428

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 40/81 (49%), Gaps = 6/81 (7%)

Query: 462 QEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F        
Sbjct: 646 QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALIDALKNFT----GGV 700

Query: 521 FIVEHDFIMATYLADKVIVFE 541
            +V HD  +  ++  ++ V E
Sbjct: 701 LMVSHDISVIDHVCSEIWVSE 721

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 4/72 (5%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  +V HD
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVLVVSHD 423

Query: 527 FIMATYLADKVI 538
                 +A  +I
Sbjct: 424 RAFLNEVATDII 435

>Kwal_34.16240
          Length = 752

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 77/188 (40%), Gaps = 29/188 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKIL  + +P  G     P     + YF    + +        D  
Sbjct: 561 IALVGANGCGKTTLLKILMEQLRPIQGYVSRNPRLR--VAYFTQHHVDSMDLNTSAVDWM 618

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
           +   P   D   R   G     G L   +M+                         LSGG
Sbjct: 619 STTFPGKTDEEYRRHLGAFGITGSLGLQKMQ------------------------LLSGG 654

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           +  R A    C+   ++ + DEPS++LD    L+A  ++ +L   T  V+ V HD+SV+D
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LMDALKKFTGGVLMVSHDISVID 711

Query: 286 YLSDFICI 293
            + + I +
Sbjct: 712 GVCNEIWV 719

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 39/213 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEW-- 140
           G   G+VG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGIVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALNSVLDADVWRK 284

Query: 141 ------SDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGE-LLKA 193
                 S I +  R  E++   ++  ED +++    + +DN    ++  L+++ E L+  
Sbjct: 285 QLLSEESKINE--RLQEIEKLRSEFEEDSLES----KKLDNEREDLESHLEQISEKLIDM 338

Query: 194 RMEKPEADVKMYIKILELQNVLKRD-VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYL 252
             +K EA     +  L      ++   ++ SGG   R ++  +   Q ++ + DEPS+ L
Sbjct: 339 ESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNML 398

Query: 253 DVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           DV      +  +++   P T V+ V HD + L+
Sbjct: 399 DVPSIAYLSEYLKTY--PAT-VVVVSHDRAFLN 428

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  AL    D+ L+DEPS  LD       S+ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLSEYLKTY----PATVV 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Kwal_33.15623
          Length = 562

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 89/196 (45%), Gaps = 15/196 (7%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G  + +VG NGIGK+T LK+L+G         DD P    I    R   L  +F ++  +
Sbjct: 61  GDKVTIVGENGIGKTTFLKLLSG--------VDDYPFSGSIEIEGRIGFLPQHFEEVDGN 112

Query: 163 --DIKAIIKPQYVDNIPRAIKGPLQKVG-ELLKARMEKPEADVKMYIKILEL-QNVLKRD 218
              ++ ++K  Y D I   ++ PL     E ++        ++   +  + L Q +L+R 
Sbjct: 113 LLAVEVLLKSLYDDEINEFLELPLTPFSHEWIQELNSLGGHEIFRQVSHIGLRQEILRRP 172

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
              LSGGE  +  +    +   +  + DEP+++LD K        +R        V+ V 
Sbjct: 173 FRLLSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF---NGTVVMVT 229

Query: 279 HDLSVLDYLSDFICIL 294
           HD ++++ +S FI  L
Sbjct: 230 HDRALINAVSSFISEL 245

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGGE  +  +     L  D  L+DEP+ +LD++        +R+F      T  +V HD
Sbjct: 176 LSGGEKTKTLLCALSILNPDFILLDEPTNHLDTKGIEWLEFFLRKF----NGTVVMVTHD 231

>Scas_566.1
          Length = 466

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 104/224 (46%), Gaps = 24/224 (10%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRG 149
           NSF L  LP+   G V+ ++G +G GK+T L +LA K    L + D    +    K  R 
Sbjct: 68  NSFSLD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGL-KTDGDIHYILEEKPQRD 122

Query: 150 SELQNYFTKMLEDDIKAIIKPQY-VDNIPRAIKGPLQKVGEL-LKARMEKPEADVKMYIK 207
           SE +    + ++D +K    PQ  V +     +  L    +L L    E+ +  V   I 
Sbjct: 123 SEQE----QEVQDHVKMAYLPQQDVLSARLTCRETLMYAADLKLDRSKEEKKLVVDQLIH 178

Query: 208 ILELQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAAL 262
            L L++  +  V       LSGGE +R ++G   +   ++   DEP++ LD     +A L
Sbjct: 179 ELGLKDCAETLVGDNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDA---YSAYL 235

Query: 263 IIRSLL-----DPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
           ++++L      D  T+++ +    S + +L D +CIL     VY
Sbjct: 236 VVKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGKVVY 279

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 7/80 (8%)

Query: 461 DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           D   + LSGGE +R+++   +     I  +DEP+  LD+    +  K +++    + +T 
Sbjct: 192 DNTHRGLSGGEKRRLSVGTQMISNPSIMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRT- 250

Query: 521 FIVEHDFIMATYLADKVIVF 540
                 FIM+ +     I+F
Sbjct: 251 ------FIMSIHQPRSDILF 264

>KLLA0D03432g 287805..292256 similar to sp|P32568 Saccharomyces
           cerevisiae YDR011w SNQ2 multidrug resistance protein,
           start by similarity
          Length = 1483

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 93/214 (43%), Gaps = 21/214 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RYDDPPEWSDIIKYFRGSELQNY 155
           RPG++L ++G  G G ST LK +AG+     G      YD   +  D++KYF+   + N 
Sbjct: 169 RPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQ-KDMLKYFKSDVIYN- 226

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVL 215
               ++     +   Q +D    A K P +++ +    R +  E    +Y  I  L++  
Sbjct: 227 --GEMDVHFPHLTVQQTLD-FAVACKTPSKRINDF--TRQQYIEFIRDLYATIFGLKHTY 281

Query: 216 KRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR---SL 267
              V       +SGGE +R +I  +   + ++Y +D  +  LD    L     IR   +L
Sbjct: 282 NTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNL 341

Query: 268 LDPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
           L  T  +   +   ++ +   D + ILY    +Y
Sbjct: 342 LKSTALITVYQASENIYETF-DKVTILYEGKQIY 374

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 6/86 (6%)

Query: 461 DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           D  V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K TA
Sbjct: 287 DDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEYTEAIRCMTNLLKSTA 346

Query: 521 FIVEH---DFIMATYLADKV-IVFEG 542
            I  +   + I  T+  DKV I++EG
Sbjct: 347 LITVYQASENIYETF--DKVTILYEG 370

>KLLA0A10857g complement(941784..944042) highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 77/191 (40%), Gaps = 29/191 (15%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P     I YF    + +        D  
Sbjct: 561 ISLVGANGCGKTTLLKVMMEQLRPTKGFVSRNPRLR--IGYFTQHHVDSMDLNQSAVDWM 618

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
           +   P   D   R   G     G L   RM+                         LSGG
Sbjct: 619 STAFPGKTDEEYRRHLGAFGISGSLGIQRMQ------------------------LLSGG 654

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           +  R A    C+   ++ + DEPS++LD    L+A  ++ +L      V+ V HD+SV++
Sbjct: 655 QKSRVAFAALCLNNPHILVLDEPSNHLDTAG-LDA--LVDALKSFNGGVLMVSHDISVIN 711

Query: 286 YLSDFICILYG 296
            + + I +  G
Sbjct: 712 SVCNEIWVSEG 722

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 96/208 (46%), Gaps = 29/208 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQN------YF 156
           G+  GLVG NGIGKST LK L+ +++ N+ ++         I+      LQ+      + 
Sbjct: 225 GRRYGLVGQNGIGKSTLLKALS-RRELNVPKHISVLHVEQEIRGDETKALQSVLDADVWR 283

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN--- 213
            ++L ++ K   + Q ++N+ +       +V +L   R +  E   ++  K++++++   
Sbjct: 284 KQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEKLIDMESDKA 343

Query: 214 ----------------VLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR 257
                             ++  ++ SGG   R ++  +   Q ++ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 403

Query: 258 LNAALIIRSLLDPTTYVICVEHDLSVLD 285
              A  +++   P T V+ V HD + L+
Sbjct: 404 AYLAEYLKTY--PAT-VLVVSHDRAFLN 428

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 462 QEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           Q +Q LSGG+  RVA   L L  P  I ++DEPS +LD+         ++ F        
Sbjct: 646 QRMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTAGLDALVDALKSF----NGGV 700

Query: 521 FIVEHDFIMATYLADKVIVFEG 542
            +V HD  +   + +++ V EG
Sbjct: 701 LMVSHDISVINSVCNEIWVSEG 722

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PATVL 418

Query: 522 IVEHDFIMATYLADKVI 538
           +V HD      +A  +I
Sbjct: 419 VVSHDRAFLNEVATDII 435

>Kwal_27.12711
          Length = 1246

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 96/206 (46%), Gaps = 33/206 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYDDPPEWSDIIKYFRGSELQNYFTKM 159
           G ++ ++G +G GK+T L +LA K    L   G +   PE S       G    +Y T  
Sbjct: 46  GSIMAIIGGSGSGKTTLLNVLASKMSKTLKQRGSFRFVPETSS----HSGEITTSYLT-- 99

Query: 160 LEDDIKAIIKPQYVDNIPRAIKGPLQKVGEL-LKARMEKPEADVKMYIKILELQNVLKRD 218
            + DI A        N+    +  LQ   +L L++   + +  V+  I  L L++     
Sbjct: 100 -QQDILA-------SNL--TCRETLQYAADLKLQSSKSERQGLVEELIAELGLKDCANTL 149

Query: 219 VSA-----LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPT-- 271
           V +     LSGGE +R +IG+  +   ++   DEP++ LD     +A L++R+L   +  
Sbjct: 150 VGSPNRPGLSGGEKRRLSIGVQMISNPSLMFLDEPTTGLDA---YSAYLVVRTLRKLSHK 206

Query: 272 ---TYVICVEHDLSVLDYLSDFICIL 294
              ++++ +    + + +L D +CI+
Sbjct: 207 GGRSFIMSIHQPRADILFLLDQVCIM 232

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 77/163 (47%), Gaps = 20/163 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN-LGRYDDPPEWSDIIKYFRGSELQNYFTKM 159
           +P  +  ++G +G GKST L  L+GK     L  ++          +F  S++    T+ 
Sbjct: 674 QPHAINAIMGPSGSGKSTLLNFLSGKTHSTVLASFETSGS-----IFFNNSQV----TQD 724

Query: 160 LEDDIKAIIKPQYVDNI-PR-AIKGPLQKVGEL----LKARMEKPEAD---VKMYIKILE 210
           +  D+ + + PQ  D++ P+  ++  L    +L    +KAR      D    ++ +K  E
Sbjct: 725 IFKDVCSFV-PQDDDHLLPQLTVRETLLFAADLRLHHMKARNRISRVDDLISELGLKHCE 783

Query: 211 LQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
              V    V  +SGGE +R ++G   +  + + + DEP+S LD
Sbjct: 784 NTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLD 826

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 14/59 (23%)

Query: 455 RIDDIIDQE--------------VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 499
           R+DD+I +               V+ +SGGE +R+++   L   + I L+DEP++ LDS
Sbjct: 769 RVDDLISELGLKHCENTLVGSELVKGISGGEKRRLSMGTHLLTDSPILLLDEPTSGLDS 827

>Scas_716.81
          Length = 1565

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 94/199 (47%), Gaps = 26/199 (13%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGK--QKPNLGR----YDDPPEWSDI 143
           NS+ L      +PG+++ ++G  G G S+ LK++AG+  Q P   +    YD  P+  ++
Sbjct: 236 NSYAL-----AKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDGIPQ-KEM 289

Query: 144 IKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVK 203
           +K+++   + N     L+     +   Q +D    A K P ++V  +  +R E  ++  +
Sbjct: 290 MKHYKSDVIYN---GELDVHFPHLTVQQTLD-FALACKTPAKRVNNI--SRDEYIKSSRE 343

Query: 204 MYIKILELQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRL 258
           +Y  I  L++     V       +SGGE +R +I  +     ++Y +D  +  LD    L
Sbjct: 344 LYATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTAL 403

Query: 259 NAALIIR---SLLDPTTYV 274
             A  IR   +LL  T +V
Sbjct: 404 EYAKAIRIMTNLLGSTAFV 422

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 79/191 (41%), Gaps = 32/191 (16%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA + +  +   D             G  +   F +   
Sbjct: 940  PGTLTALMGESGAGKTTLLNTLAKRNEIGVVTGD---------MLVNGRPVDASFERR-- 988

Query: 162  DDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE--------ADVKMYIKILELQN 213
                  ++ Q +      ++  LQ       ARM + E        A V+  I++LE++ 
Sbjct: 989  ---TGYVQQQDIHIAELTVRESLQ-----FSARMRRSEHVSDEEKLAYVEKIIRVLEMEE 1040

Query: 214  VLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLL 268
                 V A+  G    + ++ +IG+  V + ++ +F DEP+S LD +       ++R L 
Sbjct: 1041 FADALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLRKLA 1100

Query: 269  DPTTYVICVEH 279
                 ++C  H
Sbjct: 1101 QAGQSILCTIH 1111

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 364 VRGVSGGERKRVSIAEALAANGSIYCWDNATRGLDASTALEYAKAIRIMTNLLGSTAFVT 423

>YFR009W (GCN20) [1689] chr6 (162482..164740) Component of a protein
           complex required for activation of Gcn2p protein kinase
           in response to amino acid starvation, member of the
           non-transporter group within the ATP-binding cassette
           (ABC) superfamily [2259 bp, 752 aa]
          Length = 752

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 83/189 (43%), Gaps = 31/189 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LKI+  + +P  G     P                YFT+   D + 
Sbjct: 561 IALVGANGCGKTTLLKIMMEQLRPLKGFVSRNPRLR-----------IGYFTQHHVDSMD 609

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK-RDVSALSG 224
             +    VD + ++  G              K + + + ++    +   L  + +  LSG
Sbjct: 610 --LTTSAVDWMSKSFPG--------------KTDEEYRRHLGSFGITGTLGLQKMQLLSG 653

Query: 225 GELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVL 284
           G+  R A    C+   ++ + DEPS++LD    L+A  ++ +L +    V+ V HD+SV+
Sbjct: 654 GQKSRVAFAALCLNNPHILVLDEPSNHLDTTG-LDA--LVEALKNFNGGVLMVSHDISVI 710

Query: 285 DYLSDFICI 293
           D +   I +
Sbjct: 711 DSVCKEIWV 719

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 93/208 (44%), Gaps = 29/208 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRY------------DDPPEW-----SDIIK 145
           G   GLVG NGIGKST L+ L+ +++ N+ ++            DD         +D+ +
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALS-RRELNVPKHVSILHVEQELRGDDTKALQSVLDADVWR 283

Query: 146 YFRGSELQNYFTKMLEDDI------KAIIKPQYVDNIPRAIKGPLQKVGE-LLKARMEKP 198
               SE      ++ E D+      +  ++ + +DN    +   L ++ + L+    +K 
Sbjct: 284 KQLLSEEAKINERLKEMDVLRQEFEEDSLEVKKLDNEREDLDNHLIQISDKLVDMESDKA 343

Query: 199 EADVKMYIKILELQNVLKRD-VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR 257
           EA     +  L      ++   ++ SGG   R ++  +   Q ++ + DEPS+ LDV   
Sbjct: 344 EARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSI 403

Query: 258 LNAALIIRSLLDPTTYVICVEHDLSVLD 285
              A  +++   P T V+ V HD + L+
Sbjct: 404 AYLAEYLKTY--PNT-VLTVSHDRAFLN 428

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 14/91 (15%)

Query: 462 QEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+       + ++ F        
Sbjct: 646 QKMQLLSGGQKSRVAFAALCLNNPH-ILVLDEPSNHLDTTGLDALVEALKNF----NGGV 700

Query: 521 FIVEHDFIMATYLADKVIV--------FEGT 543
            +V HD  +   +  ++ V        FEGT
Sbjct: 701 LMVSHDISVIDSVCKEIWVSEQGTVKRFEGT 731

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKTY----PNTVL 418

Query: 522 IVEHDFIMATYLADKVI 538
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+ Q+VA+  A      I L+DEP + +D  QRI+  + I+R+   N KT  I+ HD
Sbjct: 494 LSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRW--RNGKTTVIITHD 551

Query: 527 F 527
            
Sbjct: 552 L 552

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 83/183 (45%), Gaps = 26/183 (14%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD----DPPEWSDIIKYFRGSELQNYFT 157
              Q+ G+VG +G GKST + ++ G    + G  +    D  +WS         EL     
Sbjct: 1019 SNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSCDINKWST-------KELHKTVA 1071

Query: 158  KMLEDDIKAIIKPQYVDNIPRAIKGPLQKVG-ELLKARMEKPEADVKMYIKILELQNVL- 215
             + ++    +++   + N    + G  + VG E L   +E     V +   I+ L N L 
Sbjct: 1072 LLQQN---PVLQFDTIRN--NLLYGLTETVGDEHLLNVLEY----VGLKSFIISLNNGLD 1122

Query: 216  -KRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK--QRLNAALIIRSLLDPTT 272
             K D S LSGG+ QR  +    ++   V + DE +S LDV   +++N  +  RS L P T
Sbjct: 1123 SKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGSRS-LAPVT 1181

Query: 273  YVI 275
             ++
Sbjct: 1182 IIV 1184

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDL 281
           LSGG+ Q+ A+  +  +  ++ + DEP S +D++QR+     I+   +  T VI + HDL
Sbjct: 494 LSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGKTTVI-ITHDL 552

>Kwal_0.327
          Length = 1019

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 75/184 (40%), Gaps = 24/184 (13%)

Query: 366 VLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKF 425
           +LN   G     EI+ +MG +G GKTT                  K+N S   ++   K 
Sbjct: 384 ILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKASGSIKINGSEITKQNLSKI 443

Query: 426 PGTVRQLFFK----------------RI--RAQFLNPQFQT-DVCKPLRIDDIIDQEV-- 464
            G V Q  F                 R+  +  F+  Q +   V + LRI DI D+ +  
Sbjct: 444 AGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQKRVYQVLEELRILDIKDRIIGD 503

Query: 465 ---QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
              + +SGGE +RV+I   L     +  +DEP++ LDS       + + R  LH  +T  
Sbjct: 504 DLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSNNANNVIECLVRLALHYNRTLI 563

Query: 522 IVEH 525
           +  H
Sbjct: 564 LSIH 567

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 87/202 (43%), Gaps = 16/202 (7%)

Query: 69  AITIINLPTNLDSQVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQK 128
            +T  N+  N+ S+   R   N        + +PG+++ L+G +G GK+T L ILA K K
Sbjct: 365 TLTFENIEYNIRSEKGERMILNGIS----GSVKPGEIMALMGGSGAGKTTLLDILAMKDK 420

Query: 129 PNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVG 188
                       S+I K       QN        D +  + P             L+   
Sbjct: 421 AGKASGSIKINGSEITK-------QNLSKIAGFVDQENFLLPTLTVYETVLNSALLRLPR 473

Query: 189 ELLKARMEKPEADVKMYIKILELQN-VLKRDVS-ALSGGELQRFAIGMSCVQQANVYMFD 246
           +L   + +K    V   ++IL++++ ++  D+   +SGGE +R +I    V   +V   D
Sbjct: 474 KLSFVQKQKRVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLD 533

Query: 247 EPSSYLDVKQRLNAALIIRSLL 268
           EP+S LD     NA  +I  L+
Sbjct: 534 EPTSGLDSN---NANNVIECLV 552

>CAGL0I08019g complement(782863..786720) highly similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, hypothetical start
          Length = 1285

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 100/235 (42%), Gaps = 45/235 (19%)

Query: 89  ANSFKLHRLPTPRP-GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYF 147
            +S  +H L    P G V+ ++G +G GK+T L +LA K    L         S  I Y 
Sbjct: 33  TDSVLVHPLSLDLPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTH-------SGEISYI 85

Query: 148 RGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE-----ADV 202
             ++  N      E      +   Y +N+  A   P Q V   L +R+   E     AD+
Sbjct: 86  LEADKNNVDDSSSEASFD--LNATYKENVTLAYV-PQQDV---LCSRLTCRETLMYAADL 139

Query: 203 KMYIKILELQNVLKRDVS------------------ALSGGELQRFAIGMSCVQQANVYM 244
           K+    +E   ++ + +                    LSGGE +R ++G   V   +V  
Sbjct: 140 KLDASKVEKTLIVNQLIDELGLKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMF 199

Query: 245 FDEPSSYLDVKQRLNAALIIRSLL-----DPTTYVICVEHDLSVLDYLSDFICIL 294
            DEP++ LD     +A L++++L      D  T+++ +    S + +L D++CIL
Sbjct: 200 LDEPTTGLDA---YSAYLVVKTLKKLAKEDGRTFILSIHQPRSDILFLFDYVCIL 251

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/239 (19%), Positives = 103/239 (43%), Gaps = 46/239 (19%)

Query: 70  ITIINLPTNLDSQVTHRYSANSFKLHRLPTPR----------PGQVLGLVGTNGIGKSTA 119
           IT++    +L+ + T  Y+  + K+      +          PG +  ++G +G GKS+ 
Sbjct: 669 ITVVAQDVDLEVKYTKLYNRKNHKIFEYENKKILQNVSAVFKPGMINAIMGPSGSGKSSF 728

Query: 120 LKILAGKQKPNLG---------RYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIKP 170
           L +++G+ + +L          + +D P   D+ K+      Q+      +D + A++  
Sbjct: 729 LNLISGRLESSLLVKFNTAGTIKLNDTPISQDMFKHLCSYVSQD------DDHLLAMLTV 782

Query: 171 QYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN-----VLKRDVSALSGG 225
           +   +   A++        L     +   +     I IL L++     +    +  +SGG
Sbjct: 783 RETFDFAAALR--------LKHLSKDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGG 834

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVL 284
           E +R ++G+  +    + + DEP+S LD      ++ I+  L +     +C EH+ +V+
Sbjct: 835 EKRRVSMGIQLLSDRPILLLDEPTSGLD---SFTSSTILEILEN-----LCSEHNKTVI 885

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 49/102 (48%), Gaps = 1/102 (0%)

Query: 457 DDIIDQE-VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           + II  E ++ +SGGE +RV++ + L     I L+DEP++ LDS       +++      
Sbjct: 820 NTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDEPTSGLDSFTSSTILEILENLCSE 879

Query: 516 NKKTAFIVEHDFIMATYLADKVIVFEGTPSKNAYARTPESLL 557
           + KT  +  H      ++    I+      + A+  +PE ++
Sbjct: 880 HNKTVILTIHQPRSELFMKFGNILLLAKSGRTAFNGSPEEMI 921

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 32/65 (49%)

Query: 461 DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           D   + LSGGE +R+++   +     +  +DEP+  LD+    +  K +++    + +T 
Sbjct: 171 DNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKTLKKLAKEDGRTF 230

Query: 521 FIVEH 525
            +  H
Sbjct: 231 ILSIH 235

>AFR232C [3424] [Homologous to ScYER036C (KRE30) - SH]
           (859615..861438) [1824 bp, 607 aa]
          Length = 607

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/192 (25%), Positives = 83/192 (43%), Gaps = 35/192 (18%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKA 166
            LVG NG+GKST LKI+ G+  P+ GR         +  Y + S+ Q   TK   + ++ 
Sbjct: 422 ALVGPNGVGKSTLLKIMTGELTPHGGRVSRHTH-VKLGVYSQHSQDQLDLTKSALEFVRD 480

