Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR122C58556627440.0
Sklu_1838.358958922980.0
Kwal_56.2348658758022270.0
YER165W (PAB1)57757620540.0
KLLA0C17600g59259420490.0
Scas_576.757557419880.0
CAGL0L11792g57957019780.0
YFR023W (PES4)6113913791e-38
Sklu_1706.16722963402e-33
Kwal_0.3705602933311e-32
YHR015W (MIP6)6593213233e-31
AEL016C6782953135e-30
CAGL0I08943g6023263011e-28
Scas_607.106052943002e-28
KLLA0A08338g7661912871e-26
Scas_697.106104372691e-24
KLLA0C11495g4451972385e-21
CAGL0E03245g4251942234e-19
YNL016W (PUB1)4532002154e-18
Scas_671.44431672146e-18
Scas_621.104151882082e-17
Sklu_1879.44211922048e-17
YCL011C (GBP2)4273082021e-16
CAGL0H10604g4161762012e-16
AGR390C3781771974e-16
AEL217W8342161999e-16
KLLA0E08745g4751781961e-15
Scas_635.75811791961e-15
YGR159C (NSR1)4141731941e-15
Scas_637.23773291885e-15
AFR107W3961811896e-15
Kwal_27.114474391941842e-14
Kwal_23.39858762001854e-14
Scas_598.15161801834e-14
CAGL0M03795g5132041835e-14
ADL160W5261481827e-14
Kwal_55.219605971791827e-14
CAGL0E01947g4521641791e-13
KLLA0C12925g5701981792e-13
Kwal_56.247098282521792e-13
CAGL0B04169g8611711792e-13
CAGL0B04807g4191851753e-13
AAL018W3371751724e-13
ADR307W5663171755e-13
Sklu_2307.26971871755e-13
YOL123W (HRP1)5341811746e-13
YPL043W (NOP4)6853131747e-13
YPR112C (MRD1)8871731731e-12
ADR035C8384241721e-12
AGL250W7291951721e-12
Scas_558.14352211682e-12
Sklu_2085.22091191578e-12
CAGL0L12672g6823231651e-11
Scas_645.147172041641e-11
ABL059W2041691551e-11
Kwal_55.201545223421631e-11
KLLA0D11792g6852001551e-10
Kwal_27.118326861901551e-10
KLLA0D14949g8781731542e-10
YNL004W (HRB1)4292961522e-10
CAGL0F08217g6784021523e-10
Scas_157.12321731464e-10
YOR319W (HSH49)2131771428e-10
CAGL0I09900g2111691411e-09
KLLA0E11011g4322881461e-09
KLLA0A05346g8743161462e-09
Scas_705.228691731462e-09
KLLA0F18216g7083131434e-09
CAGL0H02123g5553381407e-09
Sklu_2442.114641841381e-08
Kwal_27.123372091261321e-08
Scas_665.42191771321e-08
CAGL0H03861g4431921362e-08
KLLA0C14388g2031651302e-08
Kwal_0.2502162151303e-08
AAR151W4814271319e-08
YGR250C7814641311e-07
KLLA0C08019g301591272e-07
KLLA0D05016g2622611252e-07
Kwal_14.18515353251282e-07
KLLA0F14861g5891701282e-07
YHR086W (NAM8)5233501273e-07
Sklu_905.15152011263e-07
Sklu_1790.3473841246e-07
KLLA0F07799g524841246e-07
ABL134C3752041237e-07
CAGL0J11154g3802031237e-07
ADR183C3201661227e-07
KLLA0B00979g3421661211e-06
YIR005W (IST3)148951141e-06
Scas_717.413791681183e-06
Scas_376.14042111183e-06
YMR268C (PRP24)4442831183e-06
ADL063W320991156e-06
KLLA0C05522g5402221159e-06
Kwal_33.13496330721139e-06
Kwal_55.20972135831071e-05
YOL041C (NOP12)459781141e-05
Scas_88.1256641111e-05
CAGL0H04763g3831561131e-05
YDR432W (NPL3)4141681131e-05
Kwal_33.14463393851121e-05
CAGL0L03806g2551231092e-05
Scas_666.11224821082e-05
YBR212W (NGR1)672911113e-05
CAGL0K06655g802811104e-05
Kwal_26.71794561051094e-05
Kwal_23.5864278851074e-05
Sklu_2257.4188741054e-05
Sklu_2182.3371751084e-05
Sklu_1715.1396911085e-05
YNL110C (NOP15)220821056e-05
YNL175C (NOP13)4031671076e-05
CAGL0F01023g396581077e-05
Kwal_47.18572363801067e-05
YIR001C (SGN1)250971049e-05
Scas_643.164481011069e-05
CAGL0H02211g3812681051e-04
KLLA0E00484g2422111031e-04
AFR649W310791041e-04
Sklu_2353.5252571031e-04
Scas_316.14831671051e-04
Scas_701.3321741041e-04
Scas_621.163141231022e-04
CAGL0D05236g4431091032e-04
Scas_565.83221521022e-04
ADR017W17372982e-04
CAGL0J01914g16983973e-04
AFL224W206113993e-04
ACR274W426581023e-04
Kwal_55.221474681201004e-04
KLLA0D08206g3911681005e-04
CAGL0M12573g29953986e-04
Scas_709.2*17161956e-04
YDR429C (TIF35)27460977e-04
CAGL0D06182g28061977e-04
AGL038C712307997e-04
KLLA0F09383g25866978e-04
Scas_714.5923360968e-04
KLLA0D13420g16691930.001
Kwal_26.845821968950.001
Kwal_26.752226262950.001
Sklu_2213.425761950.001
AER285C426186950.002
Scas_582.1028382940.002
YGL044C (RNA15)29661920.003
Kwal_26.9319273116910.004
Scas_530.4684341930.004
AFL050W21867900.004
Sklu_2407.322191900.004
Kwal_55.2041428489910.004
AGR010C26662900.006
ADL126C466160910.007
Sklu_2375.520767870.009
KLLA0B10472g19865860.010
CAGL0J02200g14498840.011
KLLA0F23650g31268870.013
Sklu_2060.311079820.014
KLLA0D13772g34566870.015
Sklu_2221.828158860.015
ADR001C324102870.015
YHL024W (RIM4)713145880.016
Scas_720.224574850.018
YIL061C (SNP1)30061850.021
KLLA0B11594g11484800.021
Kwal_30.1289028056850.022
Scas_570.1411379790.034
Kwal_55.2103911980790.035
KLLA0E01936g484118840.037
Kwal_27.1109620165820.037
KLLA0B00847g26948820.054
YFR032C289142820.061
YPL190C (NAB3)80260830.063
CAGL0C01529g23674810.067
CAGL0I05082g60437820.073
ADR189W26960800.081
KLLA0B14432g17377780.093
YBL051C (PIN4)66833810.095
CAGL0H04675g27461800.096
YPL178W (CBC2)20874790.10
AFL061C523127800.11
Scas_710.31*16254760.16
YNL286W (CUS2)28588780.16
AFL070C75765790.19
AER349C21865760.21
Sklu_1192.1280137770.22
Scas_611.5*78759770.29
Kwal_55.2090314791730.29
CAGL0H03267g77560770.31
CAGL0G05511g67463770.31
CAGL0A04213g63972760.43
KLLA0D16049g42582750.46
AAR022W11480700.46
CAGL0H07975g27571740.48
Sklu_2391.176191750.49
Sklu_1984.328455730.59
Sklu_2249.430979730.74
KLLA0E19327g73960740.79
CAGL0E03630g74679740.80
Kwal_23.365029945720.97
Kwal_55.2071859487721.0
KLLA0E19943g59274721.0
Kwal_47.1721415551691.3
Kwal_56.2394580691711.8
KLLA0B08976g30577692.1
KLLA0F20834g61661702.2
ACR235W57874702.3
YOR361C (PRT1)763109692.6
Kwal_33.1481057474693.0
YOL144W (NOP8)48483683.2
KLLA0E19118g65247683.4
YIR009W (MSL1)11179643.4
YER156C33883674.4
Scas_500.662174675.3
Kwal_33.1352257293666.0
CAGL0K09966g71949666.1
Sklu_2434.1473648666.2
CAGL0J05852g34354656.4
ADR399C73649666.4
Scas_683.3227236656.5
CAGL0B01397g51487657.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR122C
         (574 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...  1061   0.0  
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement        889   0.0  
Kwal_56.23486                                                         862   0.0  
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...   795   0.0  
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...   793   0.0  
Scas_576.7                                                            770   0.0  
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...   766   0.0  
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...   150   1e-38
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                           135   2e-33
Kwal_0.370                                                            132   1e-32
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...   129   3e-31
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...   125   5e-30
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...   120   1e-28
Scas_607.10                                                           120   2e-28
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...   115   1e-26
Scas_697.10                                                           108   1e-24
KLLA0C11495g complement(990832..992169) some similarities with s...    96   5e-21
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    91   4e-19
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    87   4e-18
Scas_671.4                                                             87   6e-18
Scas_621.10                                                            85   2e-17
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         83   8e-17
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    82   1e-16
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    82   2e-16
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    80   4e-16
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    81   9e-16
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    80   1e-15
Scas_635.7                                                             80   1e-15
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    79   1e-15
Scas_637.2                                                             77   5e-15
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    77   6e-15
Kwal_27.11447                                                          75   2e-14
Kwal_23.3985                                                           76   4e-14
Scas_598.1                                                             75   4e-14
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    75   5e-14
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    75   7e-14
Kwal_55.21960                                                          75   7e-14
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    74   1e-13
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    74   2e-13
Kwal_56.24709                                                          74   2e-13
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...    74   2e-13
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    72   3e-13
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    71   4e-13
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    72   5e-13
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         72   5e-13
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    72   6e-13
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    72   7e-13
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...    71   1e-12
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...    71   1e-12
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    71   1e-12
Scas_558.1                                                             69   2e-12
Sklu_2085.2 YOR319W, Contig c2085 3158-3787                            65   8e-12
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    68   1e-11
Scas_645.14                                                            68   1e-11
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    64   1e-11
Kwal_55.20154                                                          67   1e-11
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    64   1e-10
Kwal_27.11832                                                          64   1e-10
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...    64   2e-10
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    63   2e-10
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    63   3e-10
Scas_157.1                                                             61   4e-10
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    59   8e-10
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    59   1e-09
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    61   1e-09
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    61   2e-09
Scas_705.22                                                            61   2e-09
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    60   4e-09
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    59   7e-09
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      58   1e-08
Kwal_27.12337                                                          55   1e-08
Scas_665.4                                                             55   1e-08
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    57   2e-08
KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181 S...    55   2e-08
Kwal_0.250                                                             55   3e-08
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    55   9e-08
YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein...    55   1e-07
KLLA0C08019g complement(704199..705104) some similarities with s...    54   2e-07
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    53   2e-07
Kwal_14.1851                                                           54   2e-07
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    54   2e-07
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    54   3e-07
Sklu_905.1 YMR268C, Contig c905 196-1743                               53   3e-07
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            52   6e-07
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    52   6e-07
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    52   7e-07
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    52   7e-07
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    52   7e-07
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    51   1e-06
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    49   1e-06
Scas_717.41                                                            50   3e-06
Scas_376.1                                                             50   3e-06
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    50   3e-06
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    49   6e-06
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    49   9e-06
Kwal_33.13496                                                          48   9e-06
Kwal_55.20972                                                          46   1e-05
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    49   1e-05
Scas_88.1                                                              47   1e-05
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    48   1e-05
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    48   1e-05
Kwal_33.14463                                                          48   1e-05
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    47   2e-05
Scas_666.11                                                            46   2e-05
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    47   3e-05
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    47   4e-05
Kwal_26.7179                                                           47   4e-05
Kwal_23.5864                                                           46   4e-05
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         45   4e-05
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            46   4e-05
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          46   5e-05
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    45   6e-05
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    46   6e-05
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    46   7e-05
Kwal_47.18572                                                          45   7e-05
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    45   9e-05
Scas_643.16                                                            45   9e-05
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    45   1e-04
KLLA0E00484g complement(45755..46483) similar to sp|P10080 Sacch...    44   1e-04
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    45   1e-04
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          44   1e-04
Scas_316.1                                                             45   1e-04
Scas_701.3                                                             45   1e-04
Scas_621.16                                                            44   2e-04
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    44   2e-04
Scas_565.8                                                             44   2e-04
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    42   2e-04
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    42   3e-04
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    43   3e-04
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    44   3e-04
Kwal_55.22147                                                          43   4e-04
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    43   5e-04
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    42   6e-04
Scas_709.2*                                                            41   6e-04
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    42   7e-04
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    42   7e-04
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    43   7e-04
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    42   8e-04
Scas_714.59                                                            42   8e-04
KLLA0D13420g complement(1157491..1157991) some similarities with...    40   0.001
Kwal_26.8458                                                           41   0.001
Kwal_26.7522                                                           41   0.001
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         41   0.001
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    41   0.002
Scas_582.10                                                            41   0.002
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    40   0.003
Kwal_26.9319                                                           40   0.004
Scas_530.4                                                             40   0.004
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    39   0.004
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         39   0.004
Kwal_55.20414                                                          40   0.004
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    39   0.006
ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391) [...    40   0.007
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       38   0.009
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    38   0.010
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    37   0.011
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    38   0.013
Sklu_2060.3 YIR009W, Contig c2060 4599-4931                            36   0.014
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    38   0.015
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       38   0.015
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    38   0.015
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    39   0.016
Scas_720.2                                                             37   0.018
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    37   0.021
KLLA0B11594g complement(1018044..1018388) some similarities with...    35   0.021
Kwal_30.12890                                                          37   0.022
Scas_570.14                                                            35   0.034
Kwal_55.21039                                                          35   0.035
KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces c...    37   0.037
Kwal_27.11096                                                          36   0.037
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    36   0.054
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    36   0.061
YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear p...    37   0.063
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    36   0.067
CAGL0I05082g complement(473462..475276) some similarities with s...    36   0.073
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    35   0.081
KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036 Saccha...    35   0.093
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    36   0.095
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    35   0.096
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    35   0.10 
AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018) [...    35   0.11 
Scas_710.31*                                                           34   0.16 
YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRN...    35   0.16 
AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH] (303268..30...    35   0.19 
AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,...    34   0.21 
Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement          34   0.22 
Scas_611.5*                                                            34   0.29 
Kwal_55.20903                                                          33   0.29 
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    34   0.31 
CAGL0G05511g complement(522026..524050) similar to sp|P34761 Sac...    34   0.31 
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    34   0.43 
KLLA0D16049g complement(1352380..1353657) some similarities with...    33   0.46 
AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH] complement(3...    32   0.46 
CAGL0H07975g 778377..779204 similar to sp|P33399 Saccharomyces c...    33   0.48 
Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement          33   0.49 
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         33   0.59 
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         33   0.74 
KLLA0E19327g 1713099..1715318 some similarities with sp|P38741 S...    33   0.79 
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    33   0.80 
Kwal_23.3650                                                           32   0.97 
Kwal_55.20718                                                          32   1.0  
KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217 Saccha...    32   1.0  
Kwal_47.17214                                                          31   1.3  
Kwal_56.23945                                                          32   1.8  
KLLA0B08976g complement(786122..787039) weakly similar to sp|P32...    31   2.1  
KLLA0F20834g complement(1942016..1943866) weakly similar to sp|P...    32   2.2  
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    32   2.3  
YOR361C (PRT1) [5138] chr15 complement(1015357..1017648) Transla...    31   2.6  
Kwal_33.14810                                                          31   3.0  
YOL144W (NOP8) [4680] chr15 (53096..54550) Nucleolar protein req...    31   3.2  
KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925 S...    31   3.4  
YIR009W (MSL1) [2674] chr9 (374522..374857) U2 snRNA-associated ...    29   3.4  
YER156C (YER156C) [1585] chr5 complement(483320..484336) Member ...    30   4.4  
Scas_500.6                                                             30   5.3  
Kwal_33.13522                                                          30   6.0  
CAGL0K09966g complement(974102..976261) highly similar to sp|P06...    30   6.1  
Sklu_2434.14 YOR361C, Contig c2434 32150-34360                         30   6.2  
CAGL0J05852g complement(554403..555434) weakly similar to sp|P40...    30   6.4  
ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH] (1420640..1...    30   6.4  
Scas_683.32                                                            30   6.5  
CAGL0B01397g 127374..128918 similar to sp|Q08287 Saccharomyces c...    30   7.7  

