Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR124C30930313760.0
Kwal_33.14642383100780.073
Sklu_2302.637938672.0
AFR051W405105662.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR124C
         (303 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR124C [4435] [Homologous to NOHBY] (985646..986575) [930 bp, 3...   534   0.0  
Kwal_33.14642                                                          35   0.073
Sklu_2302.6 YHR129C, Contig c2302 5537-6676 reverse complement         30   2.0  
AFR051W [3243] [Homologous to ScYHR129C (ARP1) - SH] complement(...    30   2.3  

>AGR124C [4435] [Homologous to NOHBY] (985646..986575) [930 bp, 309
           aa]
          Length = 309

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/303 (91%), Positives = 276/303 (91%)

Query: 1   MQLGRSHDGGGLTRVVFGLPGCAWPHDGLLEELNLLPWCKGVCDSAPACKLCLRGRVDCC 60
           MQLGRSHDGGGLTRVVFGLPGCAWPHDGLLEELNLLPWCKGVCDSAPACKLCLRGRVDCC
Sbjct: 1   MQLGRSHDGGGLTRVVFGLPGCAWPHDGLLEELNLLPWCKGVCDSAPACKLCLRGRVDCC 60

Query: 61  VRGCNCGDSALQARDGWCGAQTCSVCXXXXXXXXXXXXXXHMIDSVSISAWWSASRWPGC 120
           VRGCNCGDSALQARDGWCGAQTCSVC              HMIDSVSISAWWSASRWPGC
Sbjct: 61  VRGCNCGDSALQARDGWCGAQTCSVCLRQLFRGLRRRRCRHMIDSVSISAWWSASRWPGC 120

Query: 121 TCACPGPAGSLAVPVGRACRAGAVLPLFIGRDPLSMHVRALVARERCCHSLPLFLCCTVP 180
           TCACPGPAGSLAVPVGRACRAGAVLPLFIGRDPLSMHVRALVARERCCHSLPLFLCCTVP
Sbjct: 121 TCACPGPAGSLAVPVGRACRAGAVLPLFIGRDPLSMHVRALVARERCCHSLPLFLCCTVP 180

Query: 181 SSCRERGAKVHRTARAVQLFLRSNPESHSMPLQLVRHALPHRSPQAASGDCPYPRFVSSW 240
           SSCRERGAKVHRTARAVQLFLRSNPESHSMPLQLVRHALPHRSPQAASGDCPYPRFVSSW
Sbjct: 181 SSCRERGAKVHRTARAVQLFLRSNPESHSMPLQLVRHALPHRSPQAASGDCPYPRFVSSW 240

Query: 241 KARRYRLPPCVFHSHGRPAFNPHRLCIAXXXXXXXXXXXXXVGSISVRLIIACQPQPVAS 300
           KARRYRLPPCVFHSHGRPAFNPHRLCIA             VGSISVRLIIACQPQPVAS
Sbjct: 241 KARRYRLPPCVFHSHGRPAFNPHRLCIACCCTPSPSCSPQCVGSISVRLIIACQPQPVAS 300

Query: 301 PSH 303
           PSH
Sbjct: 301 PSH 303

>Kwal_33.14642
          Length = 383

 Score = 34.7 bits (78), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 21/100 (21%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 167 CCHSLPLFLCCTVPSSCRERGAKVHRTARAVQLFLRSN------PESHSMPLQLVRHALP 220
           CC S+P++   ++PS+ R            +QL LR +        S    +++++    
Sbjct: 165 CCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKAC 224

Query: 221 HRSPQAASGDCPYPRFVSSWKARRYRLPPCVFHSHGRPAF 260
           + +P+ A+ +  Y     S +  +++LP     S G   F
Sbjct: 225 YVAPEVAAEEQKYASSRGSEELTKFKLPDGKILSLGAEKF 264

>Sklu_2302.6 YHR129C, Contig c2302 5537-6676 reverse complement
          Length = 379

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 167 CCHSLPLFLCCTVPSSCRERGAKVHRTARAVQLFLRSN 204
           CCHS+P+F   ++PSS R            +QL LR  
Sbjct: 164 CCHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKT 201

>AFR051W [3243] [Homologous to ScYHR129C (ARP1) - SH]
           complement(522829..524046) [1218 bp, 405 aa]
          Length = 405

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 38/105 (36%), Gaps = 18/105 (17%)

Query: 167 CCHSLPLFLCCTVPSSCRERGAKVHRTARAVQLFLRSNP------ESHSMPLQLVRHA-- 218
           CCH++P+F   +VPSS R            +QL LR          S    ++ ++    
Sbjct: 190 CCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKAC 249

Query: 219 LPHRSPQAASGDCPYPRFVSSWK----------ARRYRLPPCVFH 253
              + P+    + P     S +K            RYR P  +F 
Sbjct: 250 FVTKDPKLEEQNFPMNPSFSKFKLPDGKTIELGQERYRAPEILFQ 294

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.139    0.498 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,497,512
Number of extensions: 300228
Number of successful extensions: 515
Number of sequences better than 10.0: 5
Number of HSP's gapped: 517
Number of HSP's successfully gapped: 5
Length of query: 303
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 202
Effective length of database: 13,099,691
Effective search space: 2646137582
Effective search space used: 2646137582
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)