Query: 167 IIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGGE 226
             K  ++    +  +G L + G   +A+  +                     ++ LS G+
Sbjct: 481 --KYAHISEDFQFWRGQLGRYGLTGEAQTAQ---------------------MATLSEGQ 517

Query: 227 LQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVEHDLS 282
             R    +  ++Q NV + DEP++ LD+         I SL D        V+ V HD  
Sbjct: 518 RSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAIDAFNGGVVVVSHDFR 570

Query: 283 VLDYLSDFICIL 294
           +LD ++  I ++
Sbjct: 571 LLDRIAKDIYVV 582

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 81/170 (47%), Gaps = 33/170 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY-----DDPPEWSDIIKYFRGSELQN 154
           G+  GL+G NG GKST LK +A ++ P   N+  Y      +P E+S +    R  E QN
Sbjct: 104 GRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVR--EAQN 161

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEA------DVKMYIKI 208
              K LED ++ I+    +++ P +         ELL    EK ++      + +  I +
Sbjct: 162 EL-KRLEDLVEKIL----LEDGPES---------ELLDPLYEKMDSMDPSTFESRAAIIL 207

Query: 209 LEL---QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
           + L      + R    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 208 IGLGFNAKTINRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 460 IDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
           I+++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 217 INRKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 272

Query: 520 AFIVEH--DFI 528
             +V H  DF+
Sbjct: 273 LVLVSHSQDFL 283

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 467 LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V H
Sbjct: 513 LSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAIDAF----NGGVVVVSH 567

Query: 526 DFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
           DF +   +A  + V E   +     R   S+L   NK  KN+
Sbjct: 568 DFRLLDRIAKDIYVVENKTA----TRWDGSILDYKNKLAKNV 605

>Scas_712.29
          Length = 610

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 120/530 (22%), Positives = 208/530 (39%), Gaps = 93/530 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY-----DDPPEWSDIIKYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P   N+  Y      +P E+S +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPENIDIYLLDEPAEPSEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADV---KMYIKILEL 211
              K LED ++  I  +          GP  ++ E L  RM+  + D    +  + ++ L
Sbjct: 165 EL-KRLEDLVEKYIVEE----------GPECELLEPLYERMDSLDPDTFESRAAVILIGL 213

Query: 212 ----QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK---------QRL 258
               + +LK+    +SGG   R A+  +   +  + + D+P+++LD++         +R 
Sbjct: 214 GFNSKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF 272

Query: 259 NAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSVYGVVTLPSSVREG----- 313
           +  L++ S        +C     ++LD  +  +    G    Y          +      
Sbjct: 273 DRTLVLVSHSQDFLNGVCT----NMLDMRAQKLTAYGGNYDSYWKTRSELETNQTKQYNK 328

Query: 314 -------INIFLDGHIPSENLRFRTEALQFRLAEAGEE-----LHSDAMRAFQYPPMKRT 361
                  I  F+       NL  + ++ Q  L +   +     + +D + +F++PP++R 
Sbjct: 329 QQEEIQHIKKFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVQADKVFSFRFPPVERL 388

Query: 362 ------------------QGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXX 403
                             + +   N++ G   DS I  ++G NG GK+T           
Sbjct: 389 PPPVLAFDSISFSYDGNPENNLYENLDFGVDMDSRI-ALVGPNGVGKSTLLKIMTGELTP 447

Query: 404 XXXXXXPKLNVSMK--PQKIAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLRIDDIID 461
                    +V +    Q    +   T   L F R +   ++  FQ    +  R     +
Sbjct: 448 QSGRVSRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQYWRGQLGRYGLTGE 507

Query: 462 -QEVQH--LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNK 517
            Q VQ   LS G+  RV   +LAL  P ++ L+DEP+  LD       ++ I  F     
Sbjct: 508 GQTVQMGTLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLAEAINEF----N 562

Query: 518 KTAFIVEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
               +V HDF +   +A  + V E   +     R   S+L    K  KN+
Sbjct: 563 GGVVVVSHDFRLLDKIAKDIFVVENKTA----TRWNGSILEYKTKLAKNV 608

>Scas_288.1
          Length = 494

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 94/214 (43%), Gaps = 22/214 (10%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWSDIIKYFRGSELQNY 155
            G+++ ++G  G G S+ LK+ AG+     G       YD  P+  +++K +R   + N 
Sbjct: 72  AGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQ-DEMMKKYRADVIYN- 129

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVL 215
               L+     +   Q +D    A K P ++V ++ K   E  ++  ++Y  I  L++  
Sbjct: 130 --GELDVHFPYLTVQQTLD-FAIACKTPAKRVNDVSKE--EYIKSTRELYATIFGLRHTY 184

Query: 216 KRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR---SL 267
              V       +SGGE +R +I  +      +Y +D  +  LD    L  A  IR   +L
Sbjct: 185 NTKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIRIMTNL 244

Query: 268 LDPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
           L  T +V   +   ++ +   D + +LY    +Y
Sbjct: 245 LKSTAFVTIYQASENIYETF-DKVTVLYSGRQIY 277

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR  I+ N  K TAF
Sbjct: 193 VRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDASTALEYAKAIR--IMTNLLKSTAF 250

Query: 522 IV 523
           + 
Sbjct: 251 VT 252

>YER036C (YER036C) [1461] chr5 complement(223366..225198) Member of
           the non-transporter group of the ATP-binding cassette
           (ABC) superfamily [1833 bp, 610 aa]
          Length = 610

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 84/194 (43%), Gaps = 37/194 (19%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTK-MLEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR         +  Y + S+ Q   TK  LE   
Sbjct: 424 IALVGPNGVGKSTLLKIMTGELTPQSGRVSRHTH-VKLGVYSQHSQDQLDLTKSALE--- 479

Query: 165 KAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSG 224
              ++ +Y  NI +  +    ++G                Y    E Q V    ++ LS 
Sbjct: 480 --FVRDKY-SNISQDFQFWRGQLGR---------------YGLTGEGQTV---QMATLSE 518

Query: 225 GELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVEHD 280
           G+  R    +  ++Q NV + DEP++ LD+         I SL D        V+ V HD
Sbjct: 519 GQRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVSHD 571

Query: 281 LSVLDYLSDFICIL 294
             +LD ++  I ++
Sbjct: 572 FRLLDKIAQDIFVV 585

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 82/166 (49%), Gaps = 25/166 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRYDDPPEWSDIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK LA ++ P     ++   D+P E S++    +  +E Q+  
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPEHIDIYLLDEPAEPSELSALDYVVTEAQHEL 166

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADV---KMYIKILEL-- 211
            K +ED ++  I             GP  ++ E L  RM+  + D    +  I ++ L  
Sbjct: 167 -KRIEDLVEKTILED----------GPESELLEPLYERMDSLDPDTFESRAAIILIGLGF 215

Query: 212 --QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
             + +LK+    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 216 NKKTILKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  
Sbjct: 222 KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLV 277

Query: 522 IVEH--DFI------MATYLADKVIVFEGTPSKNAYARTPESLLTGCNK 562
           +V H  DF+      M    A K+  + G  + ++Y +T   L T   K
Sbjct: 278 LVSHSQDFLNGVCTNMIDMRAQKLTAYGG--NYDSYHKTRSELETNQMK 324

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 47/109 (43%), Gaps = 12/109 (11%)

Query: 462 QEVQHLSGGELQRVAIV---LALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK 518
           Q VQ  +  E QR  +V   LAL  P ++ L+DEP+  LD       +  I  F      
Sbjct: 509 QTVQMATLSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NG 563

Query: 519 TAFIVEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
              +V HDF +   +A  + V E   +     R   S+L   NK  KN+
Sbjct: 564 GVVVVSHDFRLLDKIAQDIFVVENKTA----TRWDGSILQYKNKLAKNV 608

>KLLA0D04554g complement(385733..388801) similar to sp|P25371
           Saccharomyces cerevisiae YCR011c ADP1 ATP-dependent
           permease, start by similarity
          Length = 1022

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 113/286 (39%), Gaps = 49/286 (17%)

Query: 352 AFQYPPMKRTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPK 411
            ++  P K    D VLN   G     E+L +MG +G GKTT                  K
Sbjct: 376 TYEVSPAKNVTAD-VLNEVTGSVKPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIK 434

Query: 412 LN-VSMKPQKIAPKFPGTVRQ---------LFFKRIRAQFLNPQFQT----------DVC 451
           +N V +   K + K  G V Q         ++   + +  L    Q           DV 
Sbjct: 435 VNGVDIDKDKYS-KIIGFVDQEDYLLPTLTVYETVLNSALLRLPRQLSFSAKQRRVYDVL 493

Query: 452 KPLRIDDIIDQEV-----QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICS 506
           + LRI DI D+ +     + +SGGE +RV+I   L     +  +DEP++ LD+       
Sbjct: 494 EELRIFDIRDRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDANNANNVI 553

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATY-LADKVIVFEGTPSKNAYARTPESLLTGCNKFLK 565
           + + R   H  KT  +  H    + + L DK+++   +  K  Y+     +    N+FLK
Sbjct: 554 ECLVRLANHYNKTLVLSIHQPRSSIFQLFDKLVLL--SNGKMVYSGDAHKV----NEFLK 607

Query: 566 N---------------LNVTFRRDPNSFRPRINKLDSQMDKEQKLS 596
           N               ++VTF       R  I+ L++ +   + L+
Sbjct: 608 NEGYACPPDYNIADYLIDVTFEPSKFVTRANIDDLEATLPTTEGLN 653

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 81/178 (45%), Gaps = 28/178 (15%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWSDIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K K           G   D  ++S II +    + 
Sbjct: 398 KPGEMLAIMGGSGAGKTTLLDILAMKNKTGKVTGSIKVNGVDIDKDKYSKIIGFV---DQ 454

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQ 212
           ++Y    L   +   +    +  +PR          +L  +  ++   DV   ++I +++
Sbjct: 455 EDYLLPTLT--VYETVLNSALLRLPR----------QLSFSAKQRRVYDVLEELRIFDIR 502

Query: 213 N-VLKRDVS-ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLL 268
           + V+  +    +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+
Sbjct: 503 DRVIGSEYERGISGGEKRRVSIACELVTSPQVLFLDEPTSGLDAN---NANNVIECLV 557

>Kwal_33.15561
          Length = 1297

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (56%), Gaps = 4/74 (5%)

Query: 453  PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            P R+  +ID   Q LSGG++QR+AIV AL     + ++DE ++ LD+    I S+ ++  
Sbjct: 1185 PKRLHSVID--TQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHH 1242

Query: 513  ILHNKKTAFIVEHD 526
            + H   T  +V H 
Sbjct: 1243 LYHT--TTLVVTHS 1254

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 82/187 (43%), Gaps = 27/187 (14%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
            G+++GL+GT+G GKST   +L             P E   I     G+++  +  K L  
Sbjct: 1087 GEIVGLIGTSGSGKSTLWSLLTRLY---------PVENGSI--SIDGTDINQWDRKALRS 1135

Query: 163  DIKAI-IKPQYVDN--IPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKR-- 217
             I  +  KP +     I     G ++KV +       +   ++ + + +LE  N   +  
Sbjct: 1136 CIAVVEQKPLFFSGSIIENLTYGLMRKVSD-------EEVNELLLTLGMLEFVNSTPKRL 1188

Query: 218  ----DVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY 273
                D   LSGG++QR AI  + +++  + + DE +S LD +     +  ++  L  TT 
Sbjct: 1189 HSVIDTQLLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARHSFIMSEFVKHHLYHTTT 1248

Query: 274  VICVEHD 280
            ++    +
Sbjct: 1249 LVVTHSE 1255

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 449 DVCKPLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKV 508
           D+ K L  D II      LSGGE QRVA+  A    + I ++DE  +  D   + +  + 
Sbjct: 484 DLAKGL--DTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEA 541

Query: 509 IRRFILHNKKTAFIVEHDF 527
           IR +     +T  I+ H+ 
Sbjct: 542 IRFW--RKGRTTIILTHEL 558

>CAGL0K10472g 1020016..1022274 highly similar to sp|P43535
           Saccharomyces cerevisiae YFR009w GCN20 positive effector
           of GCN2P, start by similarity
          Length = 752

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 71/180 (39%), Gaps = 29/180 (16%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG GK+T LK++  + +P  G     P     I YF    + +        D  
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYVSRNPRLR--IGYFTQHHVDSMDLSTSAVDWM 618

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
           +   P   D   R   G     G L   +M+                         LSGG
Sbjct: 619 SKTFPGKTDEEYRRHLGSFGITGTLGLQKMQ------------------------LLSGG 654

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLSVLD 285
           +  R A    C+   ++ + DEPS++LD         ++ ++ + T  ++ V HD+SV++
Sbjct: 655 QKSRVAFAALCLNNPHILILDEPSNHLDTT---GIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/207 (24%), Positives = 88/207 (42%), Gaps = 27/207 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILA--------------------GKQKPNLGRYDDPPEWSD 142
           G   GLVG NGIGKST L+ L+                    G +   L    D   W  
Sbjct: 225 GHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADVWRK 284

Query: 143 --IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGE-LLKARMEKPE 199
             + +  + +E      K+ E+  +  ++ + +DN    +   L ++ E L+    +K E
Sbjct: 285 QLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKLVDMESDKAE 344

Query: 200 ADVKMYIKILELQNVLKRD-VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRL 258
           A     +  L      ++   ++ SGG   R ++  +   Q ++ + DEPS+ LDV    
Sbjct: 345 ARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIA 404

Query: 259 NAALIIRSLLDPTTYVICVEHDLSVLD 285
             A  ++S   P+T V+ V HD + L+
Sbjct: 405 YLAEYLKSY--PST-VLTVSHDRAFLN 428

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 66/165 (40%), Gaps = 36/165 (21%)

Query: 352 AFQYPPMKRTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXX--XXXXXXX 409
           +F Y P K    D  L+++     DS I  ++G NG GKTT                   
Sbjct: 538 SFGYSPDKLLLKDVNLDIQM----DSRI-ALVGANGCGKTTLLKVMLEQLRPLSGYVSRN 592

Query: 410 PKLNVSMKPQK--------------IAPKFPGTVRQLFFKRIRAQFLNPQFQTDVCKPLR 455
           P+L +    Q               ++  FPG   + + +R    F        +   L 
Sbjct: 593 PRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEY-RRHLGSF-------GITGTLG 644

Query: 456 IDDIIDQEVQHLSGGELQRVAIV-LALGLPADIYLIDEPSAYLDS 499
           +     Q++Q LSGG+  RVA   L L  P  I ++DEPS +LD+
Sbjct: 645 L-----QKMQLLSGGQKSRVAFAALCLNNPH-ILILDEPSNHLDT 683

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 33/77 (42%), Gaps = 4/77 (5%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           Q     SGG   R+++  AL    D+ L+DEPS  LD       ++ ++ +      T  
Sbjct: 363 QPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPSIAYLAEYLKSY----PSTVL 418

Query: 522 IVEHDFIMATYLADKVI 538
            V HD      +A  +I
Sbjct: 419 TVSHDRAFLNEVATDII 435

>CAGL0M13739g complement(1346231..1348414) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1, hypothetical
           start
          Length = 727

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 61/137 (44%), Gaps = 6/137 (4%)

Query: 459 IIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK 518
           I+ +    +SGGE QR+AI   L   ADI   DE ++ LD+       + IRR     +K
Sbjct: 594 IVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEK 653

Query: 519 TAFIVEHDFIMATYLADKVIVF-EGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDPNS 577
           T+  + H  +     ADK+IV  EGT  +     T + LL   N   K L    + D + 
Sbjct: 654 TSVYIAHR-LRTIADADKIIVLEEGTVREEG---THQELLARENSLYKEL-WRIQEDLDL 708

Query: 578 FRPRINKLDSQMDKEQK 594
               IN     ++K  K
Sbjct: 709 LEDEINHEKETLEKLNK 725

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 34/166 (20%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLE 161
            G    + G +G GKST LK++         R+ DP E   ++    G +++ Y    L 
Sbjct: 490 AGMKTAIAGPSGSGKSTVLKLVF--------RFYDPEEGRVLVN---GVDVREYDIDQLR 538

Query: 162 DDIKAIIK--PQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDV 219
             I  + +  P + D I   +K            R+E  + ++   I   +L +++ +  
Sbjct: 539 KAIGVVPQDTPLFNDTIWENVK----------FGRIEASDEEITRVIDKAQLSDLIAKLP 588

Query: 220 SA-----------LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDV 254
                        +SGGE QR AI    ++ A++  FDE +S LD 
Sbjct: 589 QGSSTIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDT 634

>CAGL0B03487g complement(345399..348536) highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 or sp|P53978
           Saccharomyces cerevisiae YNL014w HEF3, start by
           similarity
          Length = 1045

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 80/195 (41%), Gaps = 34/195 (17%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A  Q   +  +  P E                 T  +E 
Sbjct: 456 GRRYGLCGPNGAGKSTLMRAIANGQ---VDGFPTPEE---------------CMTVYVEH 497

Query: 163 DIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSAL 222
           DI        V +              ++ + +   EA     ++    + ++   +S+L
Sbjct: 498 DIDGTHADTSVLDF-------------VVSSEVGTKEAITAKLVEFGFTEEMINMPISSL 544

Query: 223 SGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHDLS 282
           SGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       + V HD  
Sbjct: 545 SGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSVIVSHDSG 601

Query: 283 VLDYLSDFICILYGV 297
            LD +  +I    G+
Sbjct: 602 FLDNVCQYIIHYEGL 616

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           +++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 EEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSVIVSHDSGFLDNVCQYIIHYEG 615

>Sklu_2152.5 YER036C, Contig c2152 6647-8473 reverse complement
          Length = 608

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 83/196 (42%), Gaps = 41/196 (20%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKM-LEDDI 164
           + LVG NG+GKST LKI+ G+  P  GR         +  Y + S+ Q   TK  LE   
Sbjct: 422 IALVGPNGVGKSTLLKIMTGQLMPQSGRVSRHTH-VKLGVYSQHSQDQLDLTKSPLE--- 477

Query: 165 KAIIKPQY--VDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSAL 222
              ++ +Y  +    +  +G L + G   +A+  +                     +  L
Sbjct: 478 --FVRDKYPNISQDFQYWRGQLGRYGLTGEAQTSQ---------------------MGTL 514

Query: 223 SGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVE 278
           S G+  R    +  ++Q NV + DEP++ LD+         I SL D        V+ V 
Sbjct: 515 SEGQRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVS 567

Query: 279 HDLSVLDYLSDFICIL 294
           HD  +LD ++  I ++
Sbjct: 568 HDFRLLDKIAQDIFVV 583

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 81/165 (49%), Gaps = 23/165 (13%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY--DDPPEWSDIIKY-FRGSELQNYF 156
           G+  GL+G NG GKST LK +A ++ P   N+  Y  D+P E S++    +  +E QN  
Sbjct: 105 GRHYGLLGENGCGKSTFLKAIATREYPIPENIDVYLLDEPAEPSELSALDYVVTEAQNEL 164

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADV---KMYIKILEL-- 211
            K LED ++ II             GP  ++ E L  +M+  + +    +  + ++ L  
Sbjct: 165 -KRLEDLVEKIILED----------GPESELLEPLYEKMDSMDPNTFESRAAVILIGLGF 213

Query: 212 -QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
               + +    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 214 NSKTITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 258

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 460 IDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
           I ++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 218 ITKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 273

Query: 520 AFIVEH--DFI 528
             +V H  DF+
Sbjct: 274 LVLVSHSQDFL 284

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 467 LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V H
Sbjct: 514 LSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSH 568

Query: 526 DFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
           DF +   +A  + V E   +     R   S+L   NK  KN+
Sbjct: 569 DFRLLDKIAQDIFVVEHKTA----TRWNGSILDYKNKLAKNV 606

>KLLA0C04477g complement(409543..413304) similar to sp|Q08234
           Saccharomyces cerevisiae YOL075c, start by similarity
          Length = 1253

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 98/216 (45%), Gaps = 28/216 (12%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWS-DIIKYFRGSELQNYFTKMLE 161
           GQ++ ++G +G GK+T L +LAGK   ++  YD   ++S D  K   GS+         +
Sbjct: 41  GQLMAIIGGSGSGKTTMLNVLAGKTNSSI-NYDGEIQYSRDAAK--EGSKA--------D 89

Query: 162 DDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE--ADVKMYIKILELQNVLKRDV 219
           + +      Q+     R       ++   LK  + K E  + V+  I  L L++  +  V
Sbjct: 90  EKVTTAYLTQHDALAARLTCRETLRIAADLKLHLPKQERYSLVEELIAELGLRDCSETFV 149

Query: 220 S-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSL-----LD 269
                  LSGGE +R +I +  +   +V   DEP++ LD     +A L+I++L       
Sbjct: 150 GDSINKGLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDA---YSAFLLIKTLKKLCEHG 206

Query: 270 PTTYVICVEHDLSVLDYLSDFICILY-GVPSVYGVV 304
             T ++ +    S + +  D +C+L  G P   G V
Sbjct: 207 GRTIIMSIHQPRSDILFALDQVCLLSKGFPMYCGAV 242

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 451 CKPLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           C    + D I++    LSGGE +R++I + +     +  +DEP+  LD+    +  K ++
Sbjct: 144 CSETFVGDSINK---GLSGGEKRRLSIAVQMIANPSVLFLDEPTTGLDAYSAFLLIKTLK 200

Query: 511 RFILHNKKTAFIVEH 525
           +   H  +T  +  H
Sbjct: 201 KLCEHGGRTIIMSIH 215

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 76/163 (46%), Gaps = 20/163 (12%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRYDDPPEWSDIIKYFRGSELQNYFTKM 159
           RP  +  ++G +G GK++ L +++ +   N   ++++    S  I + +   +++ F  +
Sbjct: 683 RPNAINAIMGPSGSGKTSLLNLISDRVCSNFFTKFNE----SGRIIFNQQPVMKSMFKSV 738

Query: 160 L----EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN-- 213
                +DD   +      + +  A +  L    E       + E  V+  I  L L+N  
Sbjct: 739 CCYVSQDDNHLLPNLTVYETLKYAARLRLSHHNE------SRIETRVRTLISDLGLKNCA 792

Query: 214 --VLKRD-VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
             ++  D +  +SGGE +R +IG+  +   +V + DEP+S LD
Sbjct: 793 NTLVGNDLIKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLD 835

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDS 499
           ++ +SGGE +RV+I + L     + L+DEP++ LDS
Sbjct: 801 IKGISGGEKRRVSIGIQLLTDPSVLLLDEPTSGLDS 836

>Kwal_0.167
          Length = 1044

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 29/186 (15%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +S+LSGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 ISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFICILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD ++ +I    G+        +   V++          P+    +   A  L+F
Sbjct: 598 HDSGFLDNVTQYIIHYEGLKLRKYKGNMSEFVKK---------CPTAKSYYELGASELEF 648

Query: 337 RLAEAG---------EELHSDAMRAFQYPPMKRTQ-GDFVLNVEPGEFSDSEILVMMGEN 386
           R  E G         + +   +   FQYP   + Q  D        + S S  + ++G N
Sbjct: 649 RFPEPGFLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPN 703

Query: 387 GTGKTT 392
           G GK+T
Sbjct: 704 GAGKST 709

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMINMPISSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSIIVSHDSGFLDNVTQYIIHYEG 615