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/566 (92%), Positives = 523/566 (92%)

Query: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60
           MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP
Sbjct: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60

Query: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120
           IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120

Query: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180
           RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR
Sbjct: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
           DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG
Sbjct: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
           KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER
Sbjct: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300

Query: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360
           LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN
Sbjct: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360

Query: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420
           SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ
Sbjct: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420

Query: 421 HXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQMAGMPKNGAMPPQQFGRPGPM 480
           H          GLPGQF            RVPFQGPNPQMAGMPKNGAMPPQQFGRPGPM
Sbjct: 421 HANAAAAAAVAGLPGQFMPPPMYYGGIPPRVPFQGPNPQMAGMPKNGAMPPQQFGRPGPM 480

Query: 481 YGGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDEAAGKITGMILDLPPQQ 540
           YGGFA                     ALGEQLYQKVFAKTQDDEAAGKITGMILDLPPQQ
Sbjct: 481 YGGFAPQGQFPRNGQQQQFYQQKQRQALGEQLYQKVFAKTQDDEAAGKITGMILDLPPQQ 540

Query: 541 VIQLLENDELLEQHFQEAHAAYQKFK 566
           VIQLLENDELLEQHFQEAHAAYQKFK
Sbjct: 541 VIQLLENDELLEQHFQEAHAAYQKFK 566

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score =  889 bits (2298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/589 (74%), Positives = 492/589 (83%), Gaps = 23/589 (3%)

Query: 1   MSDITDKTAEQLEQLKI--EEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIF 58
           MSD+TDKTAEQLEQLKI  ++QTAPT+TESE  KV+TS ASLYVGEL+PTV+EALLYD+F
Sbjct: 1   MSDVTDKTAEQLEQLKINDDQQTAPTSTESENAKVDTSSASLYVGELDPTVTEALLYDLF 60

Query: 59  SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP 118
           SPIGSVSSIRVCRDAIT TSLGYAYVNFHDH+AG  AI++LNYT IKG+PCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRTAIQKLNYTTIKGRPCRIMWSQRDP 120

Query: 119 SLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESD 178
           SLRKKGSGNI+IKNLHPAIDNK+LH+TFS FGNILSCK+ATDE G S+GFGFVHFE E  
Sbjct: 121 SLRKKGSGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATDEAGNSKGFGFVHFEEEYS 180

Query: 179 ARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
           A++A++A++GML+N QEVYVA HVSKKDRQSKLEE K+ FTN+YVKNID ET+QEEFE L
Sbjct: 181 AKEAVDAINGMLLNGQEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY 298
           F ++GKITSAVLE+DSEGK RGFGF+NFEDH +AAKAVDELN+ +FK Q+LYVGRAQKKY
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQKKY 300

Query: 299 ERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDET 358
           ERLQEL+KQYE +RLEKLAKYQGVNLFVKNLDDSIDDEKL++EFAPFG ITSAKVMRD+ 
Sbjct: 301 ERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDDA 360

Query: 359 GNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMR 418
           GNS+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMR
Sbjct: 361 GNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMR 420

Query: 419 FQHXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQ----MAGMPKNGAMPPQQF 474
           +Q           G+PGQF             VPF GPNPQ    M GMPKNG +PPQQF
Sbjct: 421 YQQVTAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMAAMGGMPKNGVIPPQQF 480

Query: 475 GRP-GPMYG---------GFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDE 524
           GRP GPMYG         GF                      ALGEQLY+KV AKTQD+E
Sbjct: 481 GRPNGPMYGVPPQGAPQGGFPRNGGNQFYHQKQRQ-------ALGEQLYKKVSAKTQDEE 533

Query: 525 AAGKITGMILDLPPQQVIQLLENDELLEQHFQEAHAAYQKFKEDQEAQA 573
           AAGKITGMILDLPPQ+V+ LLEND+L EQHF+EA AAY+ FK+DQEAQ+
Sbjct: 534 AAGKITGMILDLPPQEVVPLLENDDLFEQHFKEAFAAYESFKKDQEAQS 582

>Kwal_56.23486
          Length = 587

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/580 (74%), Positives = 484/580 (83%), Gaps = 9/580 (1%)

Query: 1   MSDITDKTAEQLEQLKI--EEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIF 58
           MSD+TDKTAEQLEQL+I  E+ T PT+T+SE+ K E S ASLYVGEL+P+V+EALLYD+F
Sbjct: 1   MSDVTDKTAEQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDLF 60

Query: 59  SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP 118
           SPIGSVSSIRVCRDAIT TSLGYAYVNFHDH AG  AIE+LNYT IKG+PCRIMWSQRDP
Sbjct: 61  SPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIMWSQRDP 120

Query: 119 SLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESD 178
           SLRKKGSGN++IKNLHPAIDNK+LH+TFS FGNILSCK+ATDE G SR FGFVHFE E  
Sbjct: 121 SLRKKGSGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATDETGKSRKFGFVHFEEEEA 180

Query: 179 ARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
           A++AI+A++GML+N  EVYVA HVSKKDRQSKL+EVK+ FTNVYVKNID ET Q+EFE+L
Sbjct: 181 AKEAIDAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKL 240

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY 298
           F +YG ITSAVLE D+EGKLRGFGFVNFEDH AAAKAV+ELN+ +F GQKLYVGRAQKKY
Sbjct: 241 FSQYGAITSAVLETDNEGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQKKY 300

Query: 299 ERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDET 358
           ERLQELKKQYE++R+EKLAKYQGVNLFVKNLDDSIDDEKL+EEFAPFGTITS KVMRD+ 
Sbjct: 301 ERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDDA 360

Query: 359 GNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMR 418
           G+S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR+QLAQQIQARNQMR
Sbjct: 361 GSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRSQLAQQIQARNQMR 420

Query: 419 FQHXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQ----MAGMPKNGAMPPQQF 474
           +Q           G+PGQF             VPF GPNPQ    M GMPKNG +PPQQF
Sbjct: 421 YQQ-ATAAAAAAAGMPGQFMQPMFYGVMPPRGVPFNGPNPQQMAAMNGMPKNG-VPPQQF 478

Query: 475 GRP-GPMYGGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDEAAGKITGMI 533
           GRP GPMYG                        ALGEQLY++V AKTQD+EAAGKITGMI
Sbjct: 479 GRPNGPMYGVPPQGPQGAFPRNGNQFFHQKQRQALGEQLYKRVSAKTQDEEAAGKITGMI 538

Query: 534 LDLPPQQVIQLLENDELLEQHFQEAHAAYQKFKEDQEAQA 573
           LDLPPQ+V+ LLENDEL +QHF+EA AAY  FK+DQ+AQA
Sbjct: 539 LDLPPQEVVPLLENDELFDQHFKEAFAAYDSFKKDQDAQA 578

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/576 (68%), Positives = 458/576 (79%), Gaps = 7/576 (1%)

Query: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60
           M+DITDKTAEQLE L I++      T SE+  VE S ASLYVG+LEP+VSEA LYDIFSP
Sbjct: 1   MADITDKTAEQLENLNIQDDQKQAATGSESQSVENSSASLYVGDLEPSVSEAHLYDIFSP 60

Query: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120
           IGSVSSIRVCRDAIT TSLGYAYVNF+DHEAG KAIEQLNYT IKG+ CRIMWSQRDPSL
Sbjct: 61  IGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGRLCRIMWSQRDPSL 120

Query: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180
           RKKGSGNI+IKNLHP IDNK+L++TFS FG+ILS K+ATDENG S+GFGFVHFE E  A+
Sbjct: 121 RKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAK 180

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
           +AI+A++GML+N QE+YVA H+S+K+R S+LEE KA +TN+YVKNI+ ET+ E+F+ELF 
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETTDEQFQELFA 240

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
           K+G I SA LEKD++GKL+GFGFVN+E H  A KAV+ LN+ E  G+KLYVGRAQKK ER
Sbjct: 241 KFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNER 300

Query: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360
           +  LKKQYEA RLEK+AKYQGVNLFVKNLDDS+DDEKL+EEFAP+GTITSAKVMR E G 
Sbjct: 301 MHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK 360

Query: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420
           S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMR+Q
Sbjct: 361 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRYQ 420

Query: 421 HXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQ----MAGMPKNGAMPPQQFGR 476
                      G+PGQF             VPF GPNPQ    M GMPKNG MPPQ   R
Sbjct: 421 QATAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQQMNPMGGMPKNG-MPPQ--FR 477

Query: 477 PGPMYGGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDEAAGKITGMILDL 536
            GP+YG                        ALGEQLY+KV AKT ++EAAGKITGMILDL
Sbjct: 478 NGPVYGVPPQGGFPRNANDNNQFYQQKQRQALGEQLYKKVSAKTSNEEAAGKITGMILDL 537

Query: 537 PPQQVIQLLENDELLEQHFQEAHAAYQKFKEDQEAQ 572
           PPQ+V  LLE+DEL EQH++EA AAY+ FK++QE Q
Sbjct: 538 PPQEVFPLLESDELFEQHYKEASAAYESFKKEQEQQ 573

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/594 (68%), Positives = 463/594 (77%), Gaps = 23/594 (3%)

Query: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETP------------KVETSGASLYVGELEPT 48
           MSDIT+KTAEQLE L+I +   P  + S               KVE + ASLYVGEL+P 
Sbjct: 1   MSDITEKTAEQLENLQINDDQQPAQSASAPSTSASESEASSVSKVENNNASLYVGELDPN 60

Query: 49  VSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKP 108
           ++EALLYD+FSP+G +SSIRVCRDA+T  SLGYAYVN+ D+EAG KAI++LNY  I G+P
Sbjct: 61  ITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQELNYAEINGRP 120

Query: 109 CRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGF 168
           CRIMWS+RDP++RKKGSGNI+IKNLHPAIDNK+LHETFSTFG +LSCKVA DENG SRGF
Sbjct: 121 CRIMWSERDPAIRKKGSGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALDENGNSRGF 180

Query: 169 GFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQ 228
           GFVHF+ ESDA+DAIEAV+GMLMN  EVYVA+HV KKDR SKLEE KA FTN+YVKNID 
Sbjct: 181 GFVHFKEESDAKDAIEAVNGMLMNGLEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDV 240

Query: 229 ETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQK 288
           ET+ EEFE+LF +YG+I SA LEKD+EGK +GFGFVNF DH AAAKAV+ELN  EFK Q 
Sbjct: 241 ETTDEEFEQLFSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNGKEFKSQA 300

Query: 289 LYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTI 348
           LYVGRAQKKYER +ELKKQYE  RLEKLAK+QGVNLF+KNLDDSIDDEKLKEEFAP+GTI
Sbjct: 301 LYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTI 360

Query: 349 TSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLA 408
           TSA+VMRD+ GNS+GFGFVCFS+PEEATKA+TEKNQQIVAGKPLYVAIAQRK+VRR+QLA
Sbjct: 361 TSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRRSQLA 420

Query: 409 QQIQARNQMRF-QHXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQM-----AG 462
           QQIQARNQ+RF Q           G+PGQ+              P  GPNP M     AG
Sbjct: 421 QQIQARNQIRFQQQQQQQAAAAAAGMPGQYMPQMFYGVMAPRGFP--GPNPGMNGPMGAG 478

Query: 463 MPKNGAM-PPQQF-GRP-GPMYGGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAK 519
           +PKNG + PPQQF GRP GPMY G                       ALGEQLY+KV AK
Sbjct: 479 IPKNGMVPPPQQFAGRPNGPMYQGMPPQNQFPRHQQQHYIQQQKQRQALGEQLYKKVSAK 538

Query: 520 TQDDEAAGKITGMILDLPPQQVIQLLENDELLEQHFQEAHAAYQKFKEDQEAQA 573
             D+ AAGKITGMILDLPPQQVIQLL+NDE  EQ FQEA AAY+ FK++QEAQA
Sbjct: 539 IDDENAAGKITGMILDLPPQQVIQLLDNDEQFEQQFQEALAAYENFKKEQEAQA 592

>Scas_576.7
          Length = 575

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/574 (68%), Positives = 451/574 (78%), Gaps = 26/574 (4%)

Query: 1   MSDITDKTAEQLEQLKI---EEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDI 57
           MSDIT+KT EQLE LKI   E+Q + TT+   +P      ASLYVGEL+PTVSEALLYDI
Sbjct: 1   MSDITEKTVEQLENLKISESEDQPSTTTSTETSP------ASLYVGELDPTVSEALLYDI 54

Query: 58  FSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRD 117
           FSPIGSVSSIRVCRDA+T TSLGYAYVNF+DHEAG KAIEQLNYT IKG+ CRIMWSQRD
Sbjct: 55  FSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQLNYTPIKGRLCRIMWSQRD 114

Query: 118 PSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENES 177
           P+LRKKGSGNI+IKNLHP IDNK+L ETFS FGNILS K+ATDE G S+GFGFVHFE+ES
Sbjct: 115 PALRKKGSGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHES 174

Query: 178 DARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEE 237
            A++AI+A++GML+N QE+YVA H+++K+R S+LEE KA FTNVYVKNI+ ET+ EEF E
Sbjct: 175 SAKEAIDALNGMLLNGQEIYVAPHLTRKERDSQLEETKAHFTNVYVKNINLETTDEEFNE 234

Query: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
           LF KYG + S+ LEK  +GKL+GFGFV+FE H  AAKAV+ELN  EFK Q L+V RAQKK
Sbjct: 235 LFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKK 294

Query: 298 YERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE 357
           YER+QELKKQYEA+RLEK+AKYQGVNLFVKNLDDSIDDEKLKEEFAP+GTITS +VMR +
Sbjct: 295 YERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRVMRTD 354

Query: 358 TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQM 417
            G S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQAR QM
Sbjct: 355 NGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARTQM 414

Query: 418 RFQHXXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQMAGMPKNGAMPPQQFGRP 477
           R+Q           G+PGQF             VPF GPNPQ      NG +PPQQF R 
Sbjct: 415 RYQQATAAAAAAAAGIPGQFMPPMFYGVMPPRGVPFNGPNPQQM----NG-VPPQQF-RN 468

Query: 478 GPMY-----GGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDEAAGKITGM 532
           GP Y     GGF                      ALGE+LY+KV AK  D+EAAGKITGM
Sbjct: 469 GPGYGMPPQGGFP------RNGVPNQFYQKNQRQALGEELYKKVSAKNADEEAAGKITGM 522

Query: 533 ILDLPPQQVIQLLENDELLEQHFQEAHAAYQKFK 566
           ILDLPPQ+V+ LLENDEL EQHF+EA AAY+ FK
Sbjct: 523 ILDLPPQEVVSLLENDELFEQHFKEASAAYESFK 556

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/570 (66%), Positives = 449/570 (78%), Gaps = 9/570 (1%)

Query: 1   MSDITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSP 60
           M+DIT+KTAEQLE L ++++   T  E+++   ET  ASLYVG+L+P+VSEA LYDIFSP
Sbjct: 1   MADITEKTAEQLENLSLQDKQEGTNEENQS---ETVSASLYVGDLDPSVSEAHLYDIFSP 57

Query: 61  IGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120
           IG+VSSIRVCRDAIT TSLGYAYVNF+DH+A   AIE+LN+T IKGK CRIMWSQRDPSL
Sbjct: 58  IGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSL 117