 Score = 29.6 bits (65), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     S
Sbjct: 879 CAMLGLDSELVSHSRIRGLSGG--QKVKLVLAACSWQRPHLIVLDEPTNYLDRDSLGALS 936

Query: 507 KVIRRF 512
           K ++ F
Sbjct: 937 KALKAF 942

>ABR126W [718] [Homologous to ScYOR153W (PDR5) - NSH; ScYDR406W
            (PDR15) - NSH] complement(628623..633161) [4539 bp, 1512
            aa]
          Length = 1512

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 64/213 (30%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L +LA + +                                
Sbjct: 881  KPGTLTALMGSSGAGKTTLLDVLANRVR-------------------------------- 908

Query: 161  EDDIKAIIKPQYVDNIPRA--------------IKGPLQKVGELLK--ARMEKP----EA 200
               +  +    +VD +PR               + G  Q V + LK  A + +P    EA
Sbjct: 909  ---VGVVTGDMFVDGLPRGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLRQPQSVSEA 965

Query: 201  DVKMY----IKILELQNVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSY 251
            ++  Y    I++LE++      V     G    + +R  IG+  V +  + +F DEP+S 
Sbjct: 966  EIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSG 1025

Query: 252  LDVKQRLNAALIIRSLLDPTTYVICVEHDLSVL 284
            LD +   +   ++R L +    V+C  H  S +
Sbjct: 1026 LDSQTAWSVCQLMRKLANHGQAVLCTIHQPSAI 1058

>CAGL0I04862g complement(438338..442861) highly similar to sp|P32568
           Saccharomyces cerevisiae YDR011w SNQ2 multidrug
           resistance protein, hypothetical start
          Length = 1507

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 24/216 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWSDIIKYFRGSELQN 154
           R G+++ ++G  G G S+ LK+ AG+     G       YD  P+  +++K ++   + N
Sbjct: 186 RAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQ-KEMMKRYKPDVIYN 244

Query: 155 YFTKMLEDDIKA-IIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN 213
                 E D+    +  Q   +   A K P ++V ++  +R E   +   ++  I  L++
Sbjct: 245 -----GEQDVHFPHLTVQQTLDFAIACKTPSKRVNDV--SREEYIASTRDLHATIFGLRH 297

Query: 214 VLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR--- 265
                V       +SGGE +R +I  + V + ++Y +D  +  LD    L  A  IR   
Sbjct: 298 TYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITT 357

Query: 266 SLLDPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
           +LL  T +V   +   ++ +   D + +LY    +Y
Sbjct: 358 NLLGSTAFVTIYQASENIYETF-DKVTVLYTGRQIY 392

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 85/187 (45%), Gaps = 23/187 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWSDIIKYFRGSELQN 154
            +PG +  L+G +G GK+T L  LA +   N+G        +  P   DI    R   +Q 
Sbjct: 884  KPGTLTALMGESGAGKTTLLNTLAQR---NVGIITGDMLVNGKP--IDISFERRTGYVQQ 938

Query: 155  YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNV 214
                + E  ++  +  Q+   + RA   P ++       +ME  E  +K+ + + E  + 
Sbjct: 939  QDIHISELTVRESL--QFSARMRRAQNVPEEE-------KMEHVERIIKV-LDMEEYADA 988

Query: 215  LKRDVS-ALSGGELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTT 272
            L  DV   L+  + ++ +IG+  V + ++ +F DEP+S LD +       +++ L     
Sbjct: 989  LVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLAKAGQ 1048

Query: 273  YVICVEH 279
             ++C  H
Sbjct: 1049 SILCTIH 1055

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR        TAF+ 
Sbjct: 308 VRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRITTNLLGSTAFVT 367

>YLR249W (YEF3) [3645] chr12 (636782..639916) Translation elongation
           factor EF-3A, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 3/79 (3%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +SALSGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       I + 
Sbjct: 541 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 597

Query: 279 HDLSVLDYLSDFICILYGV 297
           HD   LD + ++I    G+
Sbjct: 598 HDSVFLDNVCEYIINYEGL 616

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+  + HD +    + + +I +EG
Sbjct: 590 GITSITISHDSVFLDNVCEYIINYEG 615

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 13/106 (12%)

Query: 451 CKPLRID-DIIDQE-VQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D +I+    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     S
Sbjct: 879 CSMLGLDPEIVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALS 936

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG---TPSKNAY 549
           K ++ F    +    I+ H       L ++V   +    TPS + +
Sbjct: 937 KALKEF----EGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNW 978

>YOL075C (YOL075C) [4745] chr15 complement(189657..193541) Member of
           the ATP-binding cassette (ABC) superfamily, has
           similarity to Drosophila white protein [3885 bp, 1294
           aa]
          Length = 1294

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 78/157 (49%), Gaps = 8/157 (5%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL-GRYDDPPEWSDIIKYFRGSEL--QNYFT 157
           +PG +  ++G +G GKS+ L +++G+ K ++  ++D     S +    + SEL  +N  +
Sbjct: 718 KPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSG--SIMFNDIQVSELMFKNVCS 775

Query: 158 KMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVK-MYIKILELQNVLK 216
            + +DD   +      + +  A    L  + E    RME+ +  ++ + +K  E   +  
Sbjct: 776 YVSQDDDHLLAALTVKETLKYAAALRLHHLTE--AERMERTDNLIRSLGLKHCENNIIGN 833

Query: 217 RDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
             V  +SGGE +R  +G+  +    + + DEP+S LD
Sbjct: 834 EFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLD 870

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 104/236 (44%), Gaps = 38/236 (16%)

Query: 90  NSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYF-- 147
           N+F +  LP+   G V+ ++G +G GK+T L +LA K    L         +  I+Y   
Sbjct: 46  NTFSMD-LPS---GSVMAVMGGSGSGKTTLLNVLASKISGGLTH-------NGSIRYVLE 94

Query: 148 -RGSELQNYFTK--MLEDDIKAIIKPQYVDNIPRA-IKGPLQKVGELLK----ARMEKPE 199
             GSE      K   L+     I K   +  +P+  +  P     E LK     ++   E
Sbjct: 95  DTGSEPNETEPKRAHLDGQDHPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSSE 154

Query: 200 ADVKMYIKIL-------ELQNVLKRDVS--ALSGGELQRFAIGMSCVQQANVYMFDEPSS 250
              K+ ++ L       +  + L  D S   LSGGE +R +IG   +   ++   DEP++
Sbjct: 155 RTKKLMVEQLIEELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTT 214

Query: 251 YLDVKQRLNAALIIRSLL-----DPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
            LD     +A L+I++L      D  T+++ +    S + +L D +CIL     VY
Sbjct: 215 GLDA---YSAFLVIKTLKKLAKEDGRTFIMSIHQPRSDILFLLDQVCILSKGNVVY 267

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 457 DDIIDQE-VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           ++II  E V+ +SGGE +RV + + L     I L+DEP++ LDS       +++ +    
Sbjct: 828 NNIIGNEFVKGISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATILEILEKLCRE 887

Query: 516 NKKTAFIVEH 525
             KT  I  H
Sbjct: 888 QGKTIIITIH 897

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 32/65 (49%)

Query: 461 DQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTA 520
           D   + LSGGE +R++I   +     I  +DEP+  LD+    +  K +++    + +T 
Sbjct: 180 DNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEDGRTF 239

Query: 521 FIVEH 525
            +  H
Sbjct: 240 IMSIH 244

>Sklu_2442.20 YLR249W, Contig c2442 35272-38406 reverse complement
          Length = 1044

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 29/186 (15%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +++LSGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFICILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD +  +I    G+             R  ++ F+    P+    +   A  L+F
Sbjct: 598 HDSGFLDSVCQYIIHYEGLKL--------RKYRGNLSEFVK-KCPTAKSYYELGASELEF 648

Query: 337 RLAEAG---------EELHSDAMRAFQYPPMKRTQ-GDFVLNVEPGEFSDSEILVMMGEN 386
           R  E G         + +   +   FQYP   + Q  D        + S S  + ++G N
Sbjct: 649 RFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKPQISDISF-----QCSLSSRIAVIGPN 703

Query: 387 GTGKTT 392
           G GK+T
Sbjct: 704 GAGKST 709

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSIIVSHDSGFLDSVCQYIIHYEG 615

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 80/234 (34%), Gaps = 88/234 (37%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RYDDPPEWSD 142
           + ++G NG GKST + +L G+  P +G                         D  P  S+
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTIGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSE----LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKG--------------- 182
            I++ F+  E    +     ++ EDD +A+ K   +D  PR I G               
Sbjct: 755 YIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 183 ----------------PLQKVGELLKARMEKPEADVKMYIKI------------------ 208
                           P+  V      R E  E+  KM  ++                  
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWIPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 209 ---------LELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
                    L+ + V    +  LSGG+  +  +     Q+ ++ + DEP++YLD
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 928

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     S
Sbjct: 879 CAMLGLDAELVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALS 936

Query: 507 KVIRRF 512
           K ++ F
Sbjct: 937 KALKAF 942

>Scas_108.1
          Length = 335

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 11/131 (8%)

Query: 179 AIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVS-----ALSGGELQRFAIG 233
           A K P ++V  + KA   K   +  +Y  I  L++     V       +SGGE +R +I 
Sbjct: 1   ACKTPAKRVNNISKAEYVKTTRE--LYATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIA 58

Query: 234 MSCVQQANVYMFDEPSSYLDVKQRLNAALIIR---SLLDPTTYVICVEHDLSVLDYLSDF 290
            + V   +VY +D  +  LD    L  A  IR   +LL+ T +V   +   ++ +   D 
Sbjct: 59  EALVANGSVYCWDNATRGLDASTALEYAKAIRIMTNLLESTAFVTIYQASENIYETF-DK 117

Query: 291 ICILYGVPSVY 301
           + +LY    +Y
Sbjct: 118 VTVLYDGRQIY 128

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN--KKTAF 521
           V+ +SGGE +RV+I  AL     +Y  D  +  LD+   +  +K IR  I+ N  + TAF
Sbjct: 44  VRGVSGGERKRVSIAEALVANGSVYCWDNATRGLDASTALEYAKAIR--IMTNLLESTAF 101

Query: 522 IV 523
           + 
Sbjct: 102 VT 103

>Scas_573.11
          Length = 689

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +SALSGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       I + 
Sbjct: 581 ISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSITIS 637

Query: 279 HDLSVLDYLSDFI 291
           HD   LD + ++I
Sbjct: 638 HDSVFLDSVCEYI 650

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 574 DEMIAMPISALSGGWKMKLALARAVLRNADILLLDEPTNHLDT----VNVAWLVNYLNTC 629

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+  + HD +    + + +I +EG
Sbjct: 630 GITSITISHDSVFLDSVCEYIINYEG 655

>YPL226W (NEW1) [5223] chr16 (121767..125357) Member of the
           non-transporter group of the ATP-binding cassette (ABC)
           superfamily, also a prion responsible for the [NU+]
           determinant [3591 bp, 1196 aa]
          Length = 1196

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 77/185 (41%), Gaps = 34/185 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +  D
Sbjct: 597 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDL--D 648

Query: 163 DIKAIIKPQYVDNIPRA-IKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSA 221
            +  I   + + +  R  I   L+ VG   + R +                      V +
Sbjct: 649 LVSFIALDEELQSTSREEIAAALESVGFDEERRAQT---------------------VGS 687

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV-ICVEHD 280
           LSGG   +  +  + +Q+A++ + DEP+++LDV    N   +   LL+ T    + V HD
Sbjct: 688 LSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLEEYLLEHTDITSLIVSHD 744

Query: 281 LSVLD 285
              LD
Sbjct: 745 SGFLD 749

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (50%), Gaps = 5/81 (6%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 683 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLEEYLLEHTDITS 738

Query: 521 FIVEHDFIMATYLADKVIVFE 541
            IV HD      +   +I +E
Sbjct: 739 LIVSHDSGFLDTVCTDIIHYE 759

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR   D +  V+ + 
Sbjct: 1030 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIR---DWSGGVVMIS 1086

Query: 279  HD 280
            H+
Sbjct: 1087 HN 1088

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 109 VGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           +G NG GKST +K+L G+  PN G+ +  P
Sbjct: 845 LGPNGAGKSTLIKLLTGELVPNEGKVEKHP 874

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 6/58 (10%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK 518
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +
Sbjct: 1033 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDWSGGVVMISHNNE 1090

>YNL014W (HEF3) [4572] chr14 (606317..609451) Translation elongation
           factor EF-3B, member of the non-transporter group of the
           ATP-binding cassette (ABC) superfamily [3135 bp, 1044
           aa]
          Length = 1044

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 38/197 (19%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G+  GL G NG GKST ++ +A       G+ D  P   +    +   ++ N  + M   
Sbjct: 456 GRRYGLCGPNGAGKSTLMRSIAN------GQVDGFPTQDECRTVYVEHDIDNTHSDM--- 506

Query: 163 DIKAIIKPQYVDNIPR--AIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVS 220
              +++   Y  N+     I   L++ G      +E P                    ++
Sbjct: 507 ---SVLDFVYSGNVGTKDVITSKLKEFG-FSDEMIEMP--------------------IA 542

Query: 221 ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHD 280
           +LSGG   + A+  + ++ A++ + DEP+++LD    +N   ++  L       + V HD
Sbjct: 543 SLSGGWKMKLALARAVLKDADILLLDEPTNHLDT---VNVEWLVNYLNTCGITSVIVSHD 599

Query: 281 LSVLDYLSDFICILYGV 297
              LD +  +I    G+
Sbjct: 600 SGFLDKVCQYIIHYEGL 616

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +  + +  ++   
Sbjct: 534 DEMIEMPIASLSGGWKMKLALARAVLKDADILLLDEPTNHLDT----VNVEWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSVIVSHDSGFLDKVCQYIIHYEG 615

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 13/106 (12%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     S
Sbjct: 879 CAMLGLDSELVSHSRIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALS 936

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG---TPSKNAY 549
           K ++ F    +    I+ H       L D+V   +    TPS + +
Sbjct: 937 KALKAF----EGGVIIITHSAEFTKNLTDEVWAVKDGKMTPSGHNW 978

>KLLA0A01452g 130078..131901 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 607

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 78/193 (40%), Gaps = 35/193 (18%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR         +  Y + S+ Q   TK   + ++
Sbjct: 421 IALVGPNGVGKSTLLKIMTGQLTTQSGRVSRHSHVK-LGVYSQHSQDQLDLTKSALEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
                   D  P   +      G+L +  +      V+M                 LS G
Sbjct: 480 --------DKYPHVSQDFQYWRGQLGRYGLTGEGQTVQM---------------GTLSEG 516

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVEHDL 281
           +  R    +  ++Q NV + DEP++ LD+         I SL D        V+ V HD 
Sbjct: 517 QRSRVVFALLALEQPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVSHDF 569

Query: 282 SVLDYLSDFICIL 294
            +LD ++  I ++
Sbjct: 570 RLLDKIAKDIFVV 582

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 460 IDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
           I+++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 272

Query: 520 AFIVEH--DFI--MATYLAD----KVIVFEGTPSKNAYARTPESLLT 558
             +V H  DF+  + T + D    K++ + G  + ++Y +T   L T
Sbjct: 273 LVLVSHSQDFLNGVCTNMLDMRLQKLMAYGG--NYDSYVKTRSELET 317

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 78/167 (46%), Gaps = 27/167 (16%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP---NLGRY-----DDPPEWSDIIKYFRGSELQN 154
           G+  GL+G NG GKST LK +A ++ P   N+  Y      +P E+S +    R ++ + 
Sbjct: 104 GRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQGE- 162

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEA---DVKMYIKILEL 211
              K LED ++ I+             GP   + E L  RM+  +    + +  I ++ L
Sbjct: 163 --LKRLEDLVEKILLED----------GPESDLLEPLYERMDDMDPSTFESRAAIILIGL 210

Query: 212 ---QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
                 + +    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 211 GFNSKTINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 467 LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V H
Sbjct: 513 LSEGQRSRVVFALLALEQP-NVLLLDEPTNGLDIPTIDSLADAINEF----NGGVVVVSH 567

Query: 526 DFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
           DF +   +A  + V E   +     R   S+L   NK  KN+
Sbjct: 568 DFRLLDKIAKDIFVVEHKTA----TRWDGSILDYKNKLAKNV 605

>Scas_40.1
          Length = 203

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 91/225 (40%), Gaps = 52/225 (23%)

Query: 39  IEVAPTSKVAFISENLCIGCGICVKKCPFGAITIINLPTNLDSQVTHRYSANSFKLHRLP 98
           +  APT +VA    NL I                  + T  +  + H  S +      LP
Sbjct: 10  LSFAPTIRVAVQVRNLSI------------------IATKSNKTIVHDVSMD------LP 45

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYDDPPEWSDIIKYFRGSELQNY 155
           +   G ++ +VG +G GK+T L +LA K    L   G Y+   +         GS  Q+ 
Sbjct: 46  S---GSIMAIVGGSGSGKTTLLNVLASKISRGLKMEGSYEFVADG--------GSRQQDI 94

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGEL-LKARMEKPEADVKMYIKILELQN- 213
            T        A +  Q V +    ++  L    +L LKA  ++    V+  I  L L+  
Sbjct: 95  TT--------AYLAQQDVSSPKLTVRETLSYAADLKLKAPRQERRRLVEELIAELGLKEC 146

Query: 214 ----VLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDV 254
               V   +   LSGGE +R +IG+  +   ++   DEP++ LD 
Sbjct: 147 SDTRVGDSEHRGLSGGEKRRLSIGVQMISNPSLLFLDEPTTGLDA 191

>CAGL0C02343g 236840..238672 highly similar to sp|P40024
           Saccharomyces cerevisiae YER036c, start by similarity
          Length = 610

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 81/196 (41%), Gaps = 43/196 (21%)

Query: 107 GLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTK-MLEDDIK 165
            LVG NG+GKST LKI+ G+  P  GR         +  Y + S+ Q   TK  LE    
Sbjct: 425 ALVGPNGVGKSTLLKIMTGELMPQSGRVSRHTH-VKLGVYSQHSQDQLDLTKSALE---- 479

Query: 166 AIIKPQYVDNIPRAI---KGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSAL 222
             ++ +Y  NI +     +G L + G    A+                     K  +  L
Sbjct: 480 -FVRDKY-SNISQDFQYWRGQLGRYGLTGDAQ---------------------KVQMGTL 516

Query: 223 SGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVE 278
           S G+  R    +  ++  NV + DEP++ LD+         I SL D        V+ V 
Sbjct: 517 SEGQRSRVVFALLALENPNVLLLDEPTNGLDIP-------TIDSLADAINEFNGGVVVVS 569

Query: 279 HDLSVLDYLSDFICIL 294
           HD  +LD ++  I ++
Sbjct: 570 HDFRLLDKIAKDIFVV 585

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 74/161 (45%), Gaps = 15/161 (9%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD--------DPPEWSDIIKYFRGSELQN 154
           G+  GL+G NG GKST LK LA ++ P     D         P E+S +    R  E QN
Sbjct: 107 GRRYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVVR--EAQN 164

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNV 214
              K +ED ++ II     D     +  PL +  + +     +  A V +       Q +
Sbjct: 165 EL-KRVEDLVEKII---LEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTI 220

Query: 215 LKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
           LK+    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 221 LKK-TKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 260

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
           ++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T  
Sbjct: 222 KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRTLV 277

Query: 522 IVEH--DFI 528
           +V H  DF+
Sbjct: 278 LVSHSQDFL 286

>YDR011W (SNQ2) [865] chr4 (465916..470421) Drug-efflux pump
           involved in resistance to multiple drugs, member of the
           ATP-binding cassette (ABC) superfamily [4506 bp, 1501
           aa]
          Length = 1501

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 91/213 (42%), Gaps = 22/213 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLG------RYDDPPEWSDIIKYFRGSELQNYF 156
           G+++ ++G  G G S+ LK+ AG+     G       YD  P+  +++K ++   + N  
Sbjct: 186 GEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGEVAYDGIPQ-EEMMKRYKADVIYN-- 242

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK 216
              L+     +   Q +D    A K P  +V  + K        D  +Y  I  L++   
Sbjct: 243 -GELDVHFPYLTVKQTLD-FAIACKTPALRVNNVSKKEYIASRRD--LYATIFGLRHTYN 298

Query: 217 RDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR---SLL 268
             V       +SGGE +R +I  +   + ++Y +D  +  LD    L  A  IR   +LL
Sbjct: 299 TKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLL 358

Query: 269 DPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
             T +V   +   ++ +   D + +LY    +Y
Sbjct: 359 KSTAFVTIYQASENIYETF-DKVTVLYSGKQIY 390

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  +K IR      K TAF+ 
Sbjct: 306 VRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDASTALEYAKAIRIMTNLLKSTAFVT 365

>CAGL0M07293g complement(733072..737619) similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 or sp|P32568
            Saccharomyces cerevisiae YDR011w, hypothetical start
          Length = 1515

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 86/188 (45%), Gaps = 24/188 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG++  L+G +G GK+T L +LA  Q+ N+G                G  L N  +   
Sbjct: 872  KPGKMTALMGESGAGKTTLLNVLA--QRINMG-------------VITGDMLVNSQSLPA 916

Query: 161  EDDIKAIIKPQYVDNIPR-AIKGPLQKVGELLKAR---MEKPEADVKMYIKILELQNVLK 216
              +       Q  +++   +++  L+   EL + R   +E+    V+  I +L +QN  +
Sbjct: 917  SFNRSCGYVAQADNHMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAE 976

Query: 217  RDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPT 271
              V     G    + ++ +IG+  V + ++ +F DEP+S LD +   +    +R+L D  
Sbjct: 977  ALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSG 1036

Query: 272  TYVICVEH 279
              ++C  H
Sbjct: 1037 QSILCTIH 1044

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 92/230 (40%), Gaps = 57/230 (24%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWSDIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G +  D  +  +++K ++G      EL 
Sbjct: 177 GEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMMKNYKGYVIYCPELD 236

Query: 154 NYFTKMLEDD--------------IKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE 199
            +F K+   +              I  + + QYVDNI                       
Sbjct: 237 FHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIR---------------------- 274

Query: 200 ADVKMYIKILELQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDV 254
               M+  +  L++     V       +SGGE +R ++  +    A++Y +D  +  LD 
Sbjct: 275 ---DMWCTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDA 331

Query: 255 KQRLNAALIIRS---LLDPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
              L  A  IR+   +++ +  V   +   ++ + L D   +LY    +Y
Sbjct: 332 STALEFAQAIRTATNMMNNSAIVAIYQAGENIYE-LFDKTTVLYNGKQIY 380

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 296 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 342

>Kwal_47.19116
          Length = 607

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 82/162 (50%), Gaps = 17/162 (10%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKP-----NLGRYDDPPEWSDI--IKYFRGSELQNY 155
           G+  GL+G NG GKST LK LA K+ P     ++   D+P E S+   ++Y   +E QN 
Sbjct: 104 GRRYGLLGENGCGKSTFLKSLATKEYPIPEHIDVYLLDEPAEPSEFSALEYVV-NEAQNE 162

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRA--IKGPLQKVGELLKARMEKPEADVKMYIKILELQN 213
             K LED    +++   +++ P +  ++G  +++  L  +  E   A +   I +     
Sbjct: 163 L-KRLED----LVEKTILEDGPESDVLEGIYERMDSLDPSTFESRAAVI--LIGLGFNSK 215

Query: 214 VLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVK 255
            + +    +SGG   R A+  +   +  + + D+P+++LD++
Sbjct: 216 TINKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLE 257

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 35/193 (18%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIK 165
           + LVG NG+GKST LKI+ G+     GR         +  Y + S+ Q   TK   + ++
Sbjct: 421 VALVGPNGVGKSTLLKIMTGELATQSGRVSRHTHVK-LGVYSQHSQDQLDLTKSPLEFVR 479

Query: 166 AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSALSGG 225
              K  ++ +  +  +G L + G   + +  +                     ++ LS G
Sbjct: 480 D--KYSHISHDFQYWRGQLGRYGLTGEGQTSQ---------------------MATLSEG 516

Query: 226 ELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY----VICVEHDL 281
           +  R    +  +Q  NV + DEP++ LD+         I SL D        V+ V HD 
Sbjct: 517 QRSRVVFALLALQAPNVLLLDEPTNGLDIA-------TIDSLADAINEFNGGVVVVSHDF 569

Query: 282 SVLDYLSDFICIL 294
            +LD ++  I ++
Sbjct: 570 RLLDKIAKDIFVV 582

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 42/71 (59%), Gaps = 6/71 (8%)

Query: 460 IDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
           I+++ + +SGG   RVA+  AL +   + L+D+P+A+LD E  +   + ++RF     +T
Sbjct: 217 INKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRF----DRT 272

Query: 520 AFIVEH--DFI 528
             +V H  DF+
Sbjct: 273 LVLVSHSQDFL 283

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 467 LSGGELQRVAI-VLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
           LS G+  RV   +LAL  P ++ L+DEP+  LD       +  I  F         +V H
Sbjct: 513 LSEGQRSRVVFALLALQAP-NVLLLDEPTNGLDIATIDSLADAINEF----NGGVVVVSH 567

Query: 526 DFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
           DF +   +A  + V E   +     R   S+L   NK  KN+
Sbjct: 568 DFRLLDKIAKDIFVVENKTA----TRWDGSILDYKNKLAKNV 605

>Scas_703.17
          Length = 1046

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +SALSGG   + A+  + ++ A++ + DEP+++LD    +N   ++  L       I V 
Sbjct: 542 ISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT---INVKWLVDYLNTCGITSIIVS 598

Query: 279 HDLSVLDYLSDFICILYGV 297
           HD   LD +  +I    G+
Sbjct: 599 HDSGFLDNVCQYIIHYEGL 617

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D+ I+  +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    I  K +  ++   
Sbjct: 535 DETINMPISALSGGWKMKLALARAVLKNADILLLDEPTNHLDT----INVKWLVDYLNTC 590

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 591 GITSIIVSHDSGFLDNVCQYIIHYEG 616

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 13/106 (12%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +   +++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     S
Sbjct: 880 CSMLGLDSELVSHSQIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALS 937

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVI-VFEG--TPSKNAY 549
           K ++ F    +    I+ H       L ++V  V EG  TPS + +
Sbjct: 938 KALKAF----EGGVIIITHSEEFTKNLTEEVWAVKEGKMTPSGHNW 979

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 209 LELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
           L+ + V    +  LSGG+  +  +     Q+ ++ + DEP++YLD
Sbjct: 885 LDSELVSHSQIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 929

>YMR301C (ATM1) [4255] chr13 complement(867554..869626) Member of
           the ATP-binding cassette (ABC) superfamily of membrane
           transporters, component of the mitochondrial inner
           membrane [2073 bp, 690 aa]
          Length = 690

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 70/156 (44%), Gaps = 18/156 (11%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G    +VG++G GKST LK++         R+ DP     +I    G +++ Y    L  
Sbjct: 462 GWKTAIVGSSGSGKSTILKLVF--------RFYDPESGRILIN---GRDIKEYDIDALRK 510

Query: 163 DIKAIIK--PQYVDNIPRAIK-GPLQKVGELLKARMEKPEADVKMYIKIL--ELQNVLKR 217
            I  + +  P + D I   +K G +    E +   +EK  A +   IK L      ++  
Sbjct: 511 VIGVVPQDTPLFNDTIWENVKFGRIDATDEEVITVVEK--AQLAPLIKKLPQGFDTIVGE 568

Query: 218 DVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
               +SGGE QR AI    ++ A +  FDE +S LD
Sbjct: 569 RGLMISGGEKQRLAIARVLLKNARIMFFDEATSALD 604

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   D I+ +    +SGGE QR+AI   L   A I   DE ++ LD+       + IR  
Sbjct: 559 PQGFDTIVGERGLMISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDN 618

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFE 541
                +T+  + H  +     ADK+IV +
Sbjct: 619 FTSGSRTSVYIAHR-LRTIADADKIIVLD 646

>Scas_720.36
          Length = 1190

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 46/191 (24%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKM--- 159
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +   
Sbjct: 593 GHRYGLCGRNGAGKSTLMRAIAN------GQLDGFPDKDTLRTCFVEHKLQGEEGDLDLV 646

Query: 160 ----LEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVL 215
               L+++++A  + +        I   L+ VG   + R +                   
Sbjct: 647 SFIALDEELQATSREE--------ISNALEHVGFDEERRAQT------------------ 680

Query: 216 KRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV- 274
              V +LSGG   +  +  + +Q+A++ + DEP+++LDV    N   +   LL+ T    
Sbjct: 681 ---VGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVS---NVKWLQDYLLEHTDITS 734

Query: 275 ICVEHDLSVLD 285
           + V HD   LD
Sbjct: 735 LIVSHDSGFLD 745

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 679 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VSNVKWLQDYLLEHTDITS 734

Query: 521 FIVEHDFIMATYLADKVIVFE 541
            IV HD      +   +I +E
Sbjct: 735 LIVSHDSGFLDTVCTDIIHYE 755

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR   D +  V+ + 
Sbjct: 1026 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIR---DWSGGVVMIS 1082

Query: 279  HD 280
            H+
Sbjct: 1083 HN 1084

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +
Sbjct: 1029 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDW 1074

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 838 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 870

>Kwal_26.9480
          Length = 719

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 54/126 (42%), Gaps = 9/126 (7%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D I+ +    +SGGE QR+AI   L   A I   DE ++ LD+       + I+      
Sbjct: 590 DTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTG 649

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEGTPSKN-----AYARTPESL---LTGCNKFLKNLN 568
            KT+  + H  +     ADK+IV E    K          TP+SL   L    + L +LN
Sbjct: 650 SKTSVYIAHR-LRTIADADKIIVLEHGRVKEEGKHAELLATPKSLYAELWNVQENLDDLN 708

Query: 569 VTFRRD 574
               RD
Sbjct: 709 KELERD 714

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 86/198 (43%), Gaps = 40/198 (20%)

Query: 75  LPTNLDSQVTHRYSANSFKLHRLP------TPRPGQVLGLVGTNGIGKSTALKILAGKQK 128
           LP N+ S++  +  +  +   RL       T   G    +VG +G GKST LK++     
Sbjct: 455 LPPNVPSEIVFKNVSFGYDPDRLILKNASFTIPTGSKTAIVGPSGSGKSTILKLVF---- 510

Query: 129 PNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDDIKAIIK--PQYVDNIPRAIKGPLQK 186
               R+ DP E   ++    G +++    + L   I  + +  P + ++I   +K     
Sbjct: 511 ----RFYDPIEGRILLD---GKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKF---- 559

Query: 187 VGELLKARMEKPEADVKMYIKILELQNVLK-----RDVSA------LSGGELQRFAIGMS 235
                  R++  + +++  I   +L+ +++     RD         +SGGE QR AI   
Sbjct: 560 ------GRIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARV 613

Query: 236 CVQQANVYMFDEPSSYLD 253
            ++ A +  FDE +S LD
Sbjct: 614 LLKDAPIMFFDEATSALD 631

>ABR125C [717] [Homologous to ScYDR011W (SNQ2 ) - NSH; ScYNR070W -
           NSH] (623887..628353) [4467 bp, 1488 aa]
          Length = 1488

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 93/217 (42%), Gaps = 20/217 (9%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQK-----PNLGRYDDPPEWSDIIKYFRGSELQNY 155
           RPG+++ ++G  G G ++ LK +AG+            YD  P+  ++++ +R   + N 
Sbjct: 186 RPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQ-REMMRRYRAEVVYN- 243

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVL 215
               ++     +   Q +D    A K P  +V  +  +R E      ++Y  +  L++  
Sbjct: 244 --SEIDVHFPHLTVKQTLD-FALACKTPHMRVNNV--SRAEYITLMRELYATVFGLRHTY 298

Query: 216 KRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR---SL 267
              V       +SGGE +R +I  +    A+VY +D  +  LD    L  A  +R   +L
Sbjct: 299 DTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNL 358

Query: 268 LDPTTYVICVEHDLSVLDYLSDFICILYGVPSVYGVV 304
           L  T+ V   +   ++ +     + +  G    +G V
Sbjct: 359 LQSTSLVTLYQASENIYETFDKVLVLFEGRQIYFGDV 395

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           ++ +SGGE +RV+I  AL   A +Y  D  +  LD+   +  ++ +R      + T+ + 
Sbjct: 307 IRGVSGGERKRVSIAEALAANASVYCWDNATRGLDASTALEYAQAMRIMTNLLQSTSLVT 366

Query: 524 EH---DFIMATYLADKVIV-FEG 542
            +   + I  T+  DKV+V FEG
Sbjct: 367 LYQASENIYETF--DKVLVLFEG 387

>CAGL0D03674g 370066..373626 highly similar to tr|Q08972
           Saccharomyces cerevisiae YPL226w NEW1, start by
           similarity
          Length = 1186

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   K +  ++L H   T+
Sbjct: 676 QTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLD----VANVKWLEEYLLEHTNITS 731

Query: 521 FIVEHD--FIMAT------YLADKVIVFEGTPSK 546
            IV HD  F+ A       Y   K+I ++G  +K
Sbjct: 732 LIVSHDSGFLDAVCTDIIHYENKKLIYYKGNLAK 765

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 76/187 (40%), Gaps = 38/187 (20%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ D  P+   +   F   +LQ     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSIAN------GQLDGFPDKDTLKTCFVEHKLQGEEGDL--D 641

Query: 163 DIKAIIKPQYVDNIPRA-IKGPLQKVG--ELLKARMEKPEADVKMYIKILELQNVLKRDV 219
            +  I   + +    R  I   L  VG  E  +A+                        V
Sbjct: 642 LVSFIALDEQLQTTSRDDIANALASVGFDETRRAQT-----------------------V 678

Query: 220 SALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV-ICVE 278
            +LSGG   +  +  + +Q+A++ + DEP+++LDV    N   +   LL+ T    + V 
Sbjct: 679 GSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVA---NVKWLEEYLLEHTNITSLIVS 735

Query: 279 HDLSVLD 285
           HD   LD
Sbjct: 736 HDSGFLD 742

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF------ILHNKK-- 518
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +      I HN +  
Sbjct: 1026 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNEFV 1085

Query: 519  -----TAFIVEHDFIMATYLAD-KVIVFEGTPSKNAYARTPESLLT 558
                   +IVE+  ++   + D     FE   + NA    P S +T
Sbjct: 1086 GALCPEQWIVENGTMVQKGVKDVDQSRFEDGGNANAVGLKPSSSVT 1131

 Score = 33.9 bits (76), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR   D +  V+ + 
Sbjct: 1023 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIR---DWSGGVVMIS 1079

Query: 279  HD 280
            H+
Sbjct: 1080 HN 1081

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 835 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 867

>CAGL0E00385g 31723..33549 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 or sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 608

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 89/215 (41%), Gaps = 32/215 (14%)

Query: 88  SANSFKLHRLPTPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRYDDPPEWSD 142
           S  +F++H      PG+ +  VG +G GKST   +L      G    ++G YD       
Sbjct: 383 SEMNFQIH------PGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYD------- 429

Query: 143 IIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADV 202
            I  F   + +     + ++ +  +     +DNI   +         L    M    A+ 
Sbjct: 430 -ISAFNLRKYRRMLGVVQQEPL--LFNGTILDNITYGLHDK-----SLTDLNMALKAANC 481

Query: 203 KMYIK--ILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR--L 258
             +IK   + L  ++    + LSGG+ QR A+    +Q  ++ + DE +S LD K    +
Sbjct: 482 DQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDII 541

Query: 259 NAALIIRSLLDPTTYVICVEHDLSVLDYLSDFICI 293
           N  L  R     TT  I + H LS + + S  I I
Sbjct: 542 NKELQRRQEAGMTT--ISIAHRLSTIRHSSRVIVI 574

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%)

Query: 456 IDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRR 511
           +D ++      LSGG+ QR+A+        DI ++DE ++ LD++   I +K ++R
Sbjct: 492 LDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINKELQR 547

>AFL131W [3064] [Homologous to ScYPL226W (NEW1) - SH]
           complement(186656..190225) [3570 bp, 1189 aa]
          Length = 1189

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 34/185 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ ++       G+ +  P   ++   F    L+     +  D
Sbjct: 590 GHRYGLCGRNGAGKSTLMRSISN------GQLEGFPSQDELKTCFVERALEGEDGSV--D 641

Query: 163 DIKAIIKPQYVDNIPR-AIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVSA 221
            +  +     ++N PR  I   L+ VG          +AD +             + V +
Sbjct: 642 IVSFLASAPSLENTPRKEIVAALESVGF---------DADRRA------------QTVGS 680

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV-ICVEHD 280
           LSGG   +  +  + +Q+A++ + DEP+++LDV    N   +   LL+ T    + V HD
Sbjct: 681 LSGGWKMKLELTRAILQKADILLLDEPTNHLDVA---NVRWLEEYLLNNTEITSLIVSHD 737

Query: 281 LSVLD 285
              LD
Sbjct: 738 TGFLD 742

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKK-TA 520
           Q V  LSGG   ++ +  A+   ADI L+DEP+ +LD    +   + +  ++L+N + T+
Sbjct: 676 QTVGSLSGGWKMKLELTRAILQKADILLLDEPTNHLD----VANVRWLEEYLLNNTEITS 731

Query: 521 FIVEHDFIMATYLADKV 537
            IV HD    T   DKV
Sbjct: 732 LIVSHD----TGFLDKV 744

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR     T  V+ + 
Sbjct: 1024 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1080

Query: 279  HDLSVLDYLSDFICILY-GVPSVYGVVTLPSS 309
            H    +  L     I+  G     GVVT+  S
Sbjct: 1081 HSTEFVGALCPEQWIVENGTMVQKGVVTVDQS 1112

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 47/109 (43%), Gaps = 12/109 (11%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF----ILHNKKTAFI 522
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +    ++ +  T F+
Sbjct: 1027 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFV 1086

Query: 523  VEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLT-GCNKFLKNLNVT 570
                        ++ IV  GT  +       +S    G N     LN+T
Sbjct: 1087 -------GALCPEQWIVENGTMVQKGVVTVDQSRFADGGNAEAVGLNIT 1128

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 835 VAIIGPNGAGKSTLIKLLTGELVPTSGKVEKHP 867

>YCR011C (ADP1) [545] chr3 complement(133721..136870) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [3150 bp, 1049 aa]
          Length = 1049

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 92/215 (42%), Gaps = 31/215 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWSDIIKYFRGSEL 152
           +PGQ+L ++G +G GK+T L ILA K+K           G   D   +S II +    + 
Sbjct: 414 KPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKIIGFVDQDDF 473

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKP-EADVKMYIKILEL 211
                 + E  + + +       +P+A+        E  KAR+ K  E    + IK   +
Sbjct: 474 LLPTLTVFETVLNSALL-----RLPKALS------FEAKKARVYKVLEELRIIDIKDRII 522

Query: 212 QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPT 271
            N   R    +SGGE +R +I    V    V   DEP+S LD     NA  +I  L+  +
Sbjct: 523 GNEFDR---GISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAS---NANNVIECLVRLS 576

Query: 272 -----TYVICVEHDLSVLDYLSDFICILYGVPSVY 301
                T V+ +    S + YL D + +L     VY
Sbjct: 577 SDYNRTLVLSIHQPRSNIFYLFDKLVLLSKGEMVY 611

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 56/254 (22%), Positives = 96/254 (37%), Gaps = 34/254 (13%)

Query: 366 VLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKF 425
           VLN   G     +IL +MG +G GKTT                  K+N     +K   K 
Sbjct: 405 VLNEISGIVKPGQILAIMGGSGAGKTTLLDILAMKRKTGHVSGSIKVNGISMDRKSFSKI 464

Query: 426 PGTVRQ---------LFFKRIRAQFLN-PQFQTDVCKPLRIDDIIDQEV----------- 464
            G V Q         +F   + +  L  P+  +   K  R+  ++++             
Sbjct: 465 IGFVDQDDFLLPTLTVFETVLNSALLRLPKALSFEAKKARVYKVLEELRIIDIKDRIIGN 524

Query: 465 ---QHLSGGELQRVAIVLALGLPADIYLIDEPSAYLD-SEQRIICSKVIRRFILHNKKTA 520
              + +SGGE +RV+I   L     +  +DEP++ LD S    +   ++R    +N+   
Sbjct: 525 EFDRGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDASNANNVIECLVRLSSDYNRTLV 584

Query: 521 FIVEHDFIMATYLADKVI-------VFEGTPSKNAYARTPESLLTGCNKFLKN--LNVTF 571
             +        YL DK++       V+ G   K +     E  +   N  + +  +++TF
Sbjct: 585 LSIHQPRSNIFYLFDKLVLLSKGEMVYSGNAKKVSEFLRNEGYICPDNYNIADYLIDITF 644

Query: 572 RRDPNSFRPRINKL 585
              P   R RI  +
Sbjct: 645 EAGPQGKRRRIRNI 658

>AAL028W [159] [Homologous to ScYLR249W (YEF3) - SH; ScYNL014W
           (HEF3) - SH] complement(291808..294942) [3135 bp, 1044
           aa]
          Length = 1044

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           + +LSGG   + A+  + ++ A++ + DEP+++LD    +N A ++  L       I V 
Sbjct: 541 IMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVAWLVNYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFICILYGV 297
           HD   LD +  +I    G+
Sbjct: 598 HDSGFLDNVCQYIIHYEGL 616

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPIMSLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVAWLVNYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSIIVSHDSGFLDNVCQYIIHYEG 615

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%)

Query: 209 LELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
           LE + V    +  LSGG+  +  +     Q+ ++ + DEP++YLD
Sbjct: 884 LEAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 928

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 4/51 (7%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICSKVIRRF 512
           ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     SK ++ F
Sbjct: 894 IRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAF 942

>KLLA0F12210g 1125630..1128764 highly similar to sp|P16521
           Saccharomyces cerevisiae YLR249w YEF3 translation
           elongation factor eEF3 P6.7.f5.1, start by similarity
          Length = 1044

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 78/186 (41%), Gaps = 29/186 (15%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           +++LSGG   + A+  + ++ A++ + DEP+++LD    +N   ++  L       I V 
Sbjct: 541 IASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT---VNVNWLVEYLNTCGITSIIVS 597

Query: 279 HDLSVLDYLSDFICILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEA--LQF 336
           HD   LD +  +I    G+        L   V++          P+    +   A  L+F
Sbjct: 598 HDSGFLDKVCQYIIHYEGLKLRKYKGNLSEFVKK---------CPTAKSYYELGASELEF 648

Query: 337 RLAEAG---------EELHSDAMRAFQYPPMKRTQ-GDFVLNVEPGEFSDSEILVMMGEN 386
           R  E G         + +   +   FQYP   + Q  D        + S S  + ++G N
Sbjct: 649 RFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTAKPQISDISF-----QCSLSSRIAVIGPN 703

Query: 387 GTGKTT 392
           G GK+T
Sbjct: 704 GAGKST 709

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D++I   +  LSGG   ++A+  A+   ADI L+DEP+ +LD+    +    +  ++   
Sbjct: 534 DEMIAMPIASLSGGWKMKLALARAVLKNADILLLDEPTNHLDT----VNVNWLVEYLNTC 589

Query: 517 KKTAFIVEHDFIMATYLADKVIVFEG 542
             T+ IV HD      +   +I +EG
Sbjct: 590 GITSIIVSHDSGFLDKVCQYIIHYEG 615

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 80/234 (34%), Gaps = 88/234 (37%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLG-----------------------RYDDPPEWSD 142
           + ++G NG GKST + +L G+  P +G                         D  P  S+
Sbjct: 697 IAVIGPNGAGKSTLINVLTGELLPTVGEVYTHENCRIAYIKQHAFAHIESHLDKTP--SE 754

Query: 143 IIKY-FRGSELQNYFTK----MLEDDIKAIIKPQYVDNIPRAIKG--------------- 182
            I++ F+  E +    +    + EDD +A+ K   +D  PR I G               
Sbjct: 755 YIQWRFQTGEDRETMDRANRVINEDDAEAMNKIFKIDGTPRRIAGIHARRKFKNTYEYEC 814

Query: 183 ----------------PLQKVGELLKARMEKPEADVKMYIKI------------------ 208
                           P+  V      R E  E+  KM  ++                  
Sbjct: 815 SFLLGENIGMKSERWVPMMSVDNAWLPRGELVESHSKMVAEVDMKEALASGQFRPLTRKE 874

Query: 209 ---------LELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
                    L+ + V    +  LSGG+  +  +     Q+ ++ + DEP++YLD
Sbjct: 875 IEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAACTWQRPHLIVLDEPTNYLD 928

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 13/106 (12%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +    ++ LSGG  Q+V +VLA       +LI  DEP+ YLD +     S
Sbjct: 879 CAMLGLDAELVSHSRIRGLSGG--QKVKLVLAACTWQRPHLIVLDEPTNYLDRDSLGALS 936

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG---TPSKNAY 549
           K ++ F    +    I+ H       L ++V   +    TPS + +
Sbjct: 937 KALKAF----EGGVIIITHSAEFTKNLTEEVWAVKDGRMTPSGHNW 978

>Scas_574.8
          Length = 702

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 51/122 (41%), Gaps = 6/122 (4%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   + I+ +    +SGGE QR+AI   L   A I   DE ++ LD+         IR  
Sbjct: 559 PQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRAN 618

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFEGTPSK-----NAYARTPESLLTGCNKFLKNL 567
                +T+  + H  +     ADK+IV E    K     +    TP SL        +NL
Sbjct: 619 FESGSRTSVYIAHR-LRTIADADKIIVLEDGAVKEEGTHSGLLATPGSLYANLWNIQENL 677

Query: 568 NV 569
           +V
Sbjct: 678 DV 679

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 82/190 (43%), Gaps = 19/190 (10%)

Query: 83  VTHRYSANSFKLHRLPTPRPGQV-LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWS 141
           VT  Y +    L+      PG +   +VG +G GKST LK++         R+ DP +  
Sbjct: 441 VTFGYDSKRKILNNASFTIPGGLKTAVVGPSGSGKSTILKLVF--------RFYDPEQGR 492

Query: 142 DIIKYFRGSELQNYFTKMLEDDIKAIIK--PQYVDNIPRAIK-GPLQKVGELLKARMEKP 198
            +I    G +++ Y    L   +  + +  P + D I   +K G +    E +   +EK 
Sbjct: 493 ILIN---GVDVKEYDVDSLRRVMGVVPQDTPLFNDTIWENVKFGRIDATDEEVHTVIEK- 548

Query: 199 EADVKMYIKIL--ELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQ 256
            A +   IK L    + ++      +SGGE QR AI    ++ A +  FDE +S LD   
Sbjct: 549 -AQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIARVLLKNAKIMFFDEATSALDTHT 607