Query: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180
           RKKG+GNI+IKNLHP IDNK+L++TFS FGNILS KVATDE G S+GFG+VHFE +  A 
Sbjct: 118 RKKGAGNIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESAS 177

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
           +AI+A++GML+N QE+YV  H+SKK+R+SK EE+KA FTNVY+KNI+ ET+ +EFEEL  
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERESKFEEMKANFTNVYIKNINTETTDKEFEELVA 237

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
           K+GK  S VLE+  EG+ +GFGFVNF +H  A K V+ELN  EFKGQ LYV RAQKKYER
Sbjct: 238 KFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQKKYER 297

Query: 301 LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN 360
            QELKKQYEA R+EK+AKYQG+NLF+KNLDDSIDD+KL+EEFAP+GTITSAKVM  E G 
Sbjct: 298 QQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK 357

Query: 361 SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQMRFQ 420
           S+GFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK+VRR+QLAQQIQARNQMRFQ
Sbjct: 358 SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKDVRRSQLAQQIQARNQMRFQ 417

Query: 421 H-XXXXXXXXXXGLPGQFXXXXXXXXXXXXRVPFQGPNPQMA---GMPKNGAMPPQQFGR 476
                       G+PGQF             VPF GPNPQMA    MPKNG MPP QF R
Sbjct: 418 QASAAAAAAAAAGMPGQFMPPMFYGVMPPRGVPFNGPNPQMANMGAMPKNG-MPPHQF-R 475

Query: 477 PGPMYGGFAXXXXXXXXXXXXXXXXXXXXXALGEQLYQKVFAKTQDDEAAGKITGMILDL 536
            GP+YG                        ALGE+LY+++F++T D+EAAGKITGMILDL
Sbjct: 476 NGPVYGVPPQGGFARNGPAANQFYQQKQRQALGEELYKRIFSRTNDEEAAGKITGMILDL 535

Query: 537 PPQQVIQLLENDELLEQHFQEAHAAYQKFK 566
           PPQ+V+ LLENDEL EQHF+EA AAY+ FK
Sbjct: 536 PPQEVVPLLENDELFEQHFKEASAAYESFK 565

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/391 (29%), Positives = 192/391 (49%), Gaps = 63/391 (16%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L++G+L  TV+E  L  IF    S  S +VC D++T  SLG+ Y+NF D E   KA+E+L
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 100 NYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL---HPAIDNKSLHETFSTFGNILSCK 156
           NYT + GK  RIM S R+ + RK    N++  NL   +P +  +  ++TFS +G ILSCK
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTRVFYDTFSRYGKILSCK 212

Query: 157 VATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR--------Q 208
           + +      +  GFV+FE+E  AR+ I+  +      +++   +H  K+ R        +
Sbjct: 213 LDS-----RKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQK 267

Query: 209 SKLE---------------------EVKAKFT----NVYVKNIDQETSQEEFEELFGKYG 243
           S+L+                     E K  ++    ++++KN+   T++++    F + G
Sbjct: 268 SRLDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVG 327

Query: 244 KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQE 303
            I S  L   ++ K   + FV +++ + + KA+   N   F+G+KL V RAQ K ER + 
Sbjct: 328 PIKSIYLSNATKVKYL-WAFVTYKNSSDSEKAIKRYNNFYFRGKKLLVTRAQDKEERAKF 386

Query: 304 LKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK-----EEFAPFGTITSAKVMRDET 358
           ++ Q       K++      LF++NL    + E LK     E   PF          DE 
Sbjct: 387 IESQ-------KIS-----TLFLENLSAVCNKEFLKYLCHQENIRPFKIQIDG---YDEN 431

Query: 359 GNSRGFGFVCFSTPEEATKAITEKNQQIVAG 389
            ++   GF+ F   E+AT+     N ++V G
Sbjct: 432 SSTYS-GFIKFRNFEDATRIFNFLNNRLVGG 461

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 81/191 (42%), Gaps = 25/191 (13%)

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKA 275
           K   +++ ++ +  ++E  + +F KY    SA +  DS   K  G G++NFED   A KA
Sbjct: 89  KLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKA 148

Query: 276 VDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNL---DDS 332
           ++ELN  +  G+++ +                  + R     K  G N+F  NL   +  
Sbjct: 149 MEELNYTKVNGKEIRI----------------MPSLRNTTFRKNFGTNVFFSNLPLNNPL 192

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           +      + F+ +G I S K+      + +  GFV F   + A   I   N     GK +
Sbjct: 193 LTTRVFYDTFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKI 247

Query: 393 YVAIAQRKEVR 403
              I   KEVR
Sbjct: 248 LCGIHFDKEVR 258

 Score = 36.6 bits (83), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 1/115 (0%)

Query: 298 YERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE 357
           + R+   K  ++  +L+     + V LF+ +L +++ +E LK  F  + +  SAKV  D 
Sbjct: 67  FLRINNNKSGHKNGKLKSFESKKLVPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDS 126

Query: 358 -TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQI 411
            T  S G G++ F   EEA KA+ E N   V GK + +  + R    R      +
Sbjct: 127 VTKKSLGHGYLNFEDKEEAEKAMEELNYTKVNGKEIRIMPSLRNTTFRKNFGTNV 181

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/296 (28%), Positives = 153/296 (51%), Gaps = 40/296 (13%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            +L++G+L+  V+E +L D F+   S+ S+++C DAI+  SLGY Y+NF + E   KA E
Sbjct: 102 VALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATE 161

Query: 98  QLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL---HPAIDNKSLHETFSTFGNILS 154
           + NY  + GK  RIM S R+   RK    N++  NL   + ++  ++ ++TF  +G ILS
Sbjct: 162 EFNYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPLENLSLTTRAFYDTFKKYGKILS 221

Query: 155 CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQS----- 209
           CK+   +N      GF++F+ ++ A+ AI+  +G       +   +H  ++ R+S     
Sbjct: 222 CKLDRRKN-----IGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSPEFEK 276

Query: 210 ---------------------KLEEV----KAKFTN-VYVKNIDQETSQEEFEELFGKYG 243
                                +L+EV    KA   N ++VKN+    ++++  + F + G
Sbjct: 277 RKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFFSRIG 336

Query: 244 KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYE 299
            + S    K  +     + FV ++  +  ++A+++LN   FK +K+ V RAQK ++
Sbjct: 337 PVKSVFTSKVPKYN-SSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKNFQ 391

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 138/297 (46%), Gaps = 37/297 (12%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAV 186
           ++I +L   +  K L +TF+ + +++S K+  D  +  S G+G+++F N+ DA  A E  
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 187 DGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQET---SQEEFEELFGKYG 243
           + + +  +EV +   +     +  +       TNV+  N+  E    +   F + F KYG
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIG------TNVFFSNLPLENLSLTTRAFYDTFKKYG 217

Query: 244 KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG----RAQKKYE 299
           KI S  L++      +  GF+ F+   +A  A+D+ N  E+ G  +  G    R  +K  
Sbjct: 218 KILSCKLDRR-----KNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKSP 272

Query: 300 RLQELKKQYEAARL--EKLA-----KYQGVN----------LFVKNLDDSIDDEKLKEEF 342
             ++ K + +   +  EKL      + Q V           +FVKNL  + +++ + + F
Sbjct: 273 EFEKRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDFF 332

Query: 343 APFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
           +  G + S    +    NS  + FV +    + ++AI + N +I   + + VA AQ+
Sbjct: 333 SRIGPVKSVFTSKVPKYNS-SWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQK 388

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 84/193 (43%), Gaps = 25/193 (12%)

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR-GFGFVNFEDHAAAAKA 275
           +   +++ ++D+  +++   + F KY  + S  +  D+  K   G+G++NF +   A KA
Sbjct: 100 RLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKA 159

Query: 276 VDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNL---DDS 332
            +E N +   G+++ +         +  L+  +    +       G N+F  NL   + S
Sbjct: 160 TEEFNYVPLFGKEVRI---------MPSLRNSFYRKNI-------GTNVFFSNLPLENLS 203

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           +      + F  +G I S K+ R      +  GF+ F     A  AI + N +   G  +
Sbjct: 204 LTTRAFYDTFKKYGKILSCKLDR-----RKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNI 258

Query: 393 YVAIAQRKEVRRN 405
              I   +EVR++
Sbjct: 259 MCGIHFDREVRKS 271

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 51/97 (52%), Gaps = 1/97 (1%)

Query: 316 LAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEE 374
           L+  + V LF+ +LD+ + ++ L++ F  + ++ S K+  D  +  S G+G++ FS  E+
Sbjct: 96  LSSKRLVALFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDED 155

Query: 375 ATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQI 411
           A KA  E N   + GK + +  + R    R  +   +
Sbjct: 156 AEKATEEFNYVPLFGKEVRIMPSLRNSFYRKNIGTNV 192

>Kwal_0.370
          Length = 560

 Score =  132 bits (331), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 140/293 (47%), Gaps = 40/293 (13%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           +SL++G+L+P V+E +L D F    S+ S+++C D+ T  SLGY Y+NF+  +    AIE
Sbjct: 15  SSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETAIE 74

Query: 98  QLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL---HPAIDNKSLHETFSTFGNILS 154
             +Y  + G+  RIM S R+   RK    N++  NL    PA+  +  +ETF  +G +LS
Sbjct: 75  TFSYVNLFGREVRIMPSMRNSYFRKNIGTNVFFSNLPLEQPALTTRVFYETFREYGKVLS 134

Query: 155 CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQS-KLEE 213
           CK+   +N      GFV+FE+++ AR AI + +        V   LH  K  R+S + E+
Sbjct: 135 CKLDRRKN-----IGFVYFESDAAARKAIASYNNKEYYGNIVTCGLHFDKDIRRSPEFEK 189

Query: 214 VKAKF------------------------------TNVYVKNIDQETSQEEFEELFGKYG 243
            +++                                +++VKN+      E+    F + G
Sbjct: 190 RRSRLGSLTVAKENLLSENNVELENHDQNSKDPHPNSIHVKNLPFNICNEDLLNYFSRIG 249

Query: 244 KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
            + S    K  E     +GFV ++      KA+D LN   F  ++L V +A K
Sbjct: 250 PVKSVFTSK-LEAYRSSWGFVTYKKGCDTRKALDSLNGAIFMDRRLEVNKALK 301

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/202 (20%), Positives = 88/202 (43%), Gaps = 25/202 (12%)

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKA 275
           K +++++ ++D   +++   + F  +  + S  +  DSE G   G+G++NF     A  A
Sbjct: 13  KVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETA 72

Query: 276 VDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNL---DDS 332
           ++  + +   G+++ +         +  ++  Y         K  G N+F  NL     +
Sbjct: 73  IETFSYVNLFGREVRI---------MPSMRNSY-------FRKNIGTNVFFSNLPLEQPA 116

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           +      E F  +G + S K+ R      +  GFV F +   A KAI   N +   G  +
Sbjct: 117 LTTRVFYETFREYGKVLSCKLDR-----RKNIGFVYFESDAAARKAIASYNNKEYYGNIV 171

Query: 393 YVAIAQRKEVRRNQLAQQIQAR 414
              +   K++RR+   ++ ++R
Sbjct: 172 TCGLHFDKDIRRSPEFEKRRSR 193

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 152/321 (47%), Gaps = 32/321 (9%)

Query: 3   DITDKTAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIG 62
           D  + T E+ EQ ++ E+T    +  +     +   SL++G L+ TV+E +L  IF    
Sbjct: 76  DCKNATQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQ 135

Query: 63  SVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRK 122
           S  S +VCRD +T  SLGY Y+NF D      A ++ NYT+  G+  +IM S ++   RK
Sbjct: 136 SFESAKVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRK 195

Query: 123 KGSGNIYIKNL---HPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDA 179
               N++  NL   +P +  +S +     +GN+LSC +   +N      GFV+F+N+  A
Sbjct: 196 NIGTNVFFSNLPLENPQLTTRSFYLIMIEYGNVLSCLLERRKN-----IGFVYFDNDISA 250

Query: 180 RDAIEAVDGMLMNDQEVYVALHVSKKDRQ----SKLEEV-------------------KA 216
           R+ I+  +       ++   LH  K+ R     +K +++                    A
Sbjct: 251 RNVIKKYNNQEFFGNKIICGLHFDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNA 310

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAV 276
           +   + VKN+  +T+QEE  + F   G I S  +  + +       FV +++   + KA 
Sbjct: 311 RSKTILVKNLPSDTTQEEVLDYFSTIGPIKSVFIS-EKQANTPHKAFVTYKNEEESKKAQ 369

Query: 277 DELNELEFKGQKLYVGRAQKK 297
             LN+  FK   ++VG  + K
Sbjct: 370 KCLNKTIFKNHTIWVGPGKDK 390

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 75/189 (39%), Gaps = 19/189 (10%)

Query: 216 AKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAK 274
           +K  ++++ N+    ++E   ++F +Y    SA + +D    K  G+G++NF+D   A  
Sbjct: 108 SKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKNDAES 167

Query: 275 AVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSID 334
           A  E N   F GQ++ +  + K                     K  G N+F  NL   ++
Sbjct: 168 ARKEFNYTVFFGQEVKIMPSMKN----------------TLFRKNIGTNVFFSNL--PLE 209

Query: 335 DEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           + +L         I    V+       +  GFV F     A   I + N Q   G  +  
Sbjct: 210 NPQLTTRSFYLIMIEYGNVLSCLLERRKNIGFVYFDNDISARNVIKKYNNQEFFGNKIIC 269

Query: 395 AIAQRKEVR 403
            +   KEVR
Sbjct: 270 GLHFDKEVR 278

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 59/121 (48%), Gaps = 3/121 (2%)

Query: 294 AQKKYERLQELKKQYEAARLEK-LAKYQGVN-LFVKNLDDSIDDEKLKEEFAPFGTITSA 351
            Q+K E+ Q  +K      ++K + K    N LF+ NL  ++ +E L++ F  + +  SA
Sbjct: 81  TQEKKEQEQVFEKTVAKGSVQKYITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESA 140

Query: 352 KVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQ 410
           KV RD  T  S G+G++ F    +A  A  E N  +  G+ + +  + +  + R  +   
Sbjct: 141 KVCRDFLTKKSLGYGYLNFKDKNDAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTN 200

Query: 411 I 411
           +
Sbjct: 201 V 201

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score =  125 bits (313), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 138/295 (46%), Gaps = 39/295 (13%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            +L++G+L+  V+E  L D F+   S  S ++C D+ T  SLGY Y+NF + E   + IE
Sbjct: 116 VALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERVIE 175

Query: 98  QLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL---HPAIDNKSLHETFSTFGNILS 154
           + NY  I G+  RIM S R+   RK    N++  NL   + A+  +  ++ F  FG ILS
Sbjct: 176 EFNYIPIFGREVRIMPSLRNSFYRKNIGTNVFFSNLPLENLALTTRVFYDAFKKFGKILS 235

Query: 155 CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQS-KLEE 213
           CK+   +N      GFV+FE +S A+ AI   +G       +   +H  +  R+S + E+
Sbjct: 236 CKLDRRKN-----IGFVYFEKDSAAKQAIAEYNGKEFFGNNILCGIHFDRNVRKSPEFEK 290

Query: 214 VKAKFTN-----------------------------VYVKNIDQETSQEEFEELFGKYGK 244
            KA+  +                             V++KN+      +   + F + G 
Sbjct: 291 RKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNLPLNPDSDLLLDYFSQIGP 350

Query: 245 ITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYE 299
           + S +   +       + F+ F+  + A  A+D LN  +  G+ + + RAQK ++
Sbjct: 351 VKS-IFTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLGRPIELSRAQKNFQ 404

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 140/310 (45%), Gaps = 36/310 (11%)