Query: 257 RLNAALIIRS 266
                  IR+
Sbjct: 608 EQALLTTIRA 617

>YNR070W (YNR070W) [4653] chr14 (765372..769373) Probable multidrug
           resistance protein of the ATP-binding cassette (ABC)
           family, has similarity to Snq2p, Pdr5p and Candida
           albicans Cdr1p [4002 bp, 1333 aa]
          Length = 1333

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 94/212 (44%), Gaps = 25/212 (11%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-------RYDDPPEWSDIIKYFRGSELQ 153
           + G+++ ++G  G G ++ LK  AG+     G        YD  P+  +++++++   + 
Sbjct: 54  KSGEMVLVLGRPGAGCTSFLKSAAGETSQFAGGVTTGHISYDGIPQ-KEMMQHYKPDVIY 112

Query: 154 NYFTKMLEDDIK--AIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILEL 211
           N      E D+    +   Q +D    + K P ++V  + K   E   A+ + Y KI  L
Sbjct: 113 N-----GEQDVHFPHLTVKQTLD-FAISCKMPAKRVNNVTKE--EYITANREFYAKIFGL 164

Query: 212 QNVLKRDV-----SALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
            +     V     S +SGGE +R +I  +   + ++Y +D  +  LD    L  A  IR+
Sbjct: 165 THTFDTKVGNDFISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIRT 224

Query: 267 L--LDPTTYVICVEHDLSVLDYLSDFICILYG 296
           +  L  TT ++ V      +    D + +LY 
Sbjct: 225 MTNLLGTTALVTVYQASENIYETFDKVTVLYA 256

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           +  +SGGE +RV+I  AL     IY  D  +  LDS   +  ++ IR
Sbjct: 177 ISGVSGGERKRVSIAEALAAKGSIYCWDNATRGLDSSTALEFARAIR 223

>KLLA0F21692g complement(2014152..2018729)
            gi|14571818|gb|AAK67294.1|AF245358_1 Kluyveromyces lactis
            multidrug pump KlPDR5, start by similarity
          Length = 1525

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 94/228 (41%), Gaps = 27/228 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +   D          +  G    N F + +
Sbjct: 887  KPGTLTALMGSSGAGKTTLLDCLASRVTMGVITGD---------MFVNGHLRDNSFPRSI 937

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLK---ARMEKPEADVKMYIKILELQNVLKR 217
                    + Q +      ++  L+    L +     +E+    V+  I ILE+Q     
Sbjct: 938  -----GYCQQQDLHLSTSTVRESLRFSAYLRQPSSVSIEEKNNYVEDVINILEMQQYADA 992

Query: 218  DVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTT 272
             V     G    + +R  IG+    +  + +F DEP+S LD +   +   ++R L D   
Sbjct: 993  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLADHGQ 1052

Query: 273  YVICVEHDLSVLDYLSDFICILY---GVPSVYGVVTLPSSVREGINIF 317
             ++C  H  S L  + +F  +L+   G  +VY    L    +E IN F
Sbjct: 1053 AILCTIHQPSAL-LMQEFDILLFLQKGGKTVY-FGNLGEGCQEMINYF 1098

>CAGL0L07744g 849961..853128 similar to sp|P25371 Saccharomyces
           cerevisiae YCR011c ADP1 ATP-dependent permease, start by
           similarity
          Length = 1055

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 34/181 (18%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPN--------LGRYDDPPEWSDIIKYFRGSEL 152
           +PG++L ++G +G GK+T L ILA K+K           G+     +++ +I +    + 
Sbjct: 401 KPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKLIGFV---DQ 457

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQ 212
            +Y    L   +   +    +  +PR +               E  +A V   ++ L + 
Sbjct: 458 DDYLLPTLT--VYETVLNSALLRLPRTMS-------------FEAKQARVFHVLEELRIM 502

Query: 213 NVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSL 267
           ++  R V       +SGGE +R +I    V    V   DEP+S LD     NA  +I  L
Sbjct: 503 DIKDRIVGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDAN---NANNVIECL 559

Query: 268 L 268
           +
Sbjct: 560 V 560

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 90/226 (39%), Gaps = 31/226 (13%)

Query: 366 VLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKF 425
           VLN   G     EIL +MG +G GKTT                  ++N  +  +K   K 
Sbjct: 392 VLNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTKL 451

Query: 426 PGTVRQ----LFFKRIRAQFLNP---------QFQT------DVCKPLRIDDIIDQEVQH 466
            G V Q    L    +    LN           F+        V + LRI DI D+ V +
Sbjct: 452 IGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKDRIVGN 511

Query: 467 -----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
                +SGGE +RV+I   L     +  +DEP++ LD+       + + R   +  +T  
Sbjct: 512 DFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANNANNVIECLVRLARNYDRTLV 571

Query: 522 IVEHD-FIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKN 566
           +  H       Y  DK+++     S+     + E+L    N+FLKN
Sbjct: 572 MSIHQPRSNIFYRFDKLVLL----SRGELVYSGEALRV--NEFLKN 611

>YKR104W (NFT1) [3355] chr11 (656472..657392) Member of the
           ATP-binding cassette (ABC) superfamily [921 bp, 306 aa]
          Length = 306

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 34/208 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
           + G  +G+VG  G GKS+   I+A      + R  D   W +        ++++   + L
Sbjct: 58  KAGTKVGIVGRTGAGKSS---IIAA-----IYRLSD---WENGTITIDNKDIKHIPLERL 106

Query: 161 EDDIKAIIK-PQYVDNIPRA------------IKGPLQKVGEL-------LKARMEKPE- 199
            + I  I + P   D   R+            I G L KVG +       L    E+P  
Sbjct: 107 RNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNF 166

Query: 200 ADVKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLN 259
           +  K+  + ++L  V+K   S LS G+ Q   +  S +   N+ + DE ++ +D      
Sbjct: 167 SSHKLRNRFIDLNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAK 226

Query: 260 AALIIRSLLDPTTYVICVEHDL-SVLDY 286
               IR  +  TT ++ + H L SV+DY
Sbjct: 227 IQKTIRETMKNTT-ILTIAHRLRSVIDY 253

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
           transporter responsible for export of a factor mating
           pheromone, member of ATP-binding cassette (ABC)
           superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/231 (25%), Positives = 87/231 (37%), Gaps = 41/231 (17%)

Query: 330 RTEALQFRLAEAGEELHSDAMRAFQYP--PMKRTQGDFVLNVEPGEFSDSEILVMMGENG 387
           +T A QF L  A  +L + A  +F YP  P +    +  LN   G+F+      ++G++G
Sbjct: 342 KTVAHQFPLDYATSDL-TFANVSFSYPSRPSEAVLKNVSLNFSAGQFT-----FIVGKSG 395

Query: 388 TGKTTXXXXXXXXX-XXXXXXXXPKLNVSMKPQKIAPKFPGTVRQ---LFFKRIRAQFL- 442
           +GK+T                     N+    QK+  +    V Q   LF   +R   L 
Sbjct: 396 SGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILL 455

Query: 443 ---------------NPQFQTDVCK-----------PLRIDDIIDQEVQHLSGGELQRVA 476
                          N     D C+           P  ++ +I      LSGG+ QRVA
Sbjct: 456 GSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVA 515

Query: 477 IVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDF 527
           I  A      I  +DE  + LD   R +  K IR +     KT  I+ H+ 
Sbjct: 516 IARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHW--RKGKTTIILTHEL 564

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 74/159 (46%), Gaps = 25/159 (15%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
            GQ LG++G +G GKST + +L       +G+          IK   G+++ ++    L  
Sbjct: 1080 GQTLGIIGESGTGKSTLVLLLTKLYNCEVGK----------IK-IDGTDVNDWNLTSLRK 1128

Query: 163  DIKAI-IKPQYVDNIPR-AIKGPLQKVGELLKARMEKPEADVKMYIKILEL-----QNVL 215
            +I  +  KP   +   R  +   LQ   E+L+  M     D   Y+ I +      Q + 
Sbjct: 1129 EISVVEQKPLLFNGTIRDNLTYGLQD--EILEIEM----YDALKYVGIHDFVISSPQGLD 1182

Query: 216  KR-DVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
             R D + LSGG+ QR  I  + ++++ + + DE +S LD
Sbjct: 1183 TRIDTTLLSGGQAQRLCIARALLRKSKILILDECTSALD 1221

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 450  VCKPLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 509
            +  P  +D  ID  +  LSGG+ QR+ I  AL   + I ++DE ++ LDS    I ++++
Sbjct: 1175 ISSPQGLDTRIDTTL--LSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIV 1232

Query: 510  RR 511
            ++
Sbjct: 1233 KK 1234

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 221 ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHD 280
            LSGG+ QR AI  + ++   +   DE  S LD+  R      IR      T +I + H+
Sbjct: 505 TLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTII-LTHE 563

Query: 281 LSVL---DYL 287
           LS +   DYL
Sbjct: 564 LSQIESDDYL 573

>Sklu_2403.5 YPL226W, Contig c2403 12436-15975 reverse complement
          Length = 1179

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  A+   AD+ L+DEP+ +LD    +   K +  ++L H + T+
Sbjct: 664 QTVGSLSGGWKMKLELARAMLQKADVLLLDEPTNHLD----VANVKWLEDYLLEHTEITS 719

Query: 521 FIVEHDFIMATYLADKVIVFE 541
            IV HD      +  ++I +E
Sbjct: 720 LIVSHDSGFLDAVCTEIIHYE 740

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 79/185 (42%), Gaps = 34/185 (18%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ     +   
Sbjct: 578 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTRFVEHKLQGEEGDL--- 628

Query: 163 DIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK-RDVSA 221
           D+ + I          A+   LQ V             D+   ++ +   +  + + V +
Sbjct: 629 DLVSFI----------ALDPELQGVSR----------EDIANALESVGFDDYRRSQTVGS 668

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV-ICVEHD 280
           LSGG   +  +  + +Q+A+V + DEP+++LDV    N   +   LL+ T    + V HD
Sbjct: 669 LSGGWKMKLELARAMLQKADVLLLDEPTNHLDVA---NVKWLEDYLLEHTEITSLIVSHD 725

Query: 281 LSVLD 285
              LD
Sbjct: 726 SGFLD 730

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR   D T  V+ + 
Sbjct: 1011 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIR---DWTGGVVMIS 1067

Query: 279  HD 280
            H+
Sbjct: 1068 HN 1069

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 4/105 (3%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +         I  ++
Sbjct: 1014 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRDW---TGGVVMISHNN 1070

Query: 527  FIMATYLADKVIVFEGTPSKNAYARTPESLLT-GCNKFLKNLNVT 570
              +     ++ IV  GT  +    +  +S    G N     LN T
Sbjct: 1071 EFVGALCPEQWIVENGTMVQKGIKQIDQSRFEDGGNANAVGLNTT 1115

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           + ++G NG GKST +K+L G+  P  G+ +  P
Sbjct: 823 VAVLGPNGAGKSTLIKLLTGELVPQEGKVEKHP 855

>KLLA0C16115g 1405766..1409317 similar to sgd|S0006147 Saccharomyces
           cerevisiae YPL226w NEW1, start by similarity
          Length = 1183

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 75/188 (39%), Gaps = 40/188 (21%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G   GL G NG GKST ++ +A       G+ +  P+   +   F   +LQ       E 
Sbjct: 583 GHRYGLCGRNGAGKSTLMRSIAN------GQLEGFPDKDTLRTCFVEHKLQGE-----EG 631

Query: 163 DIKAI----IKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRD 218
           D+  +    + P   D     I   L+ VG     R +                      
Sbjct: 632 DLDLVSFIALDPILKDVSKEDISNALESVGFDDYRRSQT--------------------- 670

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV-ICV 277
           V +LSGG   +  +  + +Q+A+V + DEP+++LDV    N   +   LL+ T    + V
Sbjct: 671 VGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLDVA---NVKWLQDYLLEHTDITSLIV 727

Query: 278 EHDLSVLD 285
            HD   LD
Sbjct: 728 SHDSGFLD 735

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 42/81 (51%), Gaps = 5/81 (6%)

Query: 462 QEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL-HNKKTA 520
           Q V  LSGG   ++ +  A+   AD+ L+DEP+ +LD    +   K ++ ++L H   T+
Sbjct: 669 QTVGSLSGGWKMKLELARAMLQRADVLLLDEPTNHLD----VANVKWLQDYLLEHTDITS 724

Query: 521 FIVEHDFIMATYLADKVIVFE 541
            IV HD      +   +I +E
Sbjct: 725 LIVSHDSGFLDTVCTDIIHYE 745

 Score = 36.2 bits (82), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 46/105 (43%), Gaps = 4/105 (3%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            LSGG+L +V I  A+     + ++DEP+ YLD +     +  IR +         I  ++
Sbjct: 1020 LSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMISHNN 1076

Query: 527  FIMATYLADKVIVFEGTPSKNAYARTPESLLT-GCNKFLKNLNVT 570
              +     ++ IV  GT  +   A   +S    G N     LNVT
Sbjct: 1077 EFVGALCPEQWIVENGTMVQKGIAEIDQSRFEDGGNTNAVGLNVT 1121

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 3/62 (4%)

Query: 219  VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
            + +LSGG+L +  I  +     ++ + DEP++YLD       A+ IR     T  V+ + 
Sbjct: 1017 LGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREW---TGGVVMIS 1073

Query: 279  HD 280
            H+
Sbjct: 1074 HN 1075

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 106 LGLVGTNGIGKSTALKILAGKQKPNLGRYDDPP 138
           + ++G NG GKST +K+L G+  P+ G+ +  P
Sbjct: 828 VAILGPNGAGKSTLIKLLNGELLPDSGKVEKHP 860

>YPL058C (PDR12) [5383] chr16 complement(445837..450372) Protein
            required for weak organic acid resistance, member of the
            ATP-binding cassette (ABC) superfamily of membrane
            transporters [4536 bp, 1511 aa]
          Length = 1511

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 86/196 (43%), Gaps = 40/196 (20%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDD---------PPEWSDIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ N+G             P  ++    Y   ++
Sbjct: 869  KPGKMTALMGESGAGKTTLLNVLA--QRINMGVITGDMLVNAKPLPASFNRSCGYV--AQ 924

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKAR---MEKPEADVKMYIKI 208
              N+  ++                   +++  L+   EL +     +E+    V+  I +
Sbjct: 925  ADNHMAEL-------------------SVRESLRFAAELRQQSSVPLEEKYEYVEKIITL 965

Query: 209  LELQNVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALI 263
            L +QN  +  V     G    + ++ +IG+  V + ++ +F DEP+S LD +   +    
Sbjct: 966  LGMQNYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQF 1025

Query: 264  IRSLLDPTTYVICVEH 279
            +R+L D    ++C  H
Sbjct: 1026 MRALADSGQSILCTIH 1041

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 76/192 (39%), Gaps = 53/192 (27%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWSDIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK L+G+    +   G +  D  + S+++  ++G      EL 
Sbjct: 174 GEMLFVVGRPGAGCSTFLKCLSGETSELVDVQGEFSYDGLDQSEMMSKYKGYVIYCPELD 233

Query: 154 NYFTKMLEDD--------------IKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE 199
            +F K+   +              I  + + QYVDNI                       
Sbjct: 234 FHFPKITVKETIDFALKCKTPRVRIDKMTRKQYVDNIR---------------------- 271

Query: 200 ADVKMYIKILELQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDV 254
               M+  +  L++     V       +SGGE +R ++  +    A++Y +D  +  LD 
Sbjct: 272 ---DMWCTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDA 328

Query: 255 KQRLNAALIIRS 266
              L  A  IR+
Sbjct: 329 STALEFAQAIRT 340

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 293 VRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQAIR 339

>Scas_628.13
          Length = 1060

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 26/177 (14%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWSDIIKYFRGSEL 152
           +PGQ+  ++G +G GK+T L ILA K+K           G       +S +I +    + 
Sbjct: 425 KPGQIFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGFV---DQ 481

Query: 153 QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMY-IKILEL 211
            +Y    L   +   +    +  +PR +        E  ++R+ +   +++++ IK   +
Sbjct: 482 NDYLHPTLT--VYETVLNSALLRLPRTMS------FESKQSRVFQILEELRIFDIKDRII 533

Query: 212 QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLL 268
            N  +R    +SGGE +R +I    V    +   DEP+S LD     NA  +I SL+
Sbjct: 534 GNDFER---GISGGEKRRVSIACELVTSPLILFLDEPTSGLDAN---NANNVITSLV 584

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 65/157 (41%), Gaps = 29/157 (18%)

Query: 369 VEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKFPGT 428
           V+PG+     I  +MG +G GKTT                  K+N ++  +K   K  G 
Sbjct: 424 VKPGQ-----IFAIMGGSGAGKTTLLDILAMKRKTGQVGGEIKVNGNIMSRKSYSKLIGF 478

Query: 429 VRQLFFKR----IRAQFLNP---------QFQT------DVCKPLRIDDIIDQEVQH--- 466
           V Q  +      +    LN           F++       + + LRI DI D+ + +   
Sbjct: 479 VDQNDYLHPTLTVYETVLNSALLRLPRTMSFESKQSRVFQILEELRIFDIKDRIIGNDFE 538

Query: 467 --LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQ 501
             +SGGE +RV+I   L     I  +DEP++ LD+  
Sbjct: 539 RGISGGEKRRVSIACELVTSPLILFLDEPTSGLDANN 575

>KLLA0A10131g complement(889688..891850) similar to sp|P40416
           Saccharomyces cerevisiae YMR301c ATM1 ATP-binding
           cassette transporter protein, mitochondrial,
           hypothetical start
          Length = 720

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   + I+ +    +SGGE QR+AI   L     I   DE ++ LD+       K I+  
Sbjct: 579 PKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKEN 638

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFEGTP-----SKNAYARTPESLLTGCNKFLKNL 567
                KT+  + H  +     ADK+IV E        + NA    P SL +      +NL
Sbjct: 639 FSDVAKTSVYIAHR-LRTIADADKIIVLENGAVREEGTHNALLANPNSLYSELWNIQENL 697

Query: 568 NV 569
           ++
Sbjct: 698 DM 699

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 73/162 (45%), Gaps = 22/162 (13%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTK 158
           T  PG+   +VG +G GKST L+++         R+ DP +   ++    G +++    +
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVF--------RFYDPQQGRILLD---GKDIR----E 522

Query: 159 MLEDDIKAII------KPQYVDNIPRAIK-GPLQKVGELLKARMEKPEADVKMYIKILEL 211
           +  D+++ I+       P + D I   +K G +      +   +EK +    ++      
Sbjct: 523 LDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAIEKAQLSDLIHKLPKGT 582

Query: 212 QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
           + ++      +SGGE QR AI    ++   +  FDE +S LD
Sbjct: 583 ETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALD 624

>AGL142C [4170] [Homologous to ScYPL058C (PDR12) - NSH]
            (434247..438740) [4494 bp, 1497 aa]
          Length = 1497

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 36/199 (18%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L +LA + +                    G    N F    
Sbjct: 869  KPGTLTALMGYSGAGKTTLLDVLANRVRV-------------------GVVTGNIFVDGH 909

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLK--ARMEKPE--------ADVKMYIKILE 210
              D     K  Y     + + G  Q V + LK  A + +P+        A V+  IK+L 
Sbjct: 910  LRDTSFQRKTGYCQQ--QDLHGRTQTVRDALKFSAYLRQPQSISRAEKNAYVEDIIKLLG 967

Query: 211  LQNVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIR 265
            ++      V     G    + +R  IG+  V +  + +F DEP+S LD +   +   +I+
Sbjct: 968  MEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIK 1027

Query: 266  SLLDPTTYVICVEHDLSVL 284
             L++    ++C  H  S +
Sbjct: 1028 KLVNHGQAILCTIHQPSAI 1046

>AGR047W [4357] [Homologous to ScYDR135C (YCF1) - SH]
           complement(802685..807163) [4479 bp, 1492 aa]
          Length = 1492

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 78/184 (42%), Gaps = 31/184 (16%)

Query: 377 SEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKFPGTVRQ--LFF 434
           SE+  ++G+ G+GK+                   + NV+   Q +A    GTVR   LF 
Sbjct: 638 SELTCIIGKVGSGKSALIQAMLGDLFRVNGSAVVRGNVAYVSQ-VAWIMNGTVRDNILFG 696

Query: 435 KRIRAQFLNPQFQTDVCKPLRID---------DIIDQEVQHLSGGELQRVAIVLALGLPA 485
            +  A+F     QT     L +D           + ++   LSGG+  R+++  A+   A
Sbjct: 697 HKYDAKFYQ---QTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAVYARA 753

Query: 486 DIYLIDEPSAYLDSEQRIICSKVIRRFILHN--------KKTAFIVEHDFIMATYLADKV 537
           D YL+D+P A +D          + + +L N        K  A ++  + I A  +AD +
Sbjct: 754 DTYLLDDPLAAVDEH--------VAKHLLQNVFGPNGLLKSKARVLTTNKITALEIADHI 805

Query: 538 IVFE 541
           ++ E
Sbjct: 806 VLLE 809

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
           complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           +SGGE QR+AI   L   A +   DE ++ LD+         I++    N KT+  V H 
Sbjct: 572 ISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHR 631

Query: 527 FIMATYLADKVIVFE 541
            +     ADK+IV E
Sbjct: 632 -LRTIADADKIIVLE 645

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 68/159 (42%), Gaps = 24/159 (15%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
           G    +VG +G GKST LK++    +P  GR               G+++++     L  
Sbjct: 461 GMKTAIVGPSGSGKSTILKLVFRFYEPEQGRI-----------LVGGTDIRDLDLLSLRK 509

Query: 163 DIKAIIK--PQYVDNIPRAIK-GPLQKVGELLKARMEKPEADVKMYIKILE-----LQNV 214
            I  + +  P + D I   +K G +    + +   +EK +       K+L+        V
Sbjct: 510 AIGVVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQ-----LTKLLQNLPKGASTV 564

Query: 215 LKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
           +      +SGGE QR AI    ++ A +  FDE +S LD
Sbjct: 565 VGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATSALD 603

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 222  LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVEHD 280
            +SGG+ QR +I  + ++Q  + + DE +S LD       A +IR++L   T VI + H 
Sbjct: 1171 MSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLKNVT-VIVITHS 1228

 Score = 37.4 bits (85), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 8/100 (8%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P  ID ++ +    LSGG+ QRVA+  A      + ++DE  + LD   R +  + IR +
Sbjct: 482 PNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRELIVEAIRHW 541

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVF---EGTPSKNAY 549
                KT  I+ H++   T + D   V+   EGT  ++ +
Sbjct: 542 --RKGKTTIILTHEY---TQIKDDEYVYLMSEGTVVESGF 576

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            +SGG+ QR++I   L     I ++DE ++ LD+      +++IR  +L N     I   +
Sbjct: 1171 MSGGQAQRLSIARTLLRQPKIIILDECTSALDAANSFAIAELIRT-VLKNVTVIVITHSE 1229

Query: 527  FIMATYLADKVIVFEGTPSK--NAYARTPES 555
             +M   + D+V+V +    K   +YA   ES
Sbjct: 1230 QLMQ--ICDRVLVLKKGKVKEEGSYAELFES 1258

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%)

Query: 211 LQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR 257
           +  +L R    LSGG+ QR A+  + ++   V + DE  S LD+  R
Sbjct: 485 IDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSR 531

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
           cerevisiae YLR188w MDL1 ATP-binding cassette transporter
           family member, hypothetical start
          Length = 706

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 91/204 (44%), Gaps = 23/204 (11%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKIL-----AGKQKPNLGRYDDPPEWSDIIKYFRGSELQ 153
           T RPG+ + +VG +G GKST   +L      G  +  LG        +D I+ F   + +
Sbjct: 452 TVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLG--------NDNIRDFNLRKYR 503

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKIL--EL 211
                + ++ +  +     +DNI  A+  P + V +  +      +A+   ++      L
Sbjct: 504 RLLGVVQQEPM--LFSGTILDNITYAV--PQELVNDETRISRAIGQANCTKFLANFPDGL 559

Query: 212 QNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR--LNAALIIRSLLD 269
           Q  +    + LSGG+ QR A+  + +   ++ + DE +S LD +    +  +L  RS   
Sbjct: 560 QTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARG 619

Query: 270 PTTYVICVEHDLSVLDYLSDFICI 293
            TT  I + H +S + + S  I +
Sbjct: 620 KTT--ISIAHRVSTIQHSSRVIVL 641

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%)

Query: 466 HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVE 524
            LSGG+ QR+A+  A  L   I ++DE ++ LDS+   + ++ +++     K T  I  
Sbjct: 569 QLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQRSARGKTTISIAH 627

>Sklu_2316.1 YKL209C, Contig c2316 84-4016 reverse complement
          Length = 1310

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 78/182 (42%), Gaps = 24/182 (13%)

Query: 102  PGQVLGLVGTNGIGKST-ALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
             G+ + +VG +G GKST  L I A  + PN     D            G ++  + T  L
Sbjct: 1101 SGETIAVVGESGSGKSTLTLLISALYEVPNGSIEID------------GIDINRWDTNKL 1148

Query: 161  EDDIKAI-IKPQYVD-----NIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNV 214
               I  +  KPQ+ D     N+   I G + ++    + +     A V+ ++  L     
Sbjct: 1149 RTIISVVEQKPQFFDGTVGENLLYGISGRVTQI----QVKEALCLAGVQDFVFSLPEGLD 1204

Query: 215  LKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQ-RLNAALIIRSLLDPTTY 273
             + D S +SGG+ QR +I  + +++  +   DE +S LD       A LI +     TT 
Sbjct: 1205 TRIDTSLISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIANLIKKHFCGITTI 1264

Query: 274  VI 275
            VI
Sbjct: 1265 VI 1266

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 31/184 (16%)

Query: 352  AFQYP--PMKRTQGDFVLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXX------ 403
            +F YP  P         L+V  GE      + ++GE+G+GK+T                 
Sbjct: 1080 SFSYPSAPSTAIYKGLKLDVFSGE-----TIAVVGESGSGKSTLTLLISALYEVPNGSIE 1134

Query: 404  -----XXXXXXPKLNVSMKPQKIAPKF-PGTVRQLFFKRIRAQFLNPQFQTDVCK----- 452
                        KL   +   +  P+F  GTV +     I  +    Q +  +C      
Sbjct: 1135 IDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQD 1194

Query: 453  -----PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSK 507
                 P  +D  ID  +  +SGG+ QR++I  A+     I  +DE ++ LD+      + 
Sbjct: 1195 FVFSLPEGLDTRIDTSL--ISGGQAQRLSIARAMLRKPKILFLDECTSALDTSNTHAIAN 1252

Query: 508  VIRR 511
            +I++
Sbjct: 1253 LIKK 1256

>AFR432W [3624] [Homologous to ScYKL209C (STE6) - SH]
            complement(1213217..1217071) [3855 bp, 1284 aa]
          Length = 1284

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 81/189 (42%), Gaps = 32/189 (16%)

Query: 103  GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLED 162
            G  + +VG +G GKST   ++ G        Y   P       +  G+++ N+    L  
Sbjct: 1074 GTKVAIVGESGSGKSTLFYLICG-------LYPVKPA----SLFIDGTDICNWEMSALRK 1122

Query: 163  DIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMY-----IKILELQNVL-- 215
             I        V+  PR   G ++   E L   +E    D ++Y     ++I+     L  
Sbjct: 1123 IIAV------VEQKPRFFNGTIR---ENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPE 1173

Query: 216  ----KRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPT 271
                + D + +SGG+LQR +I  + +++  + + DE +S LD       A ++R+ L   
Sbjct: 1174 GLETRVDTNLVSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSLHDI 1233

Query: 272  TYVICVEHD 280
            T VI + H 
Sbjct: 1234 T-VIVITHS 1241

 Score = 32.7 bits (73), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 63/206 (30%), Positives = 88/206 (42%), Gaps = 44/206 (21%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKY----FRGSE--- 151
           T RP Q+  +VG +G GKST   +L       L  Y D   +  II       RG +   
Sbjct: 383 TFRPNQITFIVGKSGSGKSTLGNLL-------LKFYSD---YEGIITVNSTNLRGIDRSW 432

Query: 152 -LQN---------YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEAD 201
            LQN          F   L ++I    KP  V+    A+K   Q +  L K   + PE  
Sbjct: 433 LLQNITLVEQSCTLFNGTLFENITLSAKP--VNKTAGAVKRACQ-MALLEKLVFDLPEG- 488

Query: 202 VKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAA 261
                    L   +     ++SGG+ QR A+  + ++ A V + DE  S LD+  R    
Sbjct: 489 ---------LHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLM 539

Query: 262 LIIRSL-LDPTTYVICVEHDLS-VLD 285
            +IRS   D TT  I + H+LS VLD
Sbjct: 540 EVIRSWRADKTT--IILTHELSHVLD 563

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 467  LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
            +SGG+LQR++IV AL     + ++DE ++ LD+      + V+R   LH+  T  ++ H 
Sbjct: 1184 VSGGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNS-LHD-ITVIVITHS 1241

Query: 527  FIMATYLADKVIVFE 541
              M   + D+++V +
Sbjct: 1242 KQMMK-MCDRIVVLK 1255

>AER190W [2692] [Homologous to ScYCR011C (ADP1) - SH; ScYOL075C -
           SH] complement(994534..997569) [3036 bp, 1011 aa]
          Length = 1011

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 72/184 (39%), Gaps = 24/184 (13%)

Query: 366 VLNVEPGEFSDSEILVMMGENGTGKTTXXXXXXXXXXXXXXXXXPKLNVSMKPQKIAPKF 425
           +LN   G  S  EIL +MG +G GKT                   K+N     +    K 
Sbjct: 383 ILNSISGYVSPGEILAVMGGSGAGKTCLLDILGMKNKAGEVSGTVKINGVPITKHTVSKV 442

Query: 426 PGTVRQ---------LFFKRIRAQFLN-PQFQT---------DVCKPLRIDDIIDQEVQH 466
            G V Q         ++   + +  L  P+  +          V + LRI DI D+ + +
Sbjct: 443 VGFVDQDNHLLPTLTVYETVLNSALLRLPRSMSFAAKQKRVYQVLEELRIFDIRDRLIGN 502

Query: 467 -----LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAF 521
                +SGGE +RV+I   L     I  +DEP++ LDS       + + R     ++T  
Sbjct: 503 DFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNNANNVIECLVRLASQYRRTLV 562

Query: 522 IVEH 525
           +  H
Sbjct: 563 LSIH 566

>YLR188W (MDL1) [3591] chr12 (528302..530389) Member of the
           ATP-binding cassette (ABC) superfamily, equivalent to a
           "half-sized" ABC protein with one ATP-binding domain and
           one transmembrane domain, involved in release of
           peptides from mitochondria [2088 bp, 695 aa]
          Length = 695

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 92/230 (40%), Gaps = 34/230 (14%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPE---------WSDIIKYFRG 149
           T +PG+ +  VG +G GKST   +L      N G  +   E         +  +I Y + 
Sbjct: 456 TIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDIRNFNLRKYRRLIGYVQQ 515

Query: 150 SELQNYFTKMLEDDIKAIIKPQYV---DNIPRAIKGPLQKVGELLKARMEKPEADVKMYI 206
             L   F   + D+I   I P+     D I RAI           KA   K  A+     
Sbjct: 516 EPL--LFNGTILDNILYCIPPEIAEQDDRIRRAIG----------KANCTKFLANFPD-- 561

Query: 207 KILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
               LQ ++    + LSGG+ QR A+  + +    V + DE +S LD +     A  ++ 
Sbjct: 562 ---GLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQR 618

Query: 267 LLDPTTYVICVEHDLSVLDYLSDFICILYGVPSVYGVVTLPSSVREGINI 316
            ++     I + H LS + + +  I +       +G V    S R+ I I
Sbjct: 619 RVERGFTTISIAHRLSTIKHSTRVIVL-----GKHGSVVETGSFRDLIAI 663

 Score = 36.2 bits (82), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRR 511
           P  +  ++      LSGG+ QR+A+  A  L   + ++DE ++ LDS+   I +K ++R
Sbjct: 560 PDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQR 618

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 6/80 (7%)

Query: 439  AQFLNPQFQTDVCKPLRIDDIIDQE--VQHLSGGELQRVAIVLALGL----PADIYLIDE 492
            A+ LN    T V   +  +   D++  V+ LSGG+    AI L L +    PA  YL DE
Sbjct: 1146 AEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDE 1205

Query: 493  PSAYLDSEQRIICSKVIRRF 512
              A LD + RI  ++ I+  
Sbjct: 1206 IDAALDKQYRIAVARTIKNL 1225

>Sklu_2343.3 YPL270W, Contig c2343 2058-4382
          Length = 774

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDP-TTYVICVEHD 280
           LSGG+ QR AI  + +++ N+ + DE +S LDV+        +  L+      +I + H 
Sbjct: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672

Query: 281 LSVL 284
           LS +
Sbjct: 673 LSTI 676

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 56/139 (40%), Gaps = 13/139 (9%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+ QR+AI  AL    +I ++DE ++ LD E     +  + + +     T   + H 
Sbjct: 613 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSRDITIISIAHR 672

Query: 527 FIM------ATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNLNVTFRRDP----- 575
                       L D   V E    K  YA     L    N+  K  + T +R+      
Sbjct: 673 LSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNE--KARDTTSKRNAEAVEK 730

Query: 576 NSFRPRINKLDSQMDKEQK 594
           N   P+  KL  +  +EQ+
Sbjct: 731 NDPSPKAEKLSDEEKEEQR 749

>Scas_710.50
          Length = 602

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 75/159 (47%), Gaps = 8/159 (5%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGK-QKPNLGRYDDPPEWSDIIKYFRGSE--LQNY 155
           T +PG +  ++G +G GKST L +++G+ +     ++      S +    + SE   +N 
Sbjct: 25  TFKPGMINAIMGPSGSGKSTLLNLVSGRIESSFFAKF--ATTGSIMFNDVQISEEMFKNV 82

Query: 156 FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVK-MYIKILELQNV 214
            + + +DD   + K    +    A    L  + E  + R+ K +  ++ + +K  E   +
Sbjct: 83  CSYVSQDDDHLLAKLTVRETFKFAADLRLHNLTE--EQRVIKSDELIRALGLKHCENNII 140

Query: 215 LKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
               +  +SGGE +R  +G+  +    + + DEP+S LD
Sbjct: 141 GNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLD 179

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 457 DDIIDQE-VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           ++II  E ++ +SGGE +RV + + L     I L+DEP++ LDS       +++++  + 
Sbjct: 137 NNIIGNEFIKGISGGEKRRVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSVE 196

Query: 516 NKKTAFIVEH 525
             KT  I  H
Sbjct: 197 YGKTIIITIH 206

>Scas_468.1
          Length = 691

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY-VICVEHD 280
           LSGG+ QR AI  + +++ N+ + DE +S LDV+           L+   +  ++ + H 
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHR 589

Query: 281 LSVL 284
           LS +
Sbjct: 590 LSTI 593

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 500
           LSGG+ QR+AI  AL    +I ++DE ++ LD E
Sbjct: 530 LSGGQKQRIAIARALIKKPNILILDEATSALDVE 563

>Kwal_23.5161
          Length = 1489

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 19/180 (10%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGR------YDDPPEWSDIIKYFRGSELQN 154
           RPG ++ ++G  G G S+ LK +AG+ + N         YD  P+  +++K ++   + N
Sbjct: 175 RPGDMVLVLGRPGAGCSSFLKTIAGETR-NFEEVRGSISYDGIPQ-EEMMKKYKTDVIYN 232

Query: 155 YFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNV 214
                ++     +   Q +D    A+     +V     +R E   A  ++Y  I  L++ 
Sbjct: 233 ---GEMDVHFPHLTVQQTLD---FALSCTTPRVRLDGASRSEYITAMRELYGTIFGLRHT 286

Query: 215 LKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLD 269
               V       +SGGE +R +I  +   + ++Y +D  +  LD    L  A  IR++ +
Sbjct: 287 YNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTN 346

 Score = 36.6 bits (83), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 84/191 (43%), Gaps = 33/191 (17%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLE 161
            PG +  L+G +G GK+T L  LA +   N+G          II    G  L N   K ++
Sbjct: 873  PGSLTALMGESGAGKTTLLNTLAQR---NVG----------IIT---GDMLVN--GKPID 914

Query: 162  DDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE--------ADVKMYIKILELQN 213
               +   +  YV      +K    +      ARM +P+        A V+  I+IL++++
Sbjct: 915  ASFER--RTGYVQQQDVHVKEMTVRESFQFAARMRRPQSIPESEKLAYVEKIIEILDMED 972

Query: 214  VLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLL 268
              +  +  +  G    + ++ +IG+    + ++ +F DEP+S LD +       ++R L 
Sbjct: 973  YAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSWAIVQLMRRLA 1032

Query: 269  DPTTYVICVEH 279
            +    ++C  H
Sbjct: 1033 EAGQSILCTIH 1043

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIV 523
           V+ +SGGE +RV+I  AL     IY  D  +  LD+   +  ++ IR      K  A + 
Sbjct: 296 VRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAIRTMTNLQKSIALVT 355

>CAGL0G00242g complement(20428..24861) highly similar to sp|P53049
            Saccharomyces cerevisiae YGR281w YOR1 ATP-binding
            cassette transporter protein, hypothetical start
          Length = 1477

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 91/212 (42%), Gaps = 34/212 (16%)

Query: 103  GQVLGLVGTNGIGKSTALKILA-------------GKQKPNLGRYDDPPEWSDIIK---Y 146
            G+ +G+ G  G GKST +  L              G     LG YD   + S I +    
Sbjct: 1241 GEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVL 1300

Query: 147  FRGSELQNY--FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKM 204
            FRG+  +N   F +  +D +   +           I+G   +  +L   + +KP+ +   
Sbjct: 1301 FRGTIRKNLDPFNEFSDDSLWNSL-----------IRGGAIEKDDLEDIKHQKPDKNGSY 1349

Query: 205  -YIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALI 263
              +    L  +++ D +  S GE Q  A+  + V+Q+ + + DE +S +D +        
Sbjct: 1350 NNMHKFHLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQTR 1409

Query: 264  IRSLLDPTTYVICVEHDL-SVLDYLSDFICIL 294
            I +     T ++C+ H L ++L+Y  D I +L
Sbjct: 1410 IATEFQDCT-ILCIAHRLKTILNY--DRILVL 1438

>Scas_716.82
          Length = 675

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 82/186 (44%), Gaps = 23/186 (12%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLE 161
           PG +  ++G +G GK+T L  LA +   N+G         D++    G  +   F +   
Sbjct: 56  PGTMTAVMGESGAGKTTLLNTLAQR---NVGIIT-----GDML--INGRPIDASFERR-- 103

Query: 162 DDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARM---EKPEADVKMYIKILELQNVLKRD 218
                 ++ Q V      ++  LQ    + +A+    E+  A V+  I +L++Q   +  
Sbjct: 104 ---TGYVQQQDVHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIHVLDMQEYAEAL 160

Query: 219 VSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTTY 273
           V  +  G    + ++ +IG+  V + ++ +F DEP+S LD +       ++R L      
Sbjct: 161 VGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQS 220

Query: 274 VICVEH 279
           ++C  H
Sbjct: 221 ILCTIH 226

>KLLA0B09702g complement(842245..846801) highly similar to sp|Q02785
            Saccharomyces cerevisiae YPL058c PDR12 multidrug
            resistance transporter, start by similarity
          Length = 1518

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 89/193 (46%), Gaps = 34/193 (17%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLG---------RYDDPPEWSDIIKYFRGSE 151
            +PG++  L+G +G GK+T L +LA  Q+ ++G           D P  ++    Y   S+
Sbjct: 870  KPGKMTALMGESGAGKTTLLNVLA--QRISVGVITGDMLVNAKDLPLSFNRSCGYVAQSD 927

Query: 152  LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILEL 211
                   M E  ++  ++       P+++  PLQ          EK +  V+  I +L +
Sbjct: 928  -----NHMGELSVRESLRFAAELRQPKSV--PLQ----------EKYDY-VEKIISLLGM 969

Query: 212  QN----VLKRDVSALSGGELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRS 266
            +     ++ +    L+  + ++ +IG+  V + ++ +F DEP+S LD +   +    +R+
Sbjct: 970  EKYAEAIIGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRA 1029

Query: 267  LLDPTTYVICVEH 279
            L D    ++C  H
Sbjct: 1030 LADSGQSILCTIH 1042

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 98/225 (43%), Gaps = 31/225 (13%)

Query: 95  HRLPTPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG-----RYDDPPEWSDIIKYFRG 149
           H +     G++L +VG  G G ST LK ++G+    +       YD   + +++++ F+G
Sbjct: 167 HCVGVVESGEMLFVVGRPGAGCSTLLKCVSGETSELVEVTGDFSYDGLSQ-AEMMEKFKG 225

Query: 150 S-----ELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKM 204
                 EL  +F K+    +K  I      +     K P  ++  L  +R +  +    +
Sbjct: 226 YVIYCPELDFHFPKI---TVKETI------DFALKCKTPRVRIDHL--SRNQYVDNMRDL 274

Query: 205 YIKILELQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLN 259
           +  +  L++    +V       +SGGE +R ++  +    A++Y +D  +  LD    L 
Sbjct: 275 WCTVFGLRHTYATNVGNDVVRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALE 334

Query: 260 AALIIRS---LLDPTTYVICVEHDLSVLDYLSDFICILYGVPSVY 301
            A  IR+   L++ +  V   +   ++ + L D   +LY    VY
Sbjct: 335 FAQAIRTATNLMNNSAIVAIYQAGENIYE-LFDKTTVLYNGKQVY 378

 Score = 36.2 bits (82), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 29/47 (61%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V AL + A IY  D  +  LD+   +  ++ IR
Sbjct: 294 VRGVSGGERKRVSLVEALAMSASIYSWDNATRGLDASTALEFAQAIR 340

>Kwal_56.22329
          Length = 776

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 60/142 (42%), Gaps = 5/142 (3%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   D II      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  + + 
Sbjct: 614 PNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKL 673

Query: 513 ILHNKKTAFIVEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNLNVTFR 572
           +   + T   + H  +     ++ VIV     S     +  +      ++  K LN   R
Sbjct: 674 MKSKELTIISIAHR-LSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKR 732

Query: 573 RDPNSFRPRINKLDSQMDKEQK 594
             P    PR+   D + D+EQ+
Sbjct: 733 DKPT---PRVQS-DPEKDREQE 750

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 220 SALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY-VICVE 278
           ++LSGG+ QR AI  + +++  + + DE +S LDV+        +  L+      +I + 
Sbjct: 626 ASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSKELTIISIA 685

Query: 279 HDLSVLDYLSDFICI 293
           H LS +    + I +
Sbjct: 686 HRLSTIRRSENVIVL 700

>Kwal_14.2435
          Length = 1247

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 48/117 (41%), Gaps = 26/117 (22%)

Query: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  I+    H +  
Sbjct: 1140 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQ-- 1197

Query: 520  AFIVEHDFIMATYLADKVIV--------FEGTPSKNAYARTPESLLTGCNKFLKNLN 568
                   FI  T+  D + V        FE   S+ A     E++     KF+K  N
Sbjct: 1198 -------FICTTFRTDMLQVADSFYRVKFENKISEIATVSKQEAI-----KFIKGRN 1242

>Scas_552.4
          Length = 720

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 80/194 (41%), Gaps = 7/194 (3%)

Query: 99  TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWS-DIIKYFRGSELQNY 155
           T  P   +G+VG  G GKST +  L     P  G  + D+    S ++ K  R   +   
Sbjct: 474 TVAPKAKIGIVGRTGAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQ 533

Query: 156 FTKMLEDDIKAIIKP--QYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN 213
              +    IK+ + P  +Y D         +  V E + + +E      +   K L L N
Sbjct: 534 DPTLFTGTIKSNLDPYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLNLNN 593

Query: 214 VLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY 273
            +    S LS G+ Q   +  S ++   + + DE ++ +D          IR   + +T 
Sbjct: 594 EISEGGSNLSQGQRQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETIRKEFNSST- 652

Query: 274 VICVEHDL-SVLDY 286
           ++ + H L SV+DY
Sbjct: 653 ILTIAHRLRSVIDY 666

>Scas_695.24
          Length = 1288

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 77/190 (40%), Gaps = 38/190 (20%)

Query: 104  QVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLEDD 163
            + +GLVG +G GKST + +L          Y   P       Y  G+++ ++    L   
Sbjct: 1079 KTIGLVGESGSGKSTLMYLLTK-------LYQVAPH----SIYLDGTDVNDWGLMNLRTQ 1127

Query: 164  IKAI-IKPQYVD-----NIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVL-- 215
            I  +  KP   D     N+   I   +          ++    D+  Y+ I E    L  
Sbjct: 1128 ISVVEQKPTLFDGTVRENLSYGISTDI----------LDMELFDMLKYVGIYEFVESLPF 1177

Query: 216  ----KRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLD-- 269
                + D   LSGG+ QR  I  + +++  + + DE +S LD    L+A +II  + +  
Sbjct: 1178 GLDTRIDTKLLSGGQAQRICIARALLRKPKILILDECTSALDA---LSANIIIDIVKNGP 1234

Query: 270  PTTYVICVEH 279
            P    I + H
Sbjct: 1235 PALLTIVITH 1244

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 425  FPGTVRQLFFKRIRAQFLNPQFQTDVCK-----------PLRIDDIIDQEVQHLSGGELQ 473
            F GTVR+     I    L+ +   D+ K           P  +D  ID ++  LSGG+ Q
Sbjct: 1138 FDGTVRENLSYGISTDILDMEL-FDMLKYVGIYEFVESLPFGLDTRIDTKL--LSGGQAQ 1194

Query: 474  RVAIVLALGLPADIYLIDEPSAYLDS 499
            R+ I  AL     I ++DE ++ LD+
Sbjct: 1195 RICIARALLRKPKILILDECTSALDA 1220

>AFR683C [3876] [Homologous to ScYLR188W (MDL1) - SH]
           (1697345..1699378) [2034 bp, 677 aa]
          Length = 677

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/201 (22%), Positives = 86/201 (42%), Gaps = 23/201 (11%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWS-----DIIKYFRGSELQNYF 156
           PG+ + +VG +G GKST   +L         R+ DP   S     + I+ F  S+ +   
Sbjct: 455 PGEHVCIVGPSGGGKSTVASLLL--------RFYDPISGSITIGGEDIRLFNLSKYRRMM 506