Query: 114 SQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENG-VSRGFGFVH 172
           S+  P+L  K    ++I +L   +  K+L +TF+ F + +S K+  D N   S G+G+++
Sbjct: 104 SKDSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLN 163

Query: 173 FENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQET-- 230
           F NE DA   IE  + + +  +EV +   +     +  +       TNV+  N+  E   
Sbjct: 164 FSNEEDAERVIEEFNYIPIFGREVRIMPSLRNSFYRKNIG------TNVFFSNLPLENLA 217

Query: 231 -SQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKL 289
            +   F + F K+GKI S  L++      +  GFV FE  +AA +A+ E N  EF G  +
Sbjct: 218 LTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

Query: 290 YVG----RAQKKYERLQELKKQYEAARLEKLAKYQGVN----------------LFVKNL 329
             G    R  +K    ++ K + E   L K +     N                +F+KNL
Sbjct: 273 LCGIHFDRNVRKSPEFEKRKARLEDMTLVKESLVMDNNQEIPSGSKMKGPHPNAVFIKNL 332

Query: 330 DDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAG 389
             + D + L + F+  G + S     + +  S  + F+ F    +A  AI   N   + G
Sbjct: 333 PLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQLLG 391

Query: 390 KPLYVAIAQR 399
           +P+ ++ AQ+
Sbjct: 392 RPIELSRAQK 401

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 90/202 (44%), Gaps = 25/202 (12%)

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR-GFGFVNFEDHAAAAKA 275
           K   +++ ++D++ +++   + F K+    SA +  DS  K   G+G++NF +   A + 
Sbjct: 114 KLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKKSLGYGYLNFSNEEDAERV 173

Query: 276 VDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNL---DDS 332
           ++E N +   G+++ +         +  L+  +         K  G N+F  NL   + +
Sbjct: 174 IEEFNYIPIFGREVRI---------MPSLRNSF-------YRKNIGTNVFFSNLPLENLA 217

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           +      + F  FG I S K+ R      +  GFV F     A +AI E N +   G  +
Sbjct: 218 LTTRVFYDAFKKFGKILSCKLDR-----RKNIGFVYFEKDSAAKQAIAEYNGKEFFGNNI 272

Query: 393 YVAIAQRKEVRRNQLAQQIQAR 414
              I   + VR++   ++ +AR
Sbjct: 273 LCGIHFDRNVRKSPEFEKRKAR 294

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score =  120 bits (301), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 147/326 (45%), Gaps = 49/326 (15%)

Query: 9   AEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIR 68
           +E LE + I  +   T  ++          +L+VG L   ++   L ++F    S  S +
Sbjct: 43  SETLEIVDIRTENLGTNVQN--------NIALFVGNLAEEITSERLTEMFKVYKSFISAK 94

Query: 69  VCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNI 128
           VC +A  N SLG+ Y+NF + E   +A E  NY  I GK  RIM S RD   RK    NI
Sbjct: 95  VCTNADDNRSLGHGYINFGNKEDAERATEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

Query: 129 YIKNL---HPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           +  NL      + ++  ++ F  +GN+LS K+ +     S+  GFV+FE+++ ARD I+ 
Sbjct: 155 FFSNLPLQKEKLTHRMFYDIFRKYGNVLSVKLDS-----SKNIGFVYFEDDTIARDVIKE 209

Query: 186 VDGMLMNDQEVYVALHVSKKDRQ--------SKLEE---------------VKAKF---- 218
            +        +   LH  K+ R+        SKL++               V+ K     
Sbjct: 210 FNNKEFLGNIISCGLHFDKELRKKPNFDKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDK 269

Query: 219 ------TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAA 272
                   +++KN+  +T+  E   +F + G I S  L   +E +   + FV ++D A+ 
Sbjct: 270 VAIIQPNGIFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASV 329

Query: 273 AKAVDELNELEFKGQKLYVGRAQKKY 298
            KA+   N      + ++V  A  KY
Sbjct: 330 EKAISLFNGKAIGNRNVFVTHAYSKY 355

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 320 QGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKA 378
             + LFV NL + I  E+L E F  + +  SAKV  +   N S G G++ F   E+A +A
Sbjct: 62  NNIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERA 121

Query: 379 ITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQI 411
             + N   + GK + +  + R  V R      I
Sbjct: 122 TEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNI 154

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 77/190 (40%), Gaps = 29/190 (15%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSA-VLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL 279
           ++V N+ +E + E   E+F  Y    SA V     + +  G G++NF +   A +A ++ 
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
           N  +  G+++ +                  + R     K  G N+F  NL   +  EKL 
Sbjct: 126 NYNKIMGKEIRI----------------MPSIRDSVYRKNFGTNIFFSNL--PLQKEKLT 167

Query: 340 EE-----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
                  F  +G + S K+      +S+  GFV F     A   I E N +   G  +  
Sbjct: 168 HRMFYDIFRKYGNVLSVKL-----DSSKNIGFVYFEDDTIARDVIKEFNNKEFLGNIISC 222

Query: 395 AIAQRKEVRR 404
            +   KE+R+
Sbjct: 223 GLHFDKELRK 232

>Scas_607.10
          Length = 605

 Score =  120 bits (300), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 137/294 (46%), Gaps = 40/294 (13%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            SL++  L   V+E +LYD+FS   S+ S+++C D+ +  SL Y Y+NF D     KA++
Sbjct: 92  TSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVD 151

Query: 98  QLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL---HPAIDNKSLHETFSTFGNILS 154
             NYT++ G   ++M S R+   RK    N++  NL   +  +  ++ ++TF  +G ILS
Sbjct: 152 DFNYTILFGNEIKMMPSLRNTIYRKNIGTNVFFANLPLENKHLTTRAFYDTFKGYGEILS 211

Query: 155 CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQ-SKLEE 213
           CK+   +N      GFV+F+N+  A+  I   +  +    ++   LH  K+ R     ++
Sbjct: 212 CKLDKRKN-----IGFVYFDNDKPAQMVINDFNNKIYFGNKIICGLHFDKEIRNFPNFDK 266

Query: 214 VKAKFTN------------------------------VYVKNIDQETSQEEFEELFGKYG 243
            KA   N                              ++VKN+  +   EE  + F K G
Sbjct: 267 RKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLPFDVPDEEILDHFSKLG 326

Query: 244 KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
            + S      ++ K   + F+ ++      +A +  N  +F+G+ + V RA+ K
Sbjct: 327 PVKSVFSSNVTKYK-SSWAFITYKKQTDTIRATNHFNNTKFQGKTITVSRAKLK 379

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/316 (20%), Positives = 136/316 (43%), Gaps = 37/316 (11%)

Query: 116 RDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGV-SRGFGFVHFE 174
           R+   RK+   +++I  L   +    L++ FS + +++S K+  D +   S  +G+++F 
Sbjct: 82  RNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFS 141

Query: 175 NESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNI---DQETS 231
           +E +A+ A++  +  ++   E+ +   +     +  +       TNV+  N+   ++  +
Sbjct: 142 DELEAKKAVDDFNYTILFGNEIKMMPSLRNTIYRKNIG------TNVFFANLPLENKHLT 195

Query: 232 QEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
              F + F  YG+I S  L+K      +  GFV F++   A   +++ N   + G K+  
Sbjct: 196 TRAFYDTFKGYGEILSCKLDKR-----KNIGFVYFDNDKPAQMVINDFNNKIYFGNKIIC 250

Query: 292 G-------RAQKKYERLQE-------LKKQYEAARL-------EKLAKYQGVNLFVKNLD 330
           G       R    +++ +        +  + EAA +        +L       +FVKNL 
Sbjct: 251 GLHFDKEIRNFPNFDKRKANIDNKIIIDDELEAANIGVQFKKNSELILPHPNAIFVKNLP 310

Query: 331 DSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
             + DE++ + F+  G + S     + T     + F+ +    +  +A    N     GK
Sbjct: 311 FDVPDEEILDHFSKLGPVKSV-FSSNVTKYKSSWAFITYKKQTDTIRATNHFNNTKFQGK 369

Query: 391 PLYVAIAQRKEVRRNQ 406
            + V+ A+ K    N+
Sbjct: 370 TITVSRAKLKNTEGNR 385

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 85/206 (41%), Gaps = 26/206 (12%)

Query: 203 SKKDRQSKLEEVKAKF-TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR-G 260
           S K R S+    + +  T++++  +  + ++    ++F KY  + S  +  DS+ K    
Sbjct: 75  SNKPRDSRNYRSRKRIVTSLFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLN 134

Query: 261 FGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQ 320
           +G++NF D   A KAVD+ N     G ++                K   + R     K  
Sbjct: 135 YGYLNFSDELEAKKAVDDFNYTILFGNEI----------------KMMPSLRNTIYRKNI 178

Query: 321 GVNLFVKNL---DDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATK 377
           G N+F  NL   +  +      + F  +G I S K+ +      +  GFV F   + A  
Sbjct: 179 GTNVFFANLPLENKHLTTRAFYDTFKGYGEILSCKLDK-----RKNIGFVYFDNDKPAQM 233

Query: 378 AITEKNQQIVAGKPLYVAIAQRKEVR 403
            I + N +I  G  +   +   KE+R
Sbjct: 234 VINDFNNKIYFGNKIICGLHFDKEIR 259

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF+  L D + +  L + F+ + ++ S K+  D ++  S  +G++ FS   EA KA+ + 
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 383 NQQIVAGKPLYVAIAQRKEVRRNQLAQQI 411
           N  I+ G  + +  + R  + R  +   +
Sbjct: 154 NYTILFGNEIKMMPSLRNTIYRKNIGTNV 182

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 65/191 (34%), Positives = 108/191 (56%), Gaps = 13/191 (6%)

Query: 24  TTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAY 83
           +T ++ T K E   A L++G+L   V+E +L++IF+   S +S+++C D+ T  SLGY Y
Sbjct: 125 STQQTNTMKSEKQTA-LFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGY 183

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSL- 142
           +NF D +    A+++ NY  I G+  R+M S R+   RK    N++  NL   +DN  L 
Sbjct: 184 LNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNTYFRKNIGTNVFFSNL--PLDNTKLT 241

Query: 143 ----HETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
               ++ F  FG ILSCK+   +N      GF++FEN++ A++AI+  +G    D  +  
Sbjct: 242 TRVFYDEFKKFGKILSCKLDRRKN-----IGFIYFENDAAAKEAIKQYNGKEFFDSTIMC 296

Query: 199 ALHVSKKDRQS 209
            +H  +  R+S
Sbjct: 297 GVHFDRNVRKS 307

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 95/227 (41%), Gaps = 30/227 (13%)

Query: 198 VALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK 257
           V L  SK   Q        K T +++ ++    +++    +F K+    S  +  DS  K
Sbjct: 117 VNLSNSKHSTQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTK 176

Query: 258 LR-GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKL 316
              G+G++NF D   A  AVDE N +   G+++ +         +  L+  Y        
Sbjct: 177 KSLGYGYLNFGDPKDAENAVDEYNYMPIFGREIRM---------MPSLRNTY-------F 220

Query: 317 AKYQGVNLFVKNLDDSIDDEKLK-----EEFAPFGTITSAKVMRDETGNSRGFGFVCFST 371
            K  G N+F  NL   +D+ KL      +EF  FG I S K+ R      +  GF+ F  
Sbjct: 221 RKNIGTNVFFSNL--PLDNTKLTTRVFYDEFKKFGKILSCKLDR-----RKNIGFIYFEN 273

Query: 372 PEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRN-QLAQQIQARNQM 417
              A +AI + N +      +   +   + VR++ +  Q+I   N +
Sbjct: 274 DAAAKEAIKQYNGKEFFDSTIMCGVHFDRNVRKSPEFEQKINRINNL 320

>Scas_697.10
          Length = 610

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 113/437 (25%), Positives = 186/437 (42%), Gaps = 67/437 (15%)

Query: 25  TTESETPKVETSG-ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAY 83
           T  S + K+E+    +L++G+L   V++  L  IF    S  S +VC D  TN SLG+ Y
Sbjct: 87  TQSSHSTKLESKPFTALFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGY 146

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLH 143
           +NF D E   KAI+  N   +  K  RIM S R  + +K    N++  NL P  DN+  H
Sbjct: 147 LNFGDKEDAEKAIDDFNCMKLGDKVIRIMPSLRGKNTKKSIGTNVFFTNL-PDEDNRLFH 205

Query: 144 -----ETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
                E F  FG ILSC++  ++N      GF+ FE+E  A+  ++  +  +     +  
Sbjct: 206 SRKFFEIFRQFGKILSCRLDPNKN-----IGFISFEHEEVAKTVVKKYNNSMFFGNRITC 260

Query: 199 ALHVSKKDRQSKLEE----------VKAKF-------------TN-------VYVKNIDQ 228
            +      ++  +EE          +  K+             TN       V+V N+  
Sbjct: 261 GILSEDNSKKPIMEEKQEQAKQFSQLNKKYDLNEKNMPRALLNTNNLFIENTVFVSNLPT 320

Query: 229 ETSQEEFEELFGKYGKITSAVL-EKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQ 287
             + EE    F K G I +  + +K S   L  + FV +   A A +A+ ELN    + +
Sbjct: 321 SITVEEIRNHFNKIGNIMNLFISDKISSNAL--WAFVKYSTAACAIRAIKELNNTFIRKK 378

Query: 288 KLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFA---- 343
           ++ V +A ++ E       Q+  +R     K     L++K L   I D+    +F     
Sbjct: 379 QIVVSQAFRRGE------TQFHLSR-----KPTKRILYLKEL-SRICDKDFVSQFCHQRR 426

Query: 344 -PFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE 401
             F  I+  KV +   T  +R    +   T E+A K     N +++AG  +  +     E
Sbjct: 427 IKFDEISLTKVNLEKSTHTAR----IKCRTDEDARKLYNSINNRLIAGSIIKASWENSNE 482

Query: 402 VRRNQLAQQIQARNQMR 418
           +   +        NQ+R
Sbjct: 483 IENVEKDISNNVENQIR 499

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 104/197 (52%), Gaps = 16/197 (8%)

Query: 26  TESETPKVETSG--ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAY 83
           +ES+ PK E +G  A+++VG L  ++ +  L   F PIG V S RV  +  T+ S GY Y
Sbjct: 182 SESKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGY 241

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKP--CRIMWSQ-----RDPSLRKKG------SGNIYI 130
           V+F D     KAI++++   I G+P  C +  S+     RD   +K G      S  +++
Sbjct: 242 VDFEDKSYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFL 301

Query: 131 KNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGM 189
            NL    D  +L+E F  +G I+S ++ T  E    +GFG+V + +  DA  A E + G 
Sbjct: 302 GNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGE 361

Query: 190 LMNDQEVYVALHVSKKD 206
            +N++ V +   + K++
Sbjct: 362 YINNRPVRLDYSIPKQN 378

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 91/197 (46%), Gaps = 19/197 (9%)

Query: 203 SKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFG 262
           SKK +     E    F      +ID E  + EFE + G    I++ V+ +    + RG+G
Sbjct: 184 SKKPKTELAGEPATIFVGRLSWSIDDEWLKTEFEPIGGV---ISARVMYERGTDRSRGYG 240

Query: 263 FVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV 322
           +V+FED + A KA+ E++  E  G+ +    +           K   A R ++  K+  V
Sbjct: 241 YVDFEDKSYAEKAIKEMHGKEIDGRPINCDMS---------TSKPAGAPRDDRAKKFGDV 291

Query: 323 ------NLFVKNLDDSIDDEKLKEEFAPFGTITSAKV-MRDETGNSRGFGFVCFSTPEEA 375
                  LF+ NL    D + L E F  +G I S ++    ET   +GFG+V + + E+A
Sbjct: 292 PSEPSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDA 351

Query: 376 TKAITEKNQQIVAGKPL 392
           TKA      + +  +P+
Sbjct: 352 TKAFEGLQGEYINNRPV 368

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 90.5 bits (223), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 100/194 (51%), Gaps = 16/194 (8%)

Query: 27  ESETPKVETSG--ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYV 84
           ES   K +T G  A+++VG L  ++ +  L   F  IG V + RV  +  T+ S GY YV
Sbjct: 163 ESSPKKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYV 222

Query: 85  NFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL-----RKKGSGNI--------YIK 131
           +F D     KA+++++   I G+P  +  S   P++     R+K  G+I        ++ 
Sbjct: 223 DFEDKSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLG 282

Query: 132 NLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGML 190
           NL    D  +++E F  FG I+S ++ T  E    +GFG+V + +  DA+ A+EA+ G  
Sbjct: 283 NLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEY 342

Query: 191 MNDQEVYVALHVSK 204
           ++++ V +     K
Sbjct: 343 IDNRPVRLDYSTPK 356

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 90/163 (55%), Gaps = 11/163 (6%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGV--SRGFGFVHFENESDARDAIE 184
            +++  L  +ID++ L + F   G +++ +V   E G   SRG+G+V FE++S A  A++
Sbjct: 177 TVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMY-ERGTDRSRGYGYVDFEDKSYAEKAVK 235

Query: 185 AVDGMLMNDQEVYVALHVSK------KDRQSKLEEVKAKFTN-VYVKNIDQETSQEEFEE 237
            + G  ++ + + V +  SK      +DRQ +  ++ ++ ++ +++ N+     ++   E
Sbjct: 236 EMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYE 295

Query: 238 LFGKYGKITSAVLEKDSEG-KLRGFGFVNFEDHAAAAKAVDEL 279
           +FGK+G+I S  +    E  + +GFG+V +     A KA++ L
Sbjct: 296 IFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEAL 338

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 85/169 (50%), Gaps = 7/169 (4%)

Query: 225 NIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284
           +ID E  ++EFE + G    + + V+ +    + RG+G+V+FED + A KAV E++  E 
Sbjct: 186 SIDDEWLKQEFEHIGGV---VAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEMHGKEI 242

Query: 285 KGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAP 344
            G+ + V  +  K        +Q    R   +       LF+ NL  + D + + E F  
Sbjct: 243 DGRPINVDMSTSKPTVNPREDRQ---KRFGDIPSEPSDTLFLGNLSFNADRDNIYEIFGK 299

Query: 345 FGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           FG I S ++    ET   +GFG+V +++ ++A KA+     + +  +P+
Sbjct: 300 FGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPV 348

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 51/89 (57%), Gaps = 3/89 (3%)

Query: 315 KLAKYQG--VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFST 371
           K AK  G    +FV  L  SIDDE LK+EF   G + +A+VM +  T  SRG+G+V F  
Sbjct: 167 KKAKTDGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFED 226

Query: 372 PEEATKAITEKNQQIVAGKPLYVAIAQRK 400
              A KA+ E + + + G+P+ V ++  K
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSK 255

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L++G L        +Y+IF   G + S+R+     T    G+ YV +   +   KA+E 
Sbjct: 278 TLFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEA 337

Query: 99  LNYTLIKGKPCRIMWSQRDP 118
           L    I  +P R+ +S   P
Sbjct: 338 LQGEYIDNRPVRLDYSTPKP 357

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 105/200 (52%), Gaps = 3/200 (1%)

Query: 8   TAEQLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSI 67
            +EQ E  + E   +     + T   ETS   LYVG L+  ++E +L   F   G +++I
Sbjct: 45  NSEQAEDNQGENDPSVVPANAITGGRETSDRVLYVGNLDKAITEDILKQYFQVGGPIANI 104

Query: 68  RVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGN 127
           ++  D   N ++ YA+V +H       A++ LN   I+    +I W+ +        + N
Sbjct: 105 KIMIDK-NNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFN 163

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAV 186
           +++ +L+  +D+++L   F  F + LS  V  D + G SRG+GFV F ++ DA++A++++
Sbjct: 164 LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSM 223

Query: 187 DGMLMNDQEVYVALHVSKKD 206
            G  +N + + +    +K+D
Sbjct: 224 QGQDLNGRPLRINW-AAKRD 242

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 88/182 (48%), Gaps = 17/182 (9%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+D+  +++  ++ F   G I +  +  D   K   + FV +     A  A+  LN
Sbjct: 77  LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLN 136

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
             + +   + +  A +                 ++ +     NLFV +L+ ++DDE L+ 
Sbjct: 137 GKQIENNIVKINWAFQS----------------QQSSSDDTFNLFVGDLNVNVDDETLRN 180

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  F +  S  VM D +TG+SRG+GFV F++ ++A  A+     Q + G+PL +  A +
Sbjct: 181 AFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAK 240

Query: 400 KE 401
           ++
Sbjct: 241 RD 242

>Scas_671.4
          Length = 443

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 91/167 (54%), Gaps = 3/167 (1%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           ETS   LYVG L+ +++E LL   F   G ++ +++  D   N ++ YA++ +       
Sbjct: 79  ETSDRVLYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDK-KNNNVNYAFIEYLKSHDAN 137

Query: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152
            A++ LN   I+GK  RI W+ Q   +     + N+++ +L+  +D+++L   F  F + 
Sbjct: 138 VALQTLNGIQIEGKTVRINWAFQSQQTTNSDDTFNLFVGDLNVDVDDETLSHAFDQFPSY 197

Query: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
           +   V  D + G SRG+GFV F ++  A++A+  + GM +N + V +
Sbjct: 198 VQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRI 244

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 86/182 (47%), Gaps = 16/182 (8%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+D+  +++  ++ F   G+IT   +  D +     + F+ +     A  A+  LN
Sbjct: 85  LYVGNLDKSINEDLLKQYFQVGGQITDVKIMVDKKNNNVNYAFIEYLKSHDANVALQTLN 144

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
            ++ +G+ + +  A   ++  Q                    NLFV +L+  +DDE L  
Sbjct: 145 GIQIEGKTVRINWA---FQSQQTTNSD------------DTFNLFVGDLNVDVDDETLSH 189

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  F +   A VM D +TG SRG+GFV F+  E+A +A+       + G+ + +  A +
Sbjct: 190 AFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINWATK 249

Query: 400 KE 401
           +E
Sbjct: 250 RE 251

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+VG+L   V +  L   F    S     V  D  T  S GY +V+F D E   +A+  
Sbjct: 172 NLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNV 231

Query: 99  LNYTLIKGKPCRIMWSQR 116
           +    I G+  RI W+ +
Sbjct: 232 MQGMPINGRAVRINWATK 249

>Scas_621.10
          Length = 415

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 92/188 (48%), Gaps = 13/188 (6%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91
           K E   A+++VG L  ++ +  L   F  IG V S RV  +  T+ S GY YV+F D   
Sbjct: 156 KTEGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSY 215

Query: 92  GPKAIEQLNYTLIKGKPCRIMWSQRDPSL----RKKGSGNI--------YIKNLHPAIDN 139
             KAI+++    I G+   +  S   P+     R K  G++        ++ NL    D 
Sbjct: 216 AEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADR 275

Query: 140 KSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
            ++ E FS +G I+S ++ T  E    +GFG+V + N  DA+ A+E + G  ++++ V +
Sbjct: 276 DAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPVRL 335

Query: 199 ALHVSKKD 206
                + D
Sbjct: 336 DYSTPRPD 343

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 88/171 (51%), Gaps = 12/171 (7%)

Query: 225 NIDQETSQEEFEELFGKYGKITSA--VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNEL 282
           +ID E  ++EFE +    G + SA  ++E+ ++ + RG+G+V+FED + A KA+ E+   
Sbjct: 172 SIDDEWLKKEFEHI----GGVVSARVIMERGTD-RSRGYGYVDFEDKSYAEKAIKEMQGK 226

Query: 283 EFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEF 342
           E  G+++ V  +  K            A +   +       LF+ NL  + D + + E F
Sbjct: 227 EIDGREINVDMSTSK----PAAGNNDRAKKFGDVPSEPSETLFLGNLSFNADRDAISELF 282

Query: 343 APFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           + +G I S ++    ET   +GFG+V ++  E+A KA+     + +  +P+
Sbjct: 283 SKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRPV 333

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEK 382
           +FV  L  SIDDE LK+EF   G + SA+V M   T  SRG+G+V F     A KAI E 
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 383 NQQIVAGKPLYVAIAQRKEVRRNQ 406
             + + G+ + V ++  K    N 
Sbjct: 224 QGKEIDGREINVDMSTSKPAAGNN 247

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 99/192 (51%), Gaps = 14/192 (7%)

Query: 29  ETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHD 88
           + P++    A+++VG L  ++ +  L   F  IG V S RV  +  ++ S GY YV+F D
Sbjct: 164 QKPELTGEPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFED 223

Query: 89  HEAGPKAIEQLNYTLIKGKP--CRIMWSQ-----RDPSLRKKG------SGNIYIKNLHP 135
                KA+++++   I G+P  C +  S+     RD   +K G      S  +++ NL  
Sbjct: 224 KHYAEKAVKEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSF 283

Query: 136 AIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQ 194
             D  +L E FS  G ++S ++ T  E    +GFG+V + +  DA+ A EA+ G  ++++
Sbjct: 284 NADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNR 343

Query: 195 EVYVALHVSKKD 206
            V +   + +++
Sbjct: 344 PVRLDYSIPRQN 355

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 19/182 (10%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           F      +ID E  + EF+ + G    +++ V+ +    + RG+G+V+FED   A KAV 
Sbjct: 176 FVGRLSWSIDDEWLKTEFDHIGGV---VSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 278 ELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV------NLFVKNLDD 331
           E++  E  G+ +    +           K   A R ++  K+  V       LF+ NL  
Sbjct: 233 EMHGKEIDGRPINCDMS---------TSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSF 283

Query: 332 SIDDEKLKEEFAPFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
           + D + L E F+  G + S ++    ET   +GFG+V + + ++A KA      + +  +
Sbjct: 284 NADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNR 343

Query: 391 PL 392
           P+
Sbjct: 344 PV 345

 Score = 52.4 bits (124), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 1/80 (1%)

Query: 322 VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAIT 380
             +FV  L  SIDDE LK EF   G + SA+V+ +  +  SRG+G+V F     A KA+ 
Sbjct: 173 ATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYERGSDRSRGYGYVDFEDKHYAEKAVK 232

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
           E + + + G+P+   ++  K
Sbjct: 233 EMHGKEIDGRPINCDMSTSK 252

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 132/308 (42%), Gaps = 41/308 (13%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           I+++NL      + L E F T G ++   + T + G  RG G V F      +DAI   D
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADIITSK-GHHRGMGTVEFTKNESVQDAISKFD 182

Query: 188 GMLMNDQEVYV---------ALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
           G L  D+++ V         A   SKK   +  EE+   F  V++ N+    + +  +++
Sbjct: 183 GALFMDRKLMVRQDNPPPEAAKEFSKK---ATREEIDNGFE-VFIINLPYSMNWQSLKDM 238

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV--GRAQK 296
           F + G +  A +E D  G  RGFG V +       +A+D  N +E +G+ L V  GR  K
Sbjct: 239 FKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRFNK 298

Query: 297 K--YERLQELKKQYEAAR--------------LEKLAKY-QGVN--------LFVKNLDD 331
           +   +R  + ++  E  R               E  AK+ +GVN        ++  NL  
Sbjct: 299 RKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNLPF 358

Query: 332 SIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKP 391
           S     L + F P G I +A++   E G   G   V +    +A   I + N     G  
Sbjct: 359 STARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGGCS 418

Query: 392 LYVAIAQR 399
           L ++ A+R
Sbjct: 419 LQISYARR 426

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/194 (28%), Positives = 96/194 (49%), Gaps = 7/194 (3%)

Query: 202 VSKKDRQSKLEEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRG 260
           + ++D + + +  K  F N ++V+N+  + + E+ +ELFG  G++  A +   S+G  RG
Sbjct: 104 IVERDLERQFDATKRNFENSIFVRNLTFDCTPEDLKELFGTVGEVVEADIIT-SKGHHRG 162

Query: 261 FGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQ 320
            G V F  + +   A+ + +   F  +KL V +     E  +E  K+     ++      
Sbjct: 163 MGTVEFTKNESVQDAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEID-----N 217

Query: 321 GVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAIT 380
           G  +F+ NL  S++ + LK+ F   G +  A V  D  G SRGFG V + T +E  +AI 
Sbjct: 218 GFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAID 277

Query: 381 EKNQQIVAGKPLYV 394
             N   V G+ L V
Sbjct: 278 TFNGMEVEGRVLEV 291

 Score = 67.8 bits (164), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 130/310 (41%), Gaps = 58/310 (18%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTS--LGYAYVNFHDHEAGPKAI 96
           S++V  L    +   L ++F  +G V    V  D IT+     G   V F  +E+   AI
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEV----VEADIITSKGHHRGMGTVEFTKNESVQDAI 178

Query: 97  EQLNYTLIKGKPCRIMWSQRDP------SLRKKGSGN-------IYIKNLHPAIDNKSLH 143
            + +  L   +  ++M  Q +P         KK +         ++I NL  +++ +SL 
Sbjct: 179 SKFDGALFMDR--KLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSLK 236

Query: 144 ETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQ--EVYVALH 201
           + F   G++L   V  D NG SRGFG V +  E +   AI+  +GM +  +  EV     
Sbjct: 237 DMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVLEVREGRF 296

Query: 202 VSKKD------RQSKLEEVK------------------AKFTN-----------VYVKNI 226
             +K+      R+  LE+ +                  AKFT            +Y  N+
Sbjct: 297 NKRKNNDRYNQRREDLEDTRGTEPGLAQDAAVHIDETAAKFTEGVNPGGDRNCFIYCSNL 356

Query: 227 DQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKG 286
              T++ +  +LFG  GKI +A L+    G+  G   V +E+   A   + +LN   + G
Sbjct: 357 PFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNYGG 416

Query: 287 QKLYVGRAQK 296
             L +  A++
Sbjct: 417 CSLQISYARR 426

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 97/176 (55%), Gaps = 4/176 (2%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           ETS   LYVG L+ +++E LL   F   G + ++++  D + N  + YA+V +       
Sbjct: 54  ETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIED-MKNEYVNYAFVEYIRSHDAN 112

Query: 94  KAIEQLNYTLIKGKPCRIMWS-QRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152
            A++ LN   ++ K  +I W+ +   +     + N+++ +L+  +D+++L  TF  F   
Sbjct: 113 VALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDETLAGTFREFPTF 172

Query: 153 LSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR 207
           +   V  D + G SRG+GFV F N+ +A+ A++A+ G  ++ +++ +    +K++R
Sbjct: 173 IQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW-ATKRER 227

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 89/182 (48%), Gaps = 16/182 (8%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+D+  +++  ++ F   G I +  + +D + +   + FV +     A  A+  LN
Sbjct: 60  LYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAFVEYIRSHDANVALQTLN 119

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
            ++ + + L +  A   +E  Q  +                 NLFV +L+  +DDE L  
Sbjct: 120 GVQLENKTLKINWA---FETQQAAEND------------DTFNLFVGDLNVDVDDETLAG 164

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  F T   A VM D +TG SRG+GFV FS  EEA KA+     + ++G+ + +  A +
Sbjct: 165 TFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINWATK 224

Query: 400 KE 401
           +E
Sbjct: 225 RE 226

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 52/263 (19%), Positives = 94/263 (35%), Gaps = 25/263 (9%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+VG+L   V +  L   F    +     V  D  T  S GY +V+F + E   KA++ 
Sbjct: 147 NLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDA 206

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVA 158
           +    + G+  RI W+ +    R++  GN +  N        S    F  +GN       
Sbjct: 207 MQGKDLSGRQIRINWATK----RERNMGNNFGNN------RGSRGGNFRPYGN------Q 250