Query: 157 TKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPE--ADVKMYIKIL--ELQ 212
             + ++ +  +     ++NI  A+  PL    +   AR+++    ++   ++      LQ
Sbjct: 507 GIVQQEPV--LFNASILENITYAL--PLHLTKD--PARIDRALRLSNCSAFVGSFPEGLQ 560

Query: 213 NVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTT 272
             +    + LSGG+ QR A+  + +Q   + + DE +S LD K     A  +        
Sbjct: 561 TAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAK 620

Query: 273 YVICVEHDLSVLDYLSDFICI 293
             I + H  S + + +  I +
Sbjct: 621 ITISIAHRKSTIQHSTRVIVL 641

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%), Gaps = 1/47 (2%)

Query: 466 HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE-QRIICSKVIRR 511
            LSGG+ QRVA+  A      I ++DE ++ LDS+ + I+ S +++R
Sbjct: 569 QLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVASTLLQR 615

>Kwal_27.9666
          Length = 1474

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 80/193 (41%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA +    +          DI+    G++    F + +
Sbjct: 854  KPGTLTALMGASGAGKTTLLDCLASRVTTGVVT-------GDIL--INGNKRDASFARSI 904

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMY----IKILELQNVLK 216
                    + Q +      ++  L+    L + +   P ++   Y    IKILE++    
Sbjct: 905  -----GYCQQQDLHLQTATVRESLRFAAHLRQPQ-SVPSSEKDKYVDEVIKILEMEKYAD 958

Query: 217  RDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPT 271
              V     G    + +R  IG+    +  + +F DEP+S LD +   +   ++R L +  
Sbjct: 959  AVVGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHG 1018

Query: 272  TYVICVEHDLSVL 284
              ++C  H  S L
Sbjct: 1019 QAILCTIHQPSAL 1031

>CAGL0E03355g complement(307242..311849) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 40/65 (61%), Gaps = 5/65 (7%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+  R+++  A+   AD+YL+D+  + +D+E   +C  +I+  +  ++KT  + +  
Sbjct: 750 LSGGQKTRLSLARAVYSRADLYLLDDILSAVDTE---VCKTIIKEVL--DEKTGLLKDKS 804

Query: 527 FIMAT 531
            ++AT
Sbjct: 805 IVLAT 809

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 5/92 (5%)

Query: 466  HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEH 525
            +LS G+ Q + +  AL   + I ++DE +A +D E   I  + IR+      +T   + H
Sbjct: 1428 NLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEF--ADRTILTIAH 1485

Query: 526  DFIMATYLADKVIVFEGTPSKNAYARTPESLL 557
              +   + +D++IV +G   K      PE+LL
Sbjct: 1486 R-LDTVFDSDRIIVLDGGEVKE--FDKPETLL 1514

>Scas_711.39
          Length = 1227

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +I++ 
Sbjct: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQL 1172

>YGR281W (YOR1) [2226] chr7 (1052829..1057262) Oligomycin-resistance
            factor, member of the ATP-binding cassette (ABC)
            superfamily [4434 bp, 1477 aa]
          Length = 1477

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 97/215 (45%), Gaps = 36/215 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKIL-------AGK------QKPNLGRYDDPPEWSDIIK-- 145
            + G+ +G+ G  G GKST +  L       AGK          LG +D   + + I +  
Sbjct: 1238 KSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDP 1297

Query: 146  -YFRGSELQNY--FTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKP-EAD 201
              FRG+  +N   F +  +D++         D + R   G + K  +L + +++KP E  
Sbjct: 1298 VLFRGTIRKNLDPFNERTDDEL--------WDALVRG--GAIAK-DDLPEVKLQKPDENG 1346

Query: 202  VKMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLN-A 260
                +    L   ++ + S  S GE Q  A+  + V+Q+ + + DE +S +D +      
Sbjct: 1347 THGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQ 1406

Query: 261  ALIIRSLLDPTTYVICVEHDL-SVLDYLSDFICIL 294
              I+    D T  ++C+ H L ++++Y  D I +L
Sbjct: 1407 TRIVEEFGDCT--ILCIAHRLKTIVNY--DRILVL 1437

>KLLA0D03476g 296287..300969 similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 pleiotropic drug resistance
            protein, start by similarity
          Length = 1560

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 42/192 (21%), Positives = 80/192 (41%), Gaps = 22/192 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G++G GK+T L  LA +    +          D++    G      F +  
Sbjct: 921  KPGTLTALMGSSGAGKTTLLDALADRISTGVIT-------GDVL--VNGRPTDASFQRS- 970

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLK-ARMEKPEAD--VKMYIKILELQNVLKR 217
                    + Q +    + ++  L     L +   + K E D  V+  I++LE++     
Sbjct: 971  ----TGYCQQQDLHGRTQTVREALTFSAYLRQPYNVSKKEKDEYVETIIRLLEMETYADA 1026

Query: 218  DVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTT 272
             V     G    + +R  IG+  V +  + +F DEP+S LD +   +   ++R L +   
Sbjct: 1027 LVGVTGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSGLDSQTAWSVCQLMRKLANHGQ 1086

Query: 273  YVICVEHDLSVL 284
             ++C  H  S +
Sbjct: 1087 AILCTIHQPSAI 1098

>ACR022W [1070] [Homologous to ScYPL270W (MDL2) - SH]
           complement(395427..397691) [2265 bp, 754 aa]
          Length = 754

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR--LNAALIIRSLLDPTTYVICVEH 279
           LSGG+ QR AI  + +++  + + DE +S LDV+    +N  L  R +      ++ + H
Sbjct: 597 LSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTL-GRLMRSKEITIVSIAH 655

Query: 280 DLSVLDYLSDFICI 293
            LS +    + + +
Sbjct: 656 RLSTIRRSENIVVL 669

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHN 516
           D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  + R +   
Sbjct: 587 DTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSK 646

Query: 517 KKTAFIVEH 525
           + T   + H
Sbjct: 647 EITIVSIAH 655

>CAGL0E03982g 378205..383184 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter, start by
            similarity
          Length = 1659

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 2/81 (2%)

Query: 207  KILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
            K L L+N +    + LS G+ Q   +  + ++   V + DE ++ +D          IR+
Sbjct: 1524 KFLNLENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRN 1583

Query: 267  LLDPTTYVICVEHDL-SVLDY 286
            + D +T V+ + H L SV+DY
Sbjct: 1584 VFDKST-VLTIAHRLRSVIDY 1603

>Scas_587.8
          Length = 715

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSK 507
           P  ++ ++      LSGG+ QR+A+  A  L   + ++DE ++ LDS+   I +K
Sbjct: 573 PEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAK 627

>YHL035C (YHL035C) [2251] chr8 complement(27976..32754) Member of the
            ATP-binding cassette (ABC) superfamily [4779 bp, 1592 aa]
          Length = 1592

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 81/193 (41%), Gaps = 10/193 (5%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYD-DPPEWS--DIIKYFRGSELQNYFTK 158
            P   +G+VG  G GKST +  L    +P  G    D  + S  D++   R   +      
Sbjct: 1349 PQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPI 1408

Query: 159  MLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEK----PEADVKMYIKILELQNV 214
            +    IK+ + P Y +   + I   L +V  +     E+     E     + K L L   
Sbjct: 1409 LFAGTIKSNVDP-YDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTE 1467

Query: 215  LKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYV 274
            +      LS GE Q   I  S +++  + + DE +S +D         IIRS  + +T +
Sbjct: 1468 IAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKST-I 1526

Query: 275  ICVEHDL-SVLDY 286
            + + H L SV+DY
Sbjct: 1527 LTIAHRLRSVIDY 1539

>Scas_472.1*
          Length = 393

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 13/106 (12%)

Query: 451 CKPLRIDD--IIDQEVQHLSGGELQRVAIVLALGLPADIYLI--DEPSAYLDSEQRIICS 506
           C  L +D   +    ++ LSGG  Q+V +VLA G     +LI  DEP+ YLD +     S
Sbjct: 228 CAMLGLDAELVSHSRIRGLSGG--QKVKLVLAAGTWQRPHLIVLDEPTNYLDRDSLGALS 285

Query: 507 KVIRRFILHNKKTAFIVEHDFIMATYLADKVIVFEG---TPSKNAY 549
           K ++ F    +    I+ H       L ++V   +    TPS + +
Sbjct: 286 KALKAF----EGGVIIITHSAEFTKNLTEEVWAVKDGKMTPSGHNW 327

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 25/45 (55%)

Query: 209 LELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD 253
           L+ + V    +  LSGG+  +  +     Q+ ++ + DEP++YLD
Sbjct: 233 LDAELVSHSRIRGLSGGQKVKLVLAAGTWQRPHLIVLDEPTNYLD 277

>YPL270W (MDL2) [5181] chr16 (30482..32803) Member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters, represents a half-sized ABC protein [2322
           bp, 773 aa]
          Length = 773

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLL-DPTTYVICVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+           L+   +  ++ + H 
Sbjct: 586 LSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHR 645

Query: 281 LSVL 284
           LS +
Sbjct: 646 LSTI 649

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 500
           P   D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E
Sbjct: 572 PNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVE 619

>Scas_567.1
          Length = 810

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 80/178 (44%), Gaps = 25/178 (14%)

Query: 103 GQVLGLVGTNGIGKSTALKILAGKQKPNL---GRYD-DPPEWSDIIKYFRGS-----ELQ 153
           G++L +VG  G G ST LK ++G+    +   G +  D  + ++++  ++G      EL 
Sbjct: 180 GEMLFVVGRPGAGCSTLLKTISGETSDMVEVQGDFSYDGLDQAEMMSKYKGYVVYCPELD 239

Query: 154 NYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQN 213
            +F K+    +K  I      +     K P  ++  +  +R E  ++   M+  +  L++
Sbjct: 240 FHFPKI---TVKETI------DFALKCKTPRTRIDNM--SRAEYVDSLRDMWCTVFGLRH 288

Query: 214 VLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
                V       +SGGE +R ++  +    A++Y +D  +  LD    L  A  IR+
Sbjct: 289 TYATKVGNDFVRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIRT 346

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 464 VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIR 510
           V+ +SGGE +RV++V A  + A IY  D  +  LD+   +  ++ IR
Sbjct: 299 VRGVSGGERKRVSLVEAQAMGASIYSWDNATRGLDASTALEFAQAIR 345

>Kwal_56.22747
          Length = 1538

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 5/65 (7%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+  R+++  A+   +D+YL+D+  + +D+E   +C ++I + +  +KKT  +    
Sbjct: 759 LSGGQKARLSLARAVYSRSDVYLLDDILSAVDAE---VCKRIIEQVL--SKKTGLLKNKT 813

Query: 527 FIMAT 531
            I+ T
Sbjct: 814 VILTT 818

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 28/175 (16%)

Query: 413  NVSMKPQKIAPKFPGTVR-----------QLFFKRIRAQFLNP---QFQTDVCKPLRIDD 458
            N+S+ PQ  A  F GTVR           +  +K +    L P   +   D   P + +D
Sbjct: 1365 NLSIIPQD-AQAFEGTVRTNLDPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEKKED 1423

Query: 459  IIDQEVQ----HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
            ++  ++     +LS G+ Q + +  AL   + I ++DE +A +DSE   +  + IR    
Sbjct: 1424 LLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEF- 1482

Query: 515  HNKKTAFIVEH--DFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNL 567
               +T   + H  D +M +   DK++V +    K     +P +LL   +    NL
Sbjct: 1483 -KDRTILTIAHRIDTVMDS---DKIMVLDKGEVKE--FDSPSNLLAQKDSIFYNL 1531

>KLLA0C14234g 1234598..1238962 similar to sp|P53049 Saccharomyces
           cerevisiae YGR281w YOR1 ATP-binding cassette transporter
           protein, start by similarity
          Length = 1454

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 20/133 (15%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLD--VKQRLNAALIIRSLLDPTTYVICVEH 279
           LSGG+  R A+  S  +  ++Y+FD+  S +D  V + +    ++  L   T   I   H
Sbjct: 698 LSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTR--ILATH 755

Query: 280 DLSVLDYLSDFICILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENLRFRTEALQFRLA 339
            LS++D  S    I  G+   + + T+P  ++                   ++ +QF+ +
Sbjct: 756 QLSLIDKASR--VIFLGLDGSFDIGTVPELLKRNTGF--------------SDLMQFQNS 799

Query: 340 EAGEELHSDAMRA 352
              EEL  D  +A
Sbjct: 800 APAEELEDDDTKA 812

 Score = 29.6 bits (65), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 13/95 (13%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+  R+A+  ++    DIYL D+  + +DS    +C  ++   ++      ++ +  
Sbjct: 698 LSGGQKARIALARSVYKDMDIYLFDDVLSAVDSR---VCKHIVDECMM-----GYLKQKT 749

Query: 527 FIMATY---LADKV--IVFEGTPSKNAYARTPESL 556
            I+AT+   L DK   ++F G          PE L
Sbjct: 750 RILATHQLSLIDKASRVIFLGLDGSFDIGTVPELL 784

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 11/108 (10%)

Query: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +++     +K  
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKEL---SKNA 1179

Query: 520  AFIVEHDFIMATYLADKV--IVFEGTPSKNAYARTPESL--LTGCNKF 563
             FI          +ADK   + +E   S        E++  + G NKF
Sbjct: 1180 QFICTTFRTDMLQVADKFFRVKYENKISTVIEVNREEAIGFIRGSNKF 1227

>Kwal_26.6702
          Length = 617

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 206 IKILELQNVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNA 260
           IKILE+Q      V     G    + +R  IG+    +  + +F DEP+S LD +   + 
Sbjct: 87  IKILEMQKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLLFLDEPTSGLDSQTAWSI 146

Query: 261 ALIIRSLLDPTTYVICVEHDLSVL 284
             ++R L +    ++C  H  S L
Sbjct: 147 CQLMRRLANHGQAILCTIHQPSAL 170

>Scas_707.8
          Length = 294

 Score = 33.5 bits (75), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 96  RLPTPRPGQVLGLVGTNGIGKSTALKILAGKQ 127
           +L  P   + L +VG NG GKST LK+LAGK 
Sbjct: 27  KLQVPWHTRTL-VVGANGAGKSTLLKLLAGKH 57

>KLLA0D00748g complement(69839..72208) similar to sp|P33311
           Saccharomyces cerevisiae YPL270w MDL2 ATP-binding
           cassette (ABC) transporter family member, hypothetical
           start
          Length = 789

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR--LNAALIIRSLLDPTTYVICVEH 279
           LSGG+ QR AI  + + +  + + DE +S LDV+    +N  L  R +      +I + H
Sbjct: 612 LSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTL-GRLMKSKELTIISIAH 670

Query: 280 DLSVLDYLSDFICI 293
            LS +    + I +
Sbjct: 671 RLSTIRRSENVIVL 684

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%)

Query: 453 PLRIDDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRF 512
           P   + II      LSGG+ QR+AI  AL     I ++DE ++ LD E     +  + R 
Sbjct: 598 PNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYTLGRL 657

Query: 513 ILHNKKTAFIVEH 525
           +   + T   + H
Sbjct: 658 MKSKELTIISIAH 670

>CAGL0A01133g 112037..114442 similar to sp|P33311 Saccharomyces
           cerevisiae YPL270w MDL2, hypothetical start
          Length = 801

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 222 LSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTY-VICVEHD 280
           LSGG+ QR AI  + +++  + + DE +S LDV+           L+      ++ + H 
Sbjct: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668

Query: 281 LSVLDYLSDFICI 293
           LS +    + I +
Sbjct: 669 LSTIRRSENVIVL 681

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%)

Query: 457 DDIIDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 500
           D +I      LSGG+ QR+AI  AL     I ++DE ++ LD E
Sbjct: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642

>Scas_714.42
          Length = 1520

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 85/208 (40%), Gaps = 54/208 (25%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G                          ++
Sbjct: 897  KPGTLTALMGASGAGKTTLLDCLA--ERVTMG--------------------------VI 928

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQK--------VGELLK--ARMEKPEADVKM------ 204
              D+    +P+   + PR+I    Q+        V E L+  A + +P ADV +      
Sbjct: 929  TGDVLVNGRPR-DQSFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQP-ADVSIEEKNQY 986

Query: 205  ---YIKILELQNVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQ 256
                IKILE++      V     G    + +R  IG+    +  + +F DEP+S LD + 
Sbjct: 987  VEDVIKILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQT 1046

Query: 257  RLNAALIIRSLLDPTTYVICVEHDLSVL 284
              +   +++ L D    ++C  H  S +
Sbjct: 1047 AWSICQLMKKLADHGQAILCTIHQPSAI 1074

>Kwal_26.9532
          Length = 1471

 Score = 33.5 bits (75), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 83/211 (39%), Gaps = 28/211 (13%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILA-------------GKQKPNLGRYDDPPEWSDIIK-- 145
            R G+ +G+ G  G GKST +  L              G     LG Y+   + + I +  
Sbjct: 1232 RGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDP 1291

Query: 146  -YFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKM 204
              F+G   +N       D        +  D + RA  G +    E     + +  A    
Sbjct: 1292 VLFKGDVRKNL------DPFHERSDNELWDALVRA--GAIATEDEAAARAVTRATAGALT 1343

Query: 205  YIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALII 264
             +    L+  ++ D S  S GE Q  A+  + V+ + + + DE +S +D +        I
Sbjct: 1344 NLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEATSSVDYETDAKIQARI 1403

Query: 265  RSLLDPTTYVICVEHDL-SVLDYLSDFICIL 294
                   T V+C+ H L ++LDY  D I +L
Sbjct: 1404 ADAFSECT-VLCIAHRLNTILDY--DRILVL 1431

>Scas_622.9
          Length = 1657

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 9/192 (4%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWS-DIIKYFRGSELQNYFTK 158
            P   +G+VG  G GKST +  +     P  G  + DD    S ++ K  R   +      
Sbjct: 1412 PKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPT 1471

Query: 159  MLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADV---KMYIKILELQNVL 215
            +    IK  + P Y +    AI   L++V  + +  ++         +   K L L+N +
Sbjct: 1472 LFTGTIKLNLDP-YNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNLENEI 1530

Query: 216  KRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVI 275
                S LS G+ Q   +  S ++   + + DE ++ +D          IR     +T ++
Sbjct: 1531 TEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQST-IL 1589

Query: 276  CVEHDL-SVLDY 286
             + H L SV+DY
Sbjct: 1590 TIAHRLRSVIDY 1601

>YDR406W (PDR15) [1232] chr4 (1279198..1283787) Member of ATP-binding
            cassette (ABC) superfamily [4590 bp, 1529 aa]
          Length = 1529

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 79/197 (40%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILA-----GKQKPNL---GRYDDPPEWSDIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA     G    N+   GR  D   +   I Y +  +L
Sbjct: 911  KPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGRLRDE-SFPRSIGYCQQQDL 969

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQ 212
                  +    ++  ++       P ++              +E+    V+  IKILE+Q
Sbjct: 970  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNRYVEEVIKILEMQ 1011

Query: 213  NVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSL 267
                  V     G    + +R  IG+    +  + +F DEP+S LD +   +   ++R L
Sbjct: 1012 QYSDAVVGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTAWDTCQLMRKL 1071

Query: 268  LDPTTYVICVEHDLSVL 284
                  ++C  H  S +
Sbjct: 1072 ATHGQAILCTIHQPSAI 1088

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   +  +++ 
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQL 1175

>KLLA0E00462g complement(39173..44125) similar to sp|P32386
            Saccharomyces cerevisiae YLL048c YBT1 yeast bile
            transporter, start by similarity
          Length = 1650

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 20/195 (10%)

Query: 106  LGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWSDIIKYFRGS-----ELQNYFTK 158
            +G+VG  G GKST +  L     P  G  + DD    +  +K  R S     +    FT 
Sbjct: 1406 VGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTG 1465

Query: 159  MLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYI------KILELQ 212
             L+ ++       Y +     I   L++V  +    +  P       +      K L+L+
Sbjct: 1466 TLKTNLDP-----YNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLDLE 1520

Query: 213  NVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTT 272
            N +    S LS G+ Q   +  S ++   V + DE ++ +D          IR     +T
Sbjct: 1521 NEVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNST 1580

Query: 273  YVICVEHDL-SVLDY 286
             ++ + H L S++DY
Sbjct: 1581 -ILTIAHRLRSIIDY 1594

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 37/75 (49%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+ QRV++  +L   +   L+D+  + +DS   +   +      L   +T  +V H+
Sbjct: 840 LSGGQKQRVSLARSLYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCVLVSHN 899

Query: 527 FIMATYLADKVIVFE 541
             +    AD VI+ E
Sbjct: 900 VALTLKNADWVIIME 914

>CAGL0F02717g 261361..265989 tr|O74208 Candida glabrata ATP-binding
            cassette transporter, identified start
          Length = 1542

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 42/197 (21%), Positives = 79/197 (40%), Gaps = 32/197 (16%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNL--------GRYDDPPEWSDIIKYFRGSEL 152
            +PG +  L+G +G GK+T L  LA +    +        GR  D   +S  I Y +  +L
Sbjct: 912  KPGTLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDT-SFSRSIGYCQQQDL 970

Query: 153  QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQ 212
                  +    ++  ++       P ++              +E+    V+  IKILE++
Sbjct: 971  H-----LKTATVRESLRFSAYLRQPSSVS-------------IEEKNEYVEAVIKILEME 1012

Query: 213  NVLKRDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSL 267
                  V     G    + +R  IG+    +  + +F DEP+S LD +       +++ L
Sbjct: 1013 TYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKL 1072

Query: 268  LDPTTYVICVEHDLSVL 284
             +    ++C  H  S +
Sbjct: 1073 ANHGQAILCTIHQPSAM 1089

>YLL015W (BPT1) [3404] chr12 (116431..121110) Membrane transporter
           of the ATP-binding cassette (ABC) superfamily, mediates
           transport of glutathione conjugates into the vacuole
           [4680 bp, 1559 aa]
          Length = 1559

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 5/65 (7%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+  R+++  A+   ADIYL+D+  + +D+E     SK I  ++L   KTA +    
Sbjct: 770 LSGGQKARLSLARAVYSRADIYLLDDILSAVDAE----VSKNIIEYVLIG-KTALLKNKT 824

Query: 527 FIMAT 531
            I+ T
Sbjct: 825 IILTT 829

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 7/90 (7%)

Query: 456  IDDIIDQEVQ----HLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRR 511
            ++DI+D ++     +LS G+ Q + +  AL   + I ++DE +A +D E   I    IRR
Sbjct: 1441 VNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRR 1500

Query: 512  FILHNKKTAFIVEHDFIMATYLADKVIVFE 541
                  +T   + H  I     +DK+IV +
Sbjct: 1501 --EFKDRTILTIAHR-IDTVLDSDKIIVLD 1527

>CAGL0C03289g 328799..333745 similar to sp|P32386 Saccharomyces
            cerevisiae YLL048c YBT1 yeast bile transporter,
            hypothetical start
          Length = 1648

 Score = 33.1 bits (74), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 81/209 (38%), Gaps = 35/209 (16%)

Query: 99   TPRPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTK 158
            T  P + +G+VG  G GKST +  L    + + G           IK   G  + N   K
Sbjct: 1395 TIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGS----------IK-LDGVNIANIDLK 1443

Query: 159  MLEDDIKAIIKPQ---------------YVDNIPRAIKGPLQKVGELLKARMEKPEADV- 202
             L   I  I  PQ               Y +     I   L++V  +    ME   +++ 
Sbjct: 1444 RLRRSITII--PQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQ 1501