Query: 159 TDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEV---- 214
              N  +R           D    ++                 V        +E++    
Sbjct: 251 GHHNRNNRNMMPPAMGMPMDGLMPMQQGQQNGQQPNVQQQQPMVPPPVNPQAIEDMIRRA 310

Query: 215 KAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAK 274
             + T  Y+ NI    ++ +   L   +G I       +     +G  F+ ++ H  AA 
Sbjct: 311 PPRVTTAYIGNIPHYATEADLIPLLQNFGFILDFTHYPE-----KGCCFIKYDTHEQAAV 365

Query: 275 AVDELNELEFKGQKLYVGRAQKK 297
            +  L    F+G+ L  G  +++
Sbjct: 366 CIVALANFPFQGRNLRTGWGKER 388

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 91/177 (51%), Gaps = 2/177 (1%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           ETS   LYVG L+ T++EA L   F   G +++++V  D   N    YA+V +       
Sbjct: 31  ETSDRILYVGNLDKTINEATLKQYFQVGGPIANVKVLVDK-NNEEANYAFVEYRQPRDAN 89

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
            A + L+   I+    +I W+ +   +    + N+++ +L+  +D+++L  TF  F   +
Sbjct: 90  VAFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFI 149

Query: 154 SCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQS 209
              V  D ++G SRG+GFV F  + +A+ A++A  G  +N + + V     ++ + +
Sbjct: 150 QAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQHA 206

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 82/182 (45%), Gaps = 17/182 (9%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+D+  ++   ++ F   G I +  +  D   +   + FV +     A  A   L+
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
             + +   + +  A +                 ++++     NLFV +L+  +DDE L  
Sbjct: 97  GKQIENNVIKINWAFQS----------------QQVSSDDTFNLFVGDLNVDVDDETLSS 140

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  F T   A VM D ++G SRG+GFV F   EEA KA+  K    + G+ + V  A +
Sbjct: 141 TFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAK 200

Query: 400 KE 401
           +E
Sbjct: 201 RE 202

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 79/170 (46%), Gaps = 5/170 (2%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +Y+ NL   I+  +L + F   G I + KV  D+N     + FV +    DA  A + +D
Sbjct: 37  LYVGNLDKTINEATLKQYFQVGGPIANVKVLVDKNNEEANYAFVEYRQPRDANVAFQTLD 96

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS 247
           G  + +    + ++ + + +Q   ++    F      ++D ET    F+E F  +  I +
Sbjct: 97  GKQIENN--VIKINWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKE-FPTF--IQA 151

Query: 248 AVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
            V+     G+ RG+GFV+F +   A KA+D        G+ + V  A K+
Sbjct: 152 HVMWDMQSGRSRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKR 201

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 93/216 (43%), Gaps = 47/216 (21%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGV-SRGFGFVHFENESDARDAIE 184
           GN+YI+ +   +    L   FS FG +LS K+  D N   S G+GF+ +   S A   I+
Sbjct: 217 GNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAARCIK 276

Query: 185 AVDGMLMNDQEVYVALHVSKKDRQS-KLEEVK-----AKFTNVYVKNIDQETSQEEF--- 235
            ++G LMN   +++  HV +K+R+   L+ +K      +F  V+V N+  E         
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFRGVFVGNLPTEYEDGTLITP 336

Query: 236 EELFGKYGKITSAV-------------------------------------LEKDSEGKL 258
           E++F K+  I   V                                       ++ +  L
Sbjct: 337 EQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCDSQNEDSPL 396

Query: 259 RGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRA 294
           +G+GF+ F  H  A KA+D+LN   + G  L V +A
Sbjct: 397 KGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKA 432

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 55/98 (56%), Gaps = 17/98 (17%)

Query: 320 QGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM-----RDE-----------TGNSRG 363
           Q  NL+VK++  S  DE L + ++ +G I SAK++     ++E            G SRG
Sbjct: 597 QESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRG 656

Query: 364 FGFVCFSTPEEATKAITEKNQ-QIVAGKPLYVAIAQRK 400
           +GFVCF  P +A++A+   ++ Q+     LYV+ AQ++
Sbjct: 657 YGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 6/102 (5%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSR---GFGFVCFSTPEEATKAI 379
           NL+++ +   +  + L   F+ FGT+ S K++ D  GN+R   G+GF+ +    +A + I
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIID--GNTRESLGYGFISYPLGSQAARCI 275

Query: 380 TEKNQQIVAGKPLYVAI-AQRKEVRRNQLAQQIQARNQMRFQ 420
            E N  ++ G PL++    +RKE  R  L    +  +  RF+
Sbjct: 276 KELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDERFR 317

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 97/234 (41%), Gaps = 56/234 (23%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITS--AVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           N+Y++ I ++ S ++   +F K+G + S   +++ ++   L G+GF+++   + AA+ + 
Sbjct: 218 NLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESL-GYGFISYPLGSQAARCIK 276

Query: 278 ELNELEFKGQKLYVGRAQKKYER----LQELKKQYEAARLEKLAKYQGVNLFVKNLDDSI 333
           ELN     G  L++    ++ ER    L  LK+  +  R      ++GV  FV NL    
Sbjct: 277 ELNGNLMNGSPLFINYHVERKERERIHLDHLKEDNDDER------FRGV--FVGNLPTEY 328

Query: 334 DD----------EKLKEEFAPFGTITSAKVMRD-----------------------ETGN 360
           +D           K      P   ++     R+                       ET +
Sbjct: 329 EDGTLITPEQVFNKFNHILDPVDILSYYFPKRNSNTNIEYKDDDSTSPTSSSKENAETCD 388

Query: 361 S-------RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA-QRKEVRRNQ 406
           S       +G+GF+ FST + A KAI + N     G  L V  A Q K +  N 
Sbjct: 389 SQNEDSPLKGYGFIKFSTHDMALKAIDKLNSFTWLGHSLVVNKAVQNKTLYNNH 442

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 17/97 (17%)

Query: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT---DEN-------------GV 164
           R +   N+Y+K++  +  ++ L++ +S +G I+S K+ T    +N             G 
Sbjct: 594 RDQQESNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGT 653

Query: 165 SRGFGFVHFENESDARDAIEAVDGMLMNDQEV-YVAL 200
           SRG+GFV F+N  DA  A+ A D   +    V YV+ 
Sbjct: 654 SRGYGFVCFKNPLDASRAMMATDRFQVGTNHVLYVSF 690

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 17/96 (17%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSA----------------VLEKDSEGKLRGFG 262
           +N+YVK+I      E+  + + +YG+I SA                 LE    G  RG+G
Sbjct: 599 SNLYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYG 658

Query: 263 FVNFEDHAAAAKAVDELNELEF-KGQKLYVGRAQKK 297
           FV F++   A++A+   +  +      LYV  AQK+
Sbjct: 659 FVCFKNPLDASRAMMATDRFQVGTNHVLYVSFAQKR 694

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 92/178 (51%), Gaps = 2/178 (1%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   LYVG L  ++ + LL   F   GS+SS+++  D   +    YA+V + +     
Sbjct: 93  EKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDK-NSQECNYAFVEYFEPHDAN 151

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
            A + LN   ++GK  +I W+ +   +    + N+++ +L+  +D+ +L  TF  F + +
Sbjct: 152 VAYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKEFPSFI 211

Query: 154 SCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK 210
              V  D ++G SRG+GFV F  +  A+ A+E   G  +N + + +     ++ +QS+
Sbjct: 212 QAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKREPQQSQ 269

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 88/191 (46%), Gaps = 17/191 (8%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+ +    +  ++ F   G I+S  +  D   +   + FV + +   A  A   LN
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDANVAYQTLN 158

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
             E +G+ L +  A +                 +++   +  NLFV +L+  +DD  L  
Sbjct: 159 GKEVEGKVLKINWAFQS----------------QQVNSDETFNLFVGDLNVDVDDATLAG 202

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F  F +   A VM D ++G SRG+GFV F   ++A  A+  K    + G+ L +  A +
Sbjct: 203 TFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASK 262

Query: 400 KEVRRNQLAQQ 410
           +E +++Q  Q+
Sbjct: 263 REPQQSQQGQR 273

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 83/177 (46%), Gaps = 5/177 (2%)

Query: 121 RKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDAR 180
           R+K    +Y+ NL  +ID+  L + F   G+I S K+  D+N     + FV +    DA 
Sbjct: 92  REKSDKILYVGNLPKSIDDDLLKQYFQIGGSISSVKIIPDKNSQECNYAFVEYFEPHDAN 151

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
            A + ++G  +  +   + ++ + + +Q   +E    F      ++D  T    F+E F 
Sbjct: 152 VAYQTLNGKEVEGK--VLKINWAFQSQQVNSDETFNLFVGDLNVDVDDATLAGTFKE-FP 208

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
            +  I + V+     G+ RG+GFV+F +   A  A++     E  G+ L +  A K+
Sbjct: 209 SF--IQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINWASKR 263

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 99/263 (37%), Gaps = 19/263 (7%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+VG+L   V +A L   F    S     V  D  +  S GY +V+F + +    A+E 
Sbjct: 185 NLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSFGEQDQAQVAMET 244

Query: 99  LNYTLIKGKPCRIMW-SQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKV 157
                + G+  RI W S+R+P   ++G          PA                   + 
Sbjct: 245 KQGFELNGRALRINWASKREPQQSQQGQRRFN----GPASGRGGFRNN------NNQNQN 294

Query: 158 ATDENGVSRGFG-FVHFENESDARDAIEAVD--GMLMNDQEVYVALHVSKKDRQSKLEEV 214
             + NG++R  G   H + +S     ++     G+    Q   V   V  +  +  +   
Sbjct: 295 HHNHNGINRHAGPPPHHQMQSHLPPQLQQQPPIGIPPIHQAPLVPPPVDPEAVEDMMRRA 354

Query: 215 KAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAK 274
             + T  Y+ NI     + +   L   +G I       +     +G  F+ ++ H  AA 
Sbjct: 355 PPRVTTAYIGNIPHFAQEHDLIPLLQNFGFIIDFKHYPE-----KGCCFIKYDTHEQAAL 409

Query: 275 AVDELNELEFKGQKLYVGRAQKK 297
            +  L    F+G+ L  G  ++K
Sbjct: 410 CIVALTNFPFQGRNLRTGWGKEK 432

>Scas_635.7
          Length = 581

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 93/179 (51%), Gaps = 21/179 (11%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEA- 185
           ++I  L+       L   FS +GN++  K+  D   G SRGFGF+ FEN S   + ++  
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKTQ 257

Query: 186 --VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYG 243
             +DG +++              ++S   E + K   ++V  I  +   +EFE+ F +YG
Sbjct: 258 HILDGKVIDP-------------KRSIPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYG 304

Query: 244 KITSA--VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
            I  A  +L+KD+ G+ RGFGFV + D   A   V +   +EFKG+++ + RA+ ++ +
Sbjct: 305 TIIDAQLMLDKDT-GRSRGFGFVTY-DSGDAVDRVCQNKYIEFKGKQIEIKRAEPRHNQ 361

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 98/197 (49%), Gaps = 26/197 (13%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDEL 279
           +++  ++ ET+++  +  F KYG +    + KD + G+ RGFGF+ FE+ ++    VDE+
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSS----VDEV 253

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
                K Q +  G+       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 254 ----VKTQHILDGK-------VIDPKRSIPREEQDKTGK-----IFVGGIGTDVRPKEFE 297

Query: 340 EEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           + FA +GTI  A++M D +TG SRGFGFV + + +   +    K  +   GK + +   +
Sbjct: 298 DFFAQYGTIIDAQLMLDKDTGRSRGFGFVTYDSGDAVDRVCQNKYIEF-KGKQIEI---K 353

Query: 399 RKEVRRNQLAQQIQARN 415
           R E R NQ A   Q  N
Sbjct: 354 RAEPRHNQRAAASQPMN 370

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 79/153 (51%), Gaps = 19/153 (12%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L + FS  G+V  +++ +D  T  S G+ ++ F +    P +++++
Sbjct: 198 MFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFEN----PSSVDEV 253

Query: 100 NYT--LIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILS 154
             T  ++ GK   P R +     P   +  +G I++  +   +  K   + F+ +G I+ 
Sbjct: 254 VKTQHILDGKVIDPKRSI-----PREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIID 308

Query: 155 CKVATDEN-GVSRGFGFVHFENESDARDAIEAV 186
            ++  D++ G SRGFGFV +    D+ DA++ V
Sbjct: 309 AQLMLDKDTGRSRGFGFVTY----DSGDAVDRV 337

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 87/173 (50%), Gaps = 12/173 (6%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A+++VG L  ++ +  L   F  IG V   RV  +  T+ S GY YV+F +     KAI+
Sbjct: 168 ATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQ 227

Query: 98  QLNYTLIKGKPCRIMWSQRDPS-----LRKKG------SGNIYIKNLHPAIDNKSLHETF 146
           ++    I G+P     S   P+      +K G      S  +++ NL    D  ++ E F
Sbjct: 228 EMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELF 287

Query: 147 STFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
           +  G ++S ++ T  E    +GFG+V F N  DA+ A++A+ G  ++++ V +
Sbjct: 288 AKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 85/162 (52%), Gaps = 13/162 (8%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKV----ATDENGVSRGFGFVHFENESDARDAI 183
           I++  L  +ID++ L + F   G ++  +V     TD    SRG+G+V FEN+S A  AI
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDR---SRGYGYVDFENKSYAEKAI 226

Query: 184 EAVDGMLMNDQEVYVALHVSK----KDRQSKLEEVKAKFTN-VYVKNIDQETSQEEFEEL 238
           + + G  ++ + +   +  SK     DR  K  +  ++ ++ +++ N+     ++   EL
Sbjct: 227 QEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFEL 286

Query: 239 FGKYGKITSAVLEKDSEG-KLRGFGFVNFEDHAAAAKAVDEL 279
           F K+G++ S  +    E  + +GFG+V F +   A KA+D L
Sbjct: 287 FAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 92/193 (47%), Gaps = 9/193 (4%)

Query: 203 SKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFG 262
           +KK +  + EE    F      +ID E  ++EFE + G  G   + V+ +    + RG+G
Sbjct: 156 NKKQKNEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIG---ARVIYERGTDRSRGYG 212

Query: 263 FVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV 322
           +V+FE+ + A KA+ E+   E  G+ +    +  K     +  K++     E        
Sbjct: 213 YVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSE-----PSD 267

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITE 381
            LF+ NL  + D + + E FA  G + S ++    ET   +GFG+V FS  E+A KA+  
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 382 KNQQIVAGKPLYV 394
              + +  +P+ +
Sbjct: 328 LQGEYIDNRPVRL 340

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEK 382
           +FV  L  SIDDE LK+EF   G +  A+V+ +  T  SRG+G+V F     A KAI E 
Sbjct: 170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEM 229

Query: 383 NQQIVAGKPLYVAIAQRKEVRRNQLAQQI 411
             + + G+P+   ++  K    N  A++ 
Sbjct: 230 QGKEIDGRPINCDMSTSKPAGNNDRAKKF 258

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L++G L        ++++F+  G V S+R+     T    G+ YV F + E   KA++ 
Sbjct: 268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDA 327

Query: 99  LNYTLIKGKPCRIMWSQRDPS 119
           L    I  +P R+ +S   P+
Sbjct: 328 LQGEYIDNRPVRLDFSSPRPN 348

>Scas_637.2
          Length = 377

 Score = 77.0 bits (188), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 77/329 (23%), Positives = 136/329 (41%), Gaps = 27/329 (8%)

Query: 97  EQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCK 156
           E+ + + +   P R      +  + K     I+I NL      + L + FS  G +++ +
Sbjct: 49  ERFHPSRVGPPPRRTYDRPYESGVEKHHENGIFIGNLSFDATEEDLRDFFSQVGEVVNAE 108