Query: 203  ----KMYIKILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRL 258
                K   K L L++ +    S  S G+ Q   +  S ++   V + DE ++ +D     
Sbjct: 1502 SNSSKNVNKFLNLESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDA 1561

Query: 259  NAALIIRSLLDPTTYVICVEHDL-SVLDY 286
                 IR   + +T V+ + H L S++DY
Sbjct: 1562 KIQETIRQEFNNST-VLTIAHRLRSIVDY 1589

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 9/86 (10%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRI-ICSKVIRRFILHNKKTAFIVEH 525
           LSGG+ QRV++  AL   A   L+D+  + +DS   + I  K I   ++   +T  +V H
Sbjct: 847 LSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEG-RTCILVTH 905

Query: 526 DFIMATYLADKVIVFE-------GTP 544
           +  +    AD V++ E       GTP
Sbjct: 906 NIALTMKNADFVVMIEDGKVKEKGTP 931

>KLLA0A04961g 442461..444818 highly similar to sp|P07264
           Saccharomyces cerevisiae YGL009c LEU1 3-isopropylmalate
           dehydratase, start by similarity
          Length = 785

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 11/89 (12%)

Query: 307 PSSVREGINIFL--DG-HIPSENLRFRTEAL---QFRLAEAGEELHSDAMRAFQY---PP 357
           P+S  +G++ FL  DG   P +     T+A+   QF        L S     +++   P 
Sbjct: 548 PTSAPKGMDPFLKLDGIAAPVDKANVDTDAIIPKQFLKTIKRTGLKSGLFYEWRFTKGPD 607

Query: 358 MKRTQGDFVLNVEPGEFSDSEILVMMGEN 386
            K  + D+VLNVEP  + ++EILV+ G+N
Sbjct: 608 GKDVETDWVLNVEP--WRNAEILVITGDN 634

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   ++ I + 
Sbjct: 1112 VEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQL 1164

>ACL072C [977] [Homologous to ScYLL048C (YBT1) - SH; ScYHL035C - SH]
           (224562..229445) [4884 bp, 1627 aa]
          Length = 1627

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%)

Query: 460 IDQEVQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519
           I ++   LSGG+ QR+++  AL   A   L+D+  + +DS   ++  +      L   +T
Sbjct: 806 IGEKGMTLSGGQKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRT 865

Query: 520 AFIVEHDFIMATYLADKVIVFE 541
             +V H+  +    AD V++ E
Sbjct: 866 CVLVSHNVALTMRNADWVVILE 887

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 81/201 (40%), Gaps = 25/201 (12%)

Query: 102  PGQVLGLVGTNGIGKSTALKILAGKQKPNLG--RYDDPPEWSDIIKYFRGSELQNYFTKM 159
            P   +G+VG  G GKST +  +     P  G  + D+       I       L+   T +
Sbjct: 1380 PKLKVGIVGRTGAGKSTIITAMFRFLDPETGFVKIDNID-----ITTIPLHRLRQSITII 1434

Query: 160  LED------DIKAIIKP--QYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYI----- 206
             +D       +K+I+ P  QY D   + I   LQ+V  L    +    +           
Sbjct: 1435 PQDPTLFTGTLKSILDPYSQYSD---KQIYEALQRVNLLSDTDINSLSSPSTQSSGENIN 1491

Query: 207  KILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
            K L+L N +    + LS G+ Q   +  S ++   + M DE ++ +D          IR 
Sbjct: 1492 KFLDLNNEVTEGGANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE 1551

Query: 267  LLDPTTYVICVEHDL-SVLDY 286
                +T ++ + H L S++DY
Sbjct: 1552 EFRDST-ILTIAHRLKSIIDY 1571

>KLLA0F20075g complement(1868786..1873336) similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 glutathione
           S-conjugate transporter, vacuolar, start by similarity
          Length = 1516

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE--QRIICSKVIRRFILHNKKTAFIVE 524
           LSGG+  R+++  A+   AD YL+D+P A +D    + +I   +    +LH+K    ++ 
Sbjct: 750 LSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTK--VLA 807

Query: 525 HDFIMATYLADKVIVFEGTP--SKNAYARTPESLLTGCNKFLKNLNVTFRRDPNSFRPRI 582
            + I    +AD + + E      + +Y +  ES  +  +K +       +  P+     +
Sbjct: 808 TNKITVLSIADSITLMENGEIIQQGSYDQVNESTNSPLSKLIAEFGKKGKPTPSQSTTSL 867

Query: 583 NKLDSQ 588
            KL S+
Sbjct: 868 AKLASE 873

>YFL028C (CAF16) [1655] chr6 complement(79342..80211) Protein that
           associates with Ccr4p, member of the non-transporter
           group of the ATP-binding cassette (ABC) superfamily [870
           bp, 289 aa]
          Length = 289

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 70/167 (41%), Gaps = 38/167 (22%)

Query: 108 LVGTNGIGKSTALKILAGKQ---------------KP-NLGRYDDPPEWSDIIKYFRGSE 151
           +VG NG GKST LK+L+GK                 P ++ + DD     D   Y   + 
Sbjct: 39  VVGANGAGKSTLLKLLSGKHLCLDGKILVNGLDPFSPLSMNQVDDDESVEDSTNYQTTTY 98

Query: 152 LQNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVG-ELLKARMEKPEADVKMYIKILE 210
           L   +  M      +II      N    +   L+ +G +  + R E+        ++IL+
Sbjct: 99  LGTEWCHM------SII------NRDIGVLELLKSIGFDHFRERGER-------LVRILD 139

Query: 211 LQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR 257
           +   ++  +  LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 140 ID--VRWRMHRLSDGQKRRVQLAMGLLKPWRVLLLDEVTVDLDVIAR 184

>Sklu_1870.3 YFL028C, Contig c1870 3336-4133
          Length = 265

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 70/160 (43%), Gaps = 32/160 (20%)

Query: 108 LVGTNGIGKSTALKILAGKQKPNLGRY----DDPPEWSDIIKYFRGSELQNYFTKMLED- 162
           +VG+NG GKST LK+L+GK     GR      DP         F  + +Q    K  ED 
Sbjct: 37  VVGSNGAGKSTLLKLLSGKHLCLNGRILVNGLDP---------FSPTSMQ----KDAEDC 83

Query: 163 DIKAIIKPQY----VDNIPRAIKGPLQKVG-ELLKARMEKPEADVKMYIKILELQNVLKR 217
            I   +  ++    + N    I   L  +G E  + R E+        I IL++   L+ 
Sbjct: 84  QITTYLGTEWCHMSIINRDIGILELLNSIGFEHYRERGEE-------LISILDID--LEW 134

Query: 218 DVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQR 257
            +  LS G+ +R  + M  ++   V + DE +  LDV  R
Sbjct: 135 RMHRLSDGQKRRVQLTMGLLKPWKVLLLDEVTVDLDVVAR 174

>Scas_612.11*
          Length = 1506

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 80/195 (41%), Gaps = 27/195 (13%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
           + G+ + +VG  G GK++ L   AG      GR               G  L   +  + 
Sbjct: 657 KKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQ-----------INGDLLLCGYPWIQ 705

Query: 161 EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLKRDVS 220
              +K        DNI         K  E+++    K + D+   +   +L  + +R ++
Sbjct: 706 NASVK--------DNIIFGSPYNKAKYDEVIRVCSLKSDLDI---LPAGDLTEIGERGIT 754

Query: 221 ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLD--VKQRLNAALIIRSLLDPTTYVICVE 278
            LSGG+  R  +  S  +Q ++Y+FD+  S +D  V + +     +  L D T   I   
Sbjct: 755 -LSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTR--ILAT 811

Query: 279 HDLSVLDYLSDFICI 293
           H LS+L+  S  I +
Sbjct: 812 HQLSLLERASRVIVL 826

>Kwal_14.1242
          Length = 269

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           ++G+NG GKST LK+L+GK 
Sbjct: 37  IIGSNGAGKSTLLKLLSGKH 56

>ADR028W [1769] [Homologous to ScYGR089W - SH]
           complement(753948..756446) [2499 bp, 832 aa]
          Length = 832

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 1/80 (1%)

Query: 512 FILHNKKTAFIVEHDFIMATYLADKVIVFEGTPSKNAYARTPESLLTGCNKFLKNLNVTF 571
           F + N KT      D I+A   +   I  E T  +  Y R+ E+ L   +++   L+ TF
Sbjct: 669 FKIDNLKTVLHKNEDQILALEASLAAIHDEQTALETEYLRSKENRLQRRSEY-DELDATF 727

Query: 572 RRDPNSFRPRINKLDSQMDK 591
           +RD  S   R++KL S +++
Sbjct: 728 KRDILSAHERLSKLQSDLEQ 747

>YDR135C (YCF1) [981] chr4 complement(722998..727545) Vacuolar
           glutathione S-conjugate transporter, member of the
           ATP-binding cassette (ABC) superfamily [4548 bp, 1515
           aa]
          Length = 1515

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 21/100 (21%)

Query: 427 GTVRQ--LFFKRIRAQFLNPQFQTDVCKPLRID---------DIIDQEVQHLSGGELQRV 475
           GTV++  LF  R  A+F     +   C  L ID          ++ ++   LSGG+  R+
Sbjct: 705 GTVKENILFGHRYDAEFYEKTIKA--C-ALTIDLAILMDGDKTLVGEKGISLSGGQKARL 761

Query: 476 AIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILH 515
           ++  A+   AD YL+D+P A +D         V R  I H
Sbjct: 762 SLARAVYARADTYLLDDPLAAVDEH-------VARHLIEH 794

>Kwal_56.23844
          Length = 1494

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLD 498
           LSGG+  R+++  A+   AD YL+D+P A +D
Sbjct: 738 LSGGQKARISLARAVYARADTYLLDDPLAAVD 769

>AFR152C [3344] [Homologous to ScYFL028C (CAF16) - SH]
           (710017..710829) [813 bp, 270 aa]
          Length = 270

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           L G+NG GKST LK+L+GK 
Sbjct: 39  LCGSNGAGKSTLLKLLSGKH 58

>YOR328W (PDR10) [5109] chr15 (931798..936492) Member of ATP-binding
            cassette (ABC) superfamily [4695 bp, 1564 aa]
          Length = 1564

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 41/192 (21%), Positives = 78/192 (40%), Gaps = 22/192 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA +    L   D          +  G      F + +
Sbjct: 950  KPGTLTALIGASGAGKTTLLDCLAERTTMGLITGD---------VFVDGRPRDQSFPRSI 1000

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKA---RMEKPEADVKMYIKILELQNVLKR 217
                    + Q +      ++  L+    L +A    +E+ +  V+  I++LE++     
Sbjct: 1001 -----GYCQQQDLHLKTATVRESLRFSAYLRQADDVSIEEKDKYVEEVIEVLEMKLYADA 1055

Query: 218  DVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTT 272
             V     G    + +R  IG+    +  + +F DEP+S LD +   +   +++ L     
Sbjct: 1056 IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSTCQLMKKLASRGQ 1115

Query: 273  YVICVEHDLSVL 284
             ++C  H  S L
Sbjct: 1116 AILCTIHQPSAL 1127

>KLLA0F08833g 822039..822860 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member singleton, start by similarity
          Length = 273

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 40  VVGNNGAGKSTLLKLLSGKH 59

>CAGL0K12474g 1217183..1218067 similar to sp|P43569 Saccharomyces
           cerevisiae YFL028c CAF16 ATP-binding cassette
           transporter family member, start by similarity
          Length = 294

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 16/20 (80%)

Query: 108 LVGTNGIGKSTALKILAGKQ 127
           +VG NG GKST LK+L+GK 
Sbjct: 38  VVGANGAGKSTLLKLLSGKH 57

>Scas_643.1
          Length = 1289

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 219 VSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTTYVICVE 278
           V  +SGGE +R +I  + +   +VY++D  +  LD    L+   I++ + + T  V  V+
Sbjct: 180 VRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTEATKSVNLVK 239

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 43/90 (47%), Gaps = 3/90 (3%)

Query: 215 LKRDVSALSGGELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTTY 273
           + + V+ LS  + +  +IG+  V + ++ +F DEP+S LD +  L     ++ L      
Sbjct: 864 MNKLVAKLSPTQKKLLSIGVELVTKPSLLLFLDEPTSGLDSEAALTIVKFLKKLSQQGQA 923

Query: 274 VICVEH--DLSVLDYLSDFICILYGVPSVY 301
           + C  H    SV+ Y  +   +  G  SV+
Sbjct: 924 IFCTIHQPSKSVISYFDNIFLLKRGGESVF 953

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 456 IDDIIDQE-VQHLSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFIL 514
           +D ++  + V+ +SGGE +R++I+        +YL D  +  LDS   +    ++++   
Sbjct: 171 MDTVVGNDFVRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALDFLSILKKMTE 230

Query: 515 HNKKTAFI--------VEHDFIMATYLADKVIVFEGT 543
             K    +        + + F     L+D   VF GT
Sbjct: 231 ATKSVNLVKISQASDKIVNKFDKILMLSDSYQVFYGT 267

>YOR153W (PDR5) [4952] chr15 (619840..624375) Drug-efflux pump
            involved in resistance to multiple drugs, member of the
            ATP-binding cassette (ABC) superfamily [4536 bp, 1511 aa]
          Length = 1511

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 24/193 (12%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G         DI+    G      F + +
Sbjct: 896  KPGTLTALMGASGAGKTTLLDCLA--ERVTMGVIT-----GDIL--VNGIPRDKSFPRSI 946

Query: 161  ----EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILELQNVLK 216
                + D+   +K   V    R     L++  E+    +E+    V+  IKILE++    
Sbjct: 947  GYCQQQDLH--LKTATVRESLR-FSAYLRQPAEV---SIEEKNRYVEEVIKILEMEKYAD 1000

Query: 217  RDVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPT 271
              V     G    + +R  IG+    +  + +F DEP+S LD +   +   +++ L +  
Sbjct: 1001 AVVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHG 1060

Query: 272  TYVICVEHDLSVL 284
              ++C  H  S +
Sbjct: 1061 QAILCTIHQPSAI 1073

>CAGL0L06402g 718726..723333 highly similar to sp|P39109
           Saccharomyces cerevisiae YDR135c YCF1 or sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, hypothetical
           start
          Length = 1535

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 500
           LSGG+  R+++  A+   AD YL+D+P A +D  
Sbjct: 772 LSGGQKARLSLARAVYARADTYLLDDPLAAVDEH 805

>YGL009C (LEU1) [1964] chr7 complement(476316..478655)
           3-Isopropylmalate dehydratase, catalyzes the conversion
           of 2-isopropylmalate to 3-isopropylmalate, the second
           step in leucine biosynthesis pathway [2340 bp, 779 aa]
          Length = 779

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 2/28 (7%)

Query: 359 KRTQGDFVLNVEPGEFSDSEILVMMGEN 386
           K  + DFVLNVEP  + ++EILV+ G+N
Sbjct: 599 KDQETDFVLNVEP--WREAEILVVTGDN 624

>YOR011W (AUS1) [4826] chr15 (349678..353862) Protein involved in
           sterol uptake and anaerobic growth, member of the
           ATP-binding cassette (ABC) superfamily of membrane
           transporters [4185 bp, 1394 aa]
          Length = 1394

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 211 LQNVLKRDVS-----ALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIR 265
           L +VLK  V       +SGGE +R +I  + +   +VY++D  +  LD    L+   I+R
Sbjct: 156 LSHVLKTIVGNDFFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSATALDFLEILR 215

Query: 266 SLLDPT 271
            +   T
Sbjct: 216 KMAKAT 221

>KLLA0B02563g complement(222951..225377) similar to sp|P34230
           Saccharomyces cerevisiae YKL188c PXA2 ABC transporter,
           peroxisomal, start by similarity
          Length = 808

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 29/69 (42%), Gaps = 15/69 (21%)

Query: 72  IINLPTNLDSQVTHRYSANSFKLHRLPTPRP-GQVL--------------GLVGTNGIGK 116
           IIN P   D  V   Y  N  +   +P   P GQVL               ++G NG GK
Sbjct: 484 IINAPKERDDTVPVEYDDNVIEFQNVPLITPTGQVLISELTFKLERFNHLLIIGPNGCGK 543

Query: 117 STALKILAG 125
           S+  ++L G
Sbjct: 544 SSLFRVLGG 552

>Sklu_1859.2 YDL148C, Contig c1859 1033-3507 reverse complement
          Length = 824

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 553 PESLLTGCNKFLKNLNVTFRR-DPNSFRPRINKLDSQMDKEQKLS 596
           P S+ T   KF +N N   +  DPN  R  INK+ +Q+ KE+K +
Sbjct: 721 PVSIPTYAPKFEENFNPDKKSYDPNRTRSEINKMKAQVKKERKFT 765

>Scas_167.1*
          Length = 279

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 74/160 (46%), Gaps = 23/160 (14%)

Query: 102 PGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKMLE 161
           PG +  L+G +G GK+T L  LA   + N+G         D++    G  +   F +   
Sbjct: 125 PGTLTALMGESGAGKTTLLNTLA---QRNVGIIT-----GDML--INGHPIDASFERR-- 172

Query: 162 DDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARM---EKPEADVKMYIKILELQNVLKRD 218
                 ++ Q +      ++  LQ    + +A+    E+  A V+  I++L+++   +  
Sbjct: 173 ---TGYVQQQDIHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIQVLDMEYYAEAL 229

Query: 219 VSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLD 253
           V  +  G    + ++ +IG+  V + ++ +F DEP+S LD
Sbjct: 230 VGEIGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLD 269

>YLL048C (YBT1) [3375] chr12 complement(41279..46264) Protein with
            similarity to mammalian ATP-dependent bile acid
            transporter, member of the ATP-binding cassette (ABC)
            superfamily [4986 bp, 1661 aa]
          Length = 1661

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 79/195 (40%), Gaps = 16/195 (8%)

Query: 106  LGLVGTNGIGKSTALKILAGKQKPNLGRYD-DPPEWS--DIIKYFRGSELQNYFTKMLED 162
            +G+VG  G GKST +  L    +P  G    D  + S  D+ +  R   +      +   
Sbjct: 1411 IGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSG 1470

Query: 163  DIKAIIKPQYVDNIPRAIKGPLQKV----------GELLKARMEKPEADVKMYIKILELQ 212
             IK  + P Y +   R I   L++V          G   +   E    + +   K L+L 
Sbjct: 1471 TIKTNLDP-YDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSENVNKFLDLS 1529

Query: 213  NVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRSLLDPTT 272
            + +    S LS G+ Q   +  S ++   + + DE ++ +D          IR     +T
Sbjct: 1530 SEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGST 1589

Query: 273  YVICVEHDL-SVLDY 286
             ++ + H L SV+DY
Sbjct: 1590 -ILTIAHRLRSVIDY 1603

>Scas_693.42
          Length = 1512

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSE 500
           LSGG+  R+++  A+   AD YL+D+P A +D  
Sbjct: 750 LSGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 783

>CAGL0M01760g 203616..208115 highly similar to sp|P33302 Saccharomyces
            cerevisiae YOR153w PDR5 or sp|Q04182 Saccharomyces
            cerevisiae YDR406w PDR15 or sp|P51533 Saccharomyces
            cerevisiae YOR328w, hypothetical start
          Length = 1499

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 79/192 (41%), Gaps = 22/192 (11%)

Query: 101  RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSELQNYFTKML 160
            +PG +  L+G +G GK+T L  LA  ++  +G                G +  + F + +
Sbjct: 884  KPGTLTALMGASGAGKTTLLDCLA--ERVTMGVITGEVS-------VDGKQRDDSFARSI 934

Query: 161  EDDIKAIIKPQYVDNIPRAIKGPLQKVGELLK---ARMEKPEADVKMYIKILELQNVLKR 217
                    + Q +      ++  L+    L +     +E+    V+  IKILE++     
Sbjct: 935  -----GYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADA 989

Query: 218  DVSALSGG----ELQRFAIGMSCVQQANVYMF-DEPSSYLDVKQRLNAALIIRSLLDPTT 272
             V     G    + +R  IG+    +  + +F DEP+S LD +   +   +++ L +   
Sbjct: 990  VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHGQ 1049

Query: 273  YVICVEHDLSVL 284
             ++C  H  S +
Sbjct: 1050 AILCTIHQPSAI 1061

>AER091W [2596] [Homologous to ScYKL188C (PXA2) - SH]
           complement(809767..812172) [2406 bp, 801 aa]
          Length = 801

 Score = 30.4 bits (67), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 21/129 (16%)

Query: 101 RPGQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWSDIIKYFRGSEL-------- 152
           + G  L ++G NG GKS+  ++L G   P L  + +P + + +I   R +E         
Sbjct: 502 KHGNHLLIIGPNGCGKSSLFRVLGGLW-PVLQSFTNPKKPTKLIMPRRNAENGESPIYYL 560

Query: 153 -QNYFTKMLEDDIKAIIKPQYVDNIPRAIKGPLQKVGELLKARMEKPEADVKMYIKILEL 211
            Q  +   L    + II P  ++   +   G  Q        R +K  AD+   + +LEL
Sbjct: 561 PQRAYMSNLSTFREQIIYPDKINAFEKKYNGDYQ--------RGDKELADI---LSVLEL 609

Query: 212 QNVLKRDVS 220
            +++  +++
Sbjct: 610 DDLIAENMA 618

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 209  LELQNVLKRDVSALSGGELQRFAIGMSCVQQ------ANVYMFDEPSSYLDVKQRLNAAL 262
            ++L N+ K  +  LSGG  QR  I +S +        A +Y+ DE  + LD+    N   
Sbjct: 1071 VKLGNIWKESLIELSGG--QRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 263  IIRSLLDPTTYVIC 276
            +I++    + +++ 
Sbjct: 1129 LIKTRFKGSQFIVV 1142

>KLLA0D04059g complement(338422..343128) similar to sp|P14772
           Saccharomyces cerevisiae YLL015w BPT1, start by
           similarity
          Length = 1568

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVI 509
           LSGG+  R+++  A+   AD+YL+D+  + +DS    +C  +I
Sbjct: 759 LSGGQKARLSLARAVYSRADLYLLDDVLSAVDSH---VCKSII 798

>Kwal_34.15770
          Length = 1436

 Score = 29.6 bits (65), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 38/81 (46%)

Query: 467 LSGGELQRVAIVLALGLPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHD 526
           LSGG+ QRV++  AL   +   L+D+  + +DS   +   +      L   +T  +V H+
Sbjct: 616 LSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCILVSHN 675

Query: 527 FIMATYLADKVIVFEGTPSKN 547
             +    AD V+  E    K+
Sbjct: 676 VALTLKNADWVVFMENGKVKD 696

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 37/81 (45%), Gaps = 2/81 (2%)

Query: 207  KILELQNVLKRDVSALSGGELQRFAIGMSCVQQANVYMFDEPSSYLDVKQRLNAALIIRS 266
            K L L N +    + LS G+ Q   +  S ++   V + DE ++ +D          IR 
Sbjct: 1301 KFLRLDNEITEGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRG 1360

Query: 267  LLDPTTYVICVEHDL-SVLDY 286
                +T ++ + H L S++DY
Sbjct: 1361 EFSNST-ILTIAHRLRSIIDY 1380

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 19,368,545
Number of extensions: 853445
Number of successful extensions: 3064
Number of sequences better than 10.0: 158
Number of HSP's gapped: 3015
Number of HSP's successfully gapped: 358
Length of query: 596
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 489
Effective length of database: 12,891,983
Effective search space: 6304179687
Effective search space used: 6304179687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)