Query: 157 VATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL-HVSKKDRQS-KLEEV 214
           V +   G S+G G V F N +DA +AI   +G+    ++++V         RQ  K  E 
Sbjct: 109 VMS-YRGRSKGMGTVEFTNPADAEEAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEP 167

Query: 215 KAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAK 274
             +    +V N+    + +  +++F + G +  A +E D  G  RGFG V + +     K
Sbjct: 168 TQQGYEAFVVNLPYSITWQNLKDIFRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFK 227

Query: 275 AVDELNELEFKGQKLYVGRAQKKY----------------------ERLQELKKQYEAAR 312
           A+D  N  E +G+ L V   +  +                      E    L   +  + 
Sbjct: 228 AIDSFNGAELEGRILEVREGKFNHPRDTFDDRRDFDDRRDFDDVPKEEEPVLPPAHNPSF 287

Query: 313 LEKLAKYQGVN--LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFS 370
            E ++     N  ++  NL  S     L + F   G I  A+++ DETG S G   V ++
Sbjct: 288 TEGVSGDGERNNTVYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYA 347

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQR 399
           + + A   I + N     G+ L++  A R
Sbjct: 348 SQDAADVCINKLNGYNYGGRDLHITYASR 376

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 117/299 (39%), Gaps = 44/299 (14%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L D FS +G V +  V   +    S G   V F +     +AI Q 
Sbjct: 80  IFIGNLSFDATEEDLRDFFSQVGEVVNAEVM--SYRGRSKGMGTVEFTNPADAEEAIRQY 137

Query: 100 NYTLIKGKPCRIMWSQRDPSLRKKGSGN--------IYIKNLHPAIDNKSLHETFSTFGN 151
           N     G+   +   Q  P  R++   +         ++ NL  +I  ++L + F   G+
Sbjct: 138 NGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDIFRECGD 197

Query: 152 ILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV------------- 198
           ++   V  D NG SRGFG V + NE D   AI++ +G  +  + + V             
Sbjct: 198 VIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRILEVREGKFNHPRDTFD 257

Query: 199 ----------ALHVSKKDRQSKLEEVKAKFT-----------NVYVKNIDQETSQEEFEE 237
                        V K++           FT            VY  N+   T+  +  +
Sbjct: 258 DRRDFDDRRDFDDVPKEEEPVLPPAHNPSFTEGVSGDGERNNTVYCNNLPLSTTVPDLYD 317

Query: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
           LFG  G+I  A L  D  G   G   V +    AA   +++LN   + G+ L++  A +
Sbjct: 318 LFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNYGGRDLHITYASR 376

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 94/181 (51%), Gaps = 14/181 (7%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91
           K +   A+++VG L  +V +  L   F  IG V   RV  +  T+ S GY YV+F D   
Sbjct: 161 KTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSY 220

Query: 92  GPKAIEQLNYTLIKGKP--CRIMWSQ-----RDPSLRKKG------SGNIYIKNLHPAID 138
             KA+++++   I G+   C +  S+     R+   +K G      S  +++ NL    D
Sbjct: 221 AEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNAD 280

Query: 139 NKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVY 197
             +L E FS  GN++S ++ T  E+   +GFG+V + +  +A+ A++A+ G  ++++ V 
Sbjct: 281 RDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVR 340

Query: 198 V 198
           +
Sbjct: 341 I 341

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 84/177 (47%), Gaps = 19/177 (10%)

Query: 225 NIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284
           ++D E  + EF+ + G  G   + V+ +    K RG+G+V+FED + A KAV E++  E 
Sbjct: 177 SVDDEWLKTEFDHIGGVVG---ARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEI 233

Query: 285 KGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV------NLFVKNLDDSIDDEKL 338
            G+ +    +           K   A R ++  KY          LF+ NL  + D + L
Sbjct: 234 DGRAINCDMS---------TSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDAL 284

Query: 339 KEEFAPFGTITSAKV-MRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
            E F+  G + S ++    E+   +GFG+V + + EEA  A+     + +  +P+ +
Sbjct: 285 FELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRI 341

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 82/164 (50%), Gaps = 15/164 (9%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKV----ATDENGVSRGFGFVHFENESDARDAI 183
           I++  L  ++D++ L   F   G ++  +V     TD+   SRG+G+V FE+ S A  A+
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDK---SRGYGYVDFEDVSYAEKAV 225

Query: 184 EAVDGMLMNDQEVYVALHVSK------KDRQSKLEEVKAKFTN-VYVKNIDQETSQEEFE 236
           + + G  ++ + +   +  SK      +DR  K  +  ++ ++ +++ N+     ++   
Sbjct: 226 KEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALF 285

Query: 237 ELFGKYGKITSAVLEKDSEG-KLRGFGFVNFEDHAAAAKAVDEL 279
           ELF K+G + S  +    E  + +GFG+V +     A  A+D L
Sbjct: 286 ELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 6/105 (5%)

Query: 302 QELKKQYEAARLEKLAKYQGVN-----LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD 356
           +E KK+   +  + +AK Q  +     +FV  L  S+DDE LK EF   G +  A+V+ +
Sbjct: 142 EESKKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE 201

Query: 357 E-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
             T  SRG+G+V F     A KA+ E + + + G+ +   ++  K
Sbjct: 202 RGTDKSRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSK 246

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L++G L        L+++FS  G+V S+R+     +N   G+ YV +   E    A++ 
Sbjct: 269 TLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDA 328

Query: 99  LNYTLIKGKPCRIMWSQRDP 118
           L    I  +P RI +S   P
Sbjct: 329 LQGEYIDNRPVRIDFSSPRP 348

>Kwal_27.11447
          Length = 439

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 96/194 (49%), Gaps = 9/194 (4%)

Query: 13  EQLKIEEQTA-----PTTTESETPK--VETSGASLYVGELEPTVSEALLYDIFSPIGSVS 65
           EQ   E QTA     P  T +   +   ETS   LYVG L+  V+E +L   F   G+++
Sbjct: 30  EQPSQEPQTAGKAAEPAVTPANATRGGRETSDRILYVGNLDLAVTEDMLKQYFQVGGAIA 89

Query: 66  SIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGS 125
           ++++  D   N    YA+V FH       A + L+   I+    +I ++ +   +  + +
Sbjct: 90  NVKILMDK-NNKEANYAFVEFHQPHDASVAFQTLDGKQIENHVIKINYAFQSQQVSSEDT 148

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIE 184
            N+++ +L+  +D+++L  TF      +   V  D + G SRG+GFV F  +  A+ A+E
Sbjct: 149 FNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAME 208

Query: 185 AVDGMLMNDQEVYV 198
              G ++N + + +
Sbjct: 209 EKQGTVVNGRAIRI 222

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 17/182 (9%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +YV N+D   +++  ++ F   G I +  +  D   K   + FV F     A+ A   L+
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE 340
             + +   + +  A +                 ++++     NLFV +L+  +DDE L  
Sbjct: 124 GKQIENHVIKINYAFQS----------------QQVSSEDTFNLFVGDLNVDVDDETLAN 167

Query: 341 EFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            F    T   A VM D +TG SRG+GFV F    +A KA+ EK   +V G+ + +  A +
Sbjct: 168 TFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

Query: 400 KE 401
           +E
Sbjct: 228 RE 229

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 80/172 (46%), Gaps = 9/172 (5%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +Y+ NL  A+    L + F   G I + K+  D+N     + FV F    DA  A + +D
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQVGGAIANVKILMDKNNKEANYAFVEFHQPHDASVAFQTLD 123

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT-NVYVKNIDQETSQEEFEELFGKYGKIT 246
           G  + +       HV K +   + ++V ++ T N++V +++ +   E     F       
Sbjct: 124 GKQIEN-------HVIKINYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFI 176

Query: 247 SAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
            A +  D + G+ RG+GFV+F +   A KA++E       G+ + +  A K+
Sbjct: 177 QAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASKR 228

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+VG+L   V +  L + F  + +     V  D  T  S GY +V+F +     KA+E+
Sbjct: 150 NLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEE 209

Query: 99  LNYTLIKGKPCRIMWSQR 116
              T++ G+  RI W+ +
Sbjct: 210 KQGTVVNGRAIRINWASK 227

>Kwal_23.3985
          Length = 876

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 99/200 (49%), Gaps = 11/200 (5%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN------GVSRGFGFVHFENESDAR 180
           +I++KNL+ +   K L E F TFG  +  +V T  +       +S GFGF  F+    A 
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
             I+A+DG +++   + + L   +  + S   + K     + VKN+  E  +++  ELF 
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
            +G++ S  L K  +   RGF FV F     A  A+++L  +   G++L +  A+++ + 
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEEEPQD 829

Query: 301 LQELKKQYEAARLEKLAKYQ 320
            +E     + AR+ K  + Q
Sbjct: 830 AEE-----QIARMTKKVRSQ 844

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 111/451 (24%), Positives = 180/451 (39%), Gaps = 79/451 (17%)

Query: 13  EQLKIEEQTAPTTTESETPKVETSGASLYVGELEPT-----------VSEALLYDIFSPI 61
           E+  +E    P +TE +  K++T+    ++ ++E T            +E     +F+P 
Sbjct: 297 EEDNVESTEDPESTEQQESKLDTTEEEKFIQKIEATGRLFLRNILYTATEDDFRKLFAPF 356

Query: 62  GSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLR 121
           G +  + V  D  T  S G+AYV F +      A  +L+  + +G+   I+  ++  S R
Sbjct: 357 GELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQGRLLHILPGEQKKSHR 416

Query: 122 KKGSGNIYIKNLHPAIDNKSL-------HETFSTFGNILSCKVATDENGVSRGFGFVHFE 174
                   +KNL P    +SL       H+TFS   N L          V+   G V   
Sbjct: 417 ---LDEFDLKNL-PLKKQRSLKRKANASHDTFS--WNSLYMNQDAVLGSVAAKLG-VQKS 469

Query: 175 NESDARDAIEAVDGMLMNDQEVYVALHV-----SKKDRQSKLEEVKAKF----TNVYVKN 225
           +  DA DA  AV   L    E +V   V     SK    +K E+ K+      T + VKN
Sbjct: 470 DLIDATDASAAVKQALA---EAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTVLLVKN 526

Query: 226 IDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFK 285
               T+  E  +LF  +GK+   +L        +    V + D  +A  A  +L+   FK
Sbjct: 527 FPFGTTHSELADLFLPFGKLQRLLLP-----PAQTIAVVQYRDATSARAAFSKLSYKRFK 581

Query: 286 GQKLYVGRAQK------------------------KYERL--QELKKQYEAARLEKLAKY 319
              LY+ +  K                        K  R    E+ +   A++ E     
Sbjct: 582 DGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTD 641

Query: 320 Q-----GVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKV-MRDETGNSR-----GFGFVC 368
                  V++FVKNL+ S   ++L E+F  FG    A+V  + +  NS      GFGF  
Sbjct: 642 DVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAE 701

Query: 369 FSTPEEATKAITEKNQQIVAGKPLYVAIAQR 399
           F T E+A   I   +  ++ G  + + ++ R
Sbjct: 702 FKTREQALAVIDAMDGAVLDGHRIQLKLSHR 732

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 47/82 (57%), Gaps = 1/82 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF++N+  +  ++  ++ FAPFG +    V  D  TG S+GF +V F  P +A  A  E 
Sbjct: 335 LFLRNILYTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVEL 394

Query: 383 NQQIVAGKPLYVAIAQRKEVRR 404
           ++QI  G+ L++   ++K+  R
Sbjct: 395 DKQIFQGRLLHILPGEQKKSHR 416

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 87/186 (46%), Gaps = 16/186 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLE-----KDSEGKLR-GFGFVNFEDHAAA 272
            +++VKN++  T+ +E  E F  +G    A ++     K+S   L  GFGF  F+    A
Sbjct: 649 VSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQA 708

Query: 273 AKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDS 332
              +D ++     G ++          +L+   +Q   +     +K     + VKNL   
Sbjct: 709 LAVIDAMDGAVLDGHRI----------QLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFE 758

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           ++ +++ E F+ FG + S ++ +    ++RGF FV F  P+EA  A+ +     + G+ L
Sbjct: 759 VERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRL 818

Query: 393 YVAIAQ 398
            +  A+
Sbjct: 819 VMQHAE 824

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 72/162 (44%), Gaps = 11/162 (6%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGS--VSSIRVCRDAITNT---SLGYAYVNFHDHEAGP 93
           S++V  L  + +   L + F   G   V+ ++   D   +    S+G+ +  F   E   
Sbjct: 650 SIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAEFKTREQAL 709

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGN------IYIKNLHPAIDNKSLHETFS 147
             I+ ++  ++ G   ++  S R          +      I +KNL   ++ K + E FS
Sbjct: 710 AVIDAMDGAVLDGHRIQLKLSHRQGGQSSSSGKSKKGTGKIIVKNLPFEVERKQIFELFS 769

Query: 148 TFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
           +FG + S ++    +  +RGF FV F    +A +A+E + G+
Sbjct: 770 SFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGV 811

 Score = 36.6 bits (83), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 11/86 (12%)

Query: 324 LFVKNLDDSIDDEKLKEEFAP-FGTI----------TSAKVMRDETGNSRGFGFVCFSTP 372
           + VK +   + ++KLK+ F     TI          T  K++++  G SR F FV F + 
Sbjct: 4   VIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGFKSE 63

Query: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398
           E+A  A+   +Q  +    + V++A+
Sbjct: 64  EDAFDAVNYFDQSFIDTSKIEVSMAK 89

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%)

Query: 141 SLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200
           ++H+  +   ++   K+  +  G SR F FV F++E DA DA+   D   ++  ++ V++
Sbjct: 28  TIHKGENISESLTDVKILKNRAGESRRFAFVGFKSEEDAFDAVNYFDQSFIDTSKIEVSM 87

Query: 201 HVSKKD 206
             S  D
Sbjct: 88  AKSFAD 93

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           + V  L   V    ++++FS  G + S+R+ +     ++ G+A+V F   +    A+EQL
Sbjct: 750 IIVKNLPFEVERKQIFELFSSFGQLKSVRLPK-KFDKSARGFAFVEFLLPKEAENAMEQL 808

Query: 100 NYTLIKGKPCRIMWSQRDP 118
               + G+   +  ++ +P
Sbjct: 809 QGVHLLGRRLVMQHAEEEP 827

>Scas_598.1
          Length = 516

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 94/180 (52%), Gaps = 24/180 (13%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEA- 185
           ++I  L+       L + FS +GN++  K+  D   G SRGFGF+ FE  S   + ++  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 186 --VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYG 243
             +DG +++ +    A+   ++D+  K          ++V  I  +   +EFEE F ++G
Sbjct: 262 HILDGKVIDPKR---AIPREEQDKTGK----------IFVGGIGPDVRPKEFEEFFAQWG 308

Query: 244 KITSA-----VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY 298
            I  A     +L+KD+ G+ RGFGF+ + D + A   V +   ++FKG+++ + RA  ++
Sbjct: 309 TIIDAQLMLLMLDKDT-GRSRGFGFITY-DSSEAVDRVCQNKYIDFKGKQIEIKRAAPRH 366

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 104/214 (48%), Gaps = 35/214 (16%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDEL 279
           +++  ++ ET++++ ++ F KYG +    + KD + G+ RGFGF+ FE     + +VDE+
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE----LSSSVDEV 257

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
                K Q +  G       ++ + K+       +K  K     +FV  +   +  ++ +
Sbjct: 258 ----VKTQHILDG-------KVIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 301

Query: 340 EEFAPFGTITSAKVM----RDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
           E FA +GTI  A++M      +TG SRGFGF+ + +  EA   + +       GK + + 
Sbjct: 302 EFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFITYDS-SEAVDRVCQNKYIDFKGKQIEIK 360

Query: 396 IAQRKEVRR--------NQLAQQIQARNQMRFQH 421
            A  + +++         Q   Q+QA  QM FQ+
Sbjct: 361 RAAPRHMQKGANNGRNPRQFQNQMQAPPQM-FQN 393

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 76/160 (47%), Gaps = 21/160 (13%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L++G L    +E  L D FS  G+V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 202 LFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFELSSSVDEVVKTQ 261

Query: 100 NYTLIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCK 156
           +  ++ GK   P R +     P   +  +G I++  + P +  K   E F+ +G I+  +
Sbjct: 262 H--ILDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 314

Query: 157 VA----TDENGVSRGFGFVHFENESDARDAIEAVDGMLMN 192
           +       + G SRGFGF+ +       D+ EAVD +  N
Sbjct: 315 LMLLMLDKDTGRSRGFGFITY-------DSSEAVDRVCQN 347

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/204 (28%), Positives = 105/204 (51%), Gaps = 28/204 (13%)

Query: 213 EVKAKFTN----VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFE 267
           +VKA  +     +++  ++ ET+++   E F KYG +    + KD + G+ RGFGF++F+
Sbjct: 120 QVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFD 179

Query: 268 DHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVK 327
               A  +VDE+     K Q +  G+       + + K+       +K  K     +FV 
Sbjct: 180 ----APSSVDEV----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVG 219

Query: 328 NLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQI 386
            L   +  ++ +E F+ +GTI  A++M D +TG SRGFGFV + +P+ A K + E   + 
Sbjct: 220 GLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAAEK-VCESRYRE 278

Query: 387 VAGKPLYVAIAQRKEVRRNQLAQQ 410
             GK + +  A+ +  ++ Q  QQ
Sbjct: 279 FKGKQIEIKRAEPRHQQK-QAGQQ 301

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 78/153 (50%), Gaps = 19/153 (12%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L + FS  G+V  +++ +D  T  S G+ +++F      P +++++
Sbjct: 132 MFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFD----APSSVDEV 187

Query: 100 NYT--LIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILS 154
             T  ++ GK   P R +     P   +  +G I++  L   +  K   E FS +G I+ 
Sbjct: 188 VKTQHILDGKVIDPKRAI-----PREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIID 242

Query: 155 CKVATDEN-GVSRGFGFVHFENESDARDAIEAV 186
            ++  D++ G SRGFGFV +    D+ DA E V
Sbjct: 243 AQLMLDKDTGRSRGFGFVTY----DSPDAAEKV 271

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 83/148 (56%), Gaps = 9/148 (6%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L + FS  G+V+ +++ RD  T  S G+ +++F D  +  + ++  
Sbjct: 165 MFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFADASSVDEVVKTQ 224

Query: 100 NYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT 159
           +  ++ GK   I   + DP+ R + +G I++  + P +  K   E FS +G+I+  ++  
Sbjct: 225 H--ILDGKV--IDPKESDPTGRARKAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLML 280

Query: 160 DEN-GVSRGFGFVHFENESDARDAIEAV 186
           D++ G SRGFGF+ +    D+ DA++ V
Sbjct: 281 DKDTGRSRGFGFITY----DSPDAVDRV 304

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 104/199 (52%), Gaps = 27/199 (13%)

Query: 212 EEVKAKFTN----VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNF 266
           ++VKA  +     +++  ++ ET+++   E F KYG +T   + +D + G+ RGFGF++F
Sbjct: 152 KQVKADLSRDINKMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSF 211

Query: 267 EDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFV 326
            D    A +VDE+     K Q +  G+       + + K+     R  K  K     +FV
Sbjct: 212 AD----ASSVDEV----VKTQHILDGK-------VIDPKESDPTGRARKAGK-----IFV 251

Query: 327 KNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQ 385
             +   +  ++ +E F+ +G+I  A++M D +TG SRGFGF+ + +P+   +    K  +
Sbjct: 252 AGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSPDAVDRVCQNKFIE 311

Query: 386 IVAGKPLYVAIAQRKEVRR 404
              GK + +  A+ ++V++
Sbjct: 312 F-KGKRIEIKRAEPRQVQK 329

>Kwal_55.21960
          Length = 597

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 92/179 (51%), Gaps = 22/179 (12%)

Query: 206 DRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS-AVLEKDSEGKLRGFGFV 264
           D++    ++      +++  ++ ET+++  ++ F KYG++T   ++  ++ G+ RGFGF+
Sbjct: 196 DQRPNKADLSRDICKMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFL 255

Query: 265 NFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNL 324
            F    A A +VDE+     K Q +  G+       + + K+       +K  K     +
Sbjct: 256 TF----AEASSVDEV----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----I 295

Query: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           FV  +   +  ++ +E F+ +GTI  A++M D +TG SRGFGF+ + TP+   +    K
Sbjct: 296 FVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCENK 354

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 94/180 (52%), Gaps = 27/180 (15%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEA- 185
           ++I  L+      +L + FS +G +   K+  D   G SRGFGF+ F   S   + ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 186 --VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYG 243
             +DG +++ +    A+   ++D+  K          ++V  I  +   +EFEE F ++G
Sbjct: 271 HILDGKVIDPKR---AIPREEQDKTGK----------IFVGGIGPDVRPKEFEEFFSQWG 317

Query: 244 KITSA--VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNE---LEFKGQKLYVGRAQKKY 298
            I  A  +L+KD+ G+ RGFGF+ ++       AVD + E   +EFKG+++ + RA+ ++
Sbjct: 318 TIIDAQLMLDKDT-GRSRGFGFITYD----TPDAVDRVCENKFIEFKGKRIEIKRAEPRH 372

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L D FS  G V+ +++ RD  T  S G+ ++ F +  +  + ++  
Sbjct: 211 MFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTFAEASSVDEVVKTQ 270

Query: 100 NYTLIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCK 156
           +  ++ GK   P R +     P   +  +G I++  + P +  K   E FS +G I+  +
Sbjct: 271 H--ILDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQ 323

Query: 157 VATDEN-GVSRGFGFVHFENESDARDAIEAV 186
           +  D++ G SRGFGF+ +    D  DA++ V
Sbjct: 324 LMLDKDTGRSRGFGFITY----DTPDAVDRV 350

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 86/164 (52%), Gaps = 22/164 (13%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDEL 279
           +++  ++ ET+++   + F KYGK+    + KD + G+ RGFGF+ FE    +A +VDE+
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFE----SASSVDEV 179

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
                K Q +  G+       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 180 ----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 223

Query: 340 EEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           E FA +GTI  A++M D +TG SRGFGF+ + TP+   K    K
Sbjct: 224 EFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDTPDAVDKVCQNK 267

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 94/182 (51%), Gaps = 21/182 (11%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARD 181
           K S  ++I  L+       L + FS +G +   K+  D   G SRGFGF+ FE+ S   +
Sbjct: 119 KDSCKMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDE 178

Query: 182 AIEA---VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
            ++    +DG +++ +    A+   ++D+  K          ++V  I  +   +EFEE 
Sbjct: 179 VVKTQHILDGKVIDPKR---AIPREEQDKTGK----------IFVGGIGPDVRPKEFEEF 225

Query: 239 FGKYGKITSA--VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
           F ++G I  A  +L+KD+ G+ RGFGF+ + D   A   V +   ++FKG+K+ + RA  
Sbjct: 226 FAQWGTIIDAQLMLDKDT-GRSRGFGFITY-DTPDAVDKVCQNKFIDFKGRKIEIKRAAP 283

Query: 297 KY 298
           ++
Sbjct: 284 RH 285

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 75/151 (49%), Gaps = 15/151 (9%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +++G L    +E  L D FS  G V  +++ +D  T  S G+ ++ F    +  + ++  
Sbjct: 124 MFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFESASSVDEVVKTQ 183

Query: 100 NYTLIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCK 156
           +  ++ GK   P R +     P   +  +G I++  + P +  K   E F+ +G I+  +
Sbjct: 184 H--ILDGKVIDPKRAI-----PREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQ 236

Query: 157 VATDEN-GVSRGFGFVHFENESDARDAIEAV 186
           +  D++ G SRGFGF+ +    D  DA++ V
Sbjct: 237 LMLDKDTGRSRGFGFITY----DTPDAVDKV 263

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 101/198 (51%), Gaps = 23/198 (11%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAVDEL 279
           +++  ++ ET++E   + F KYG +    + KD+  G+ RGFGF+ FE+    A +VDE+
Sbjct: 188 MFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN----ASSVDEV 243

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
                K Q +  G+       + + K+       +K  K     +FV  +   +  ++ +
Sbjct: 244 ----VKTQHILDGK-------VIDPKRAIPREEQDKTGK-----IFVGGIGPDVRPKEFE 287

Query: 340 EEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           E F+ +G+I  A++M D +TG SRGFGF+ + TP+   +    K  +   GK + +  A+
Sbjct: 288 EFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDTPDAVDRVCQNKFIEF-KGKQIEIKRAE 346

Query: 399 RKEVRRNQLAQQIQARNQ 416
            +++++ +  Q  Q   Q
Sbjct: 347 PRQLQKQKQPQMTQPMGQ 364

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 90/185 (48%), Gaps = 20/185 (10%)

Query: 11  QLEQLKIEEQTAPTTTESETPKVETSGAS-----LYVGELEPTVSEALLYDIFSPIGSVS 65
           QL+QL+        T     PK   +  S     +++G L    +E  L D FS  G+V+
Sbjct: 154 QLQQLQQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVA 213

Query: 66  SIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGK---PCRIMWSQRDPSLRK 122
            +++ +D  T  S G+ ++ F +  +  + ++  +  ++ GK   P R +     P   +
Sbjct: 214 EVKIMKDTATGRSRGFGFLTFENASSVDEVVKTQH--ILDGKVIDPKRAI-----PREEQ 266

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFVHFENESDARD 181
             +G I++  + P +  K   E FS +G+I+  ++  D++ G SRGFGF+ +    D  D
Sbjct: 267 DKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITY----DTPD 322

Query: 182 AIEAV 186
           A++ V
Sbjct: 323 AVDRV 327

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 295 QKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM 354
           Q+   +LQ+   Q+E   ++         +F+  L+    +E L++ F+ +G +   K+M
Sbjct: 159 QQTMSQLQQTASQHEPKAIKADLSRDINKMFIGGLNWETTEEGLRDYFSKYGAVAEVKIM 218

Query: 355 RDE-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
           +D  TG SRGFGF+ F       + +  K Q I+ GK
Sbjct: 219 KDTATGRSRGFGFLTFENASSVDEVV--KTQHILDGK 253

>Kwal_56.24709
          Length = 828

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 101/252 (40%), Gaps = 46/252 (18%)

Query: 89  HEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFST 148
           H A  + +       ++  P    WS    +      GN+Y++ +   +    L   FS 
Sbjct: 204 HWADLEVVRDSAVAALRASPIVSKWSVSVNAHALTHPGNLYVRGIPKDLTIDDLVPVFSK 263

Query: 149 FGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR 207
           FG +LS K+  D  +G S G+GF+ +   S A   I+ ++G LMN   +++  HV +K+R
Sbjct: 264 FGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSALFINYHVERKER 323

Query: 208 QS------KLEEVKAKFTNVYVKN----------IDQETSQEEFEELFGKYGK----ITS 247
           +       K +    +F  V++ N          +  E    +F++     G+    I S
Sbjct: 324 ERIHWDHFKEDNDDDRFKGVFIGNLPTNHPDGSLVTPEHVIAKFQDQLRSKGEQPVHIVS 383

Query: 248 -------------------------AVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNEL 282
                                      + K  E  L+G+GF+ F  H  A  A+D  N  
Sbjct: 384 YYLPKRNSESDIEYRDDDDKTDDIETCISKHEESPLKGYGFIKFVSHDQALTAIDLFNNF 443

Query: 283 EFKGQKLYVGRA 294
           E+ G KL V +A
Sbjct: 444 EWLGNKLVVNKA 455

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (50%), Gaps = 22/102 (21%)

Query: 320 QGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM-------------------RDETGN 360
           Q  NL+VK+L  S  DE   + +  FG I SAK++                       G+
Sbjct: 608 QESNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGS 667

Query: 361 SRGFGFVCFSTPEEATKA--ITEKNQQIVAGKPLYVAIAQRK 400
           S+G+GFVCF  P +A++A  IT++  Q+     LYV+ AQ++
Sbjct: 668 SKGYGFVCFKNPLDASRAMMITDR-YQVDENHTLYVSFAQKR 708

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITE 381
           NL+V+ +   +  + L   F+ FG + S K++ D  +G+S G+GF+ +    +A++ I E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 382 KNQQIVAGKPLYVAI-AQRKEVRR 404
            N  ++ G  L++    +RKE  R
Sbjct: 302 LNGNLMNGSALFINYHVERKERER 325

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDE 278
           N+YV+ I ++ + ++   +F K+G + S  +  DS  G   G+GF+++   + A++ + E
Sbjct: 242 NLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPLGSQASRCIKE 301

Query: 279 LNELEFKGQKLYVGRAQKKYER 300
           LN     G  L++    ++ ER
Sbjct: 302 LNGNLMNGSALFINYHVERKER 323

 Score = 35.8 bits (81), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 22/103 (21%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT---DEN----------------GVSRG 167
           N+Y+K+L  +  ++   + +  FG I+S K+ T    +N                G S+G
Sbjct: 611 NLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKG 670

Query: 168 FGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK 210
           +GFV F+N  DA  A+   D   +++      L+VS   +++K
Sbjct: 671 YGFVCFKNPLDASRAMMITDRYQVDENHT---LYVSFAQKRAK 710

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 20/99 (20%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVL----------------EKDSE---GKLR 259
           +N+YVK++      E+F + +  +G+I SA +                 K SE   G  +
Sbjct: 610 SNLYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSK 669

Query: 260 GFGFVNFEDHAAAAKAVDELNELEF-KGQKLYVGRAQKK 297
           G+GFV F++   A++A+   +  +  +   LYV  AQK+
Sbjct: 670 GYGFVCFKNPLDASRAMMITDRYQVDENHTLYVSFAQKR 708

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 89/171 (52%), Gaps = 7/171 (4%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENG------VSRGFGFVHFENESDAR 180
           +I+IKNL+    ++ L + F  F   +  +V T  +       +S GFGFV F  +  A 
Sbjct: 641 SIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKEQAT 700

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
             I A+DG +++  ++ + L   + +  S+ E+ KAK   + VKN+  E ++++  ELF 
Sbjct: 701 AVISAMDGTVIDGHKIQLKLSHRQGNAGSQ-EKKKAKNGKIIVKNLPFEATRKDVFELFN 759

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
            +G++ S  + K  +   RGF FV F     A  A+D+L  +   G++L +
Sbjct: 760 SFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVM 810

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 51/84 (60%), Gaps = 2/84 (2%)

Query: 316 LAKYQGV-NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPE 373
           +AK Q    LF++N+  S  ++  K+ F+P+G +    V  D  TGNS+GF +V F+ PE
Sbjct: 318 IAKIQKTGRLFLRNILYSSTEDDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPE 377

Query: 374 EATKAITEKNQQIVAGKPLYVAIA 397
           EA +A  E ++QI  G+ L++  A
Sbjct: 378 EAVQAYIELDKQIFQGRLLHILAA 401

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 100/451 (22%), Positives = 175/451 (38%), Gaps = 66/451 (14%)

Query: 2   SDITDKTAEQLEQLKIEEQTAPTTTESE--TPKVETSGASLYVGELEPTVSEALLYDIFS 59
           +++ DK +E+  Q    E+      + E    K++ +G  L++  +  + +E     +FS
Sbjct: 288 TNVQDKESEENSQATPAEELQEEIPDEEQAIAKIQKTG-RLFLRNILYSSTEDDFKKLFS 346

Query: 60  PIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQ--RD 117
           P G +  + V  D  T  S G+AYV F   E   +A  +L+  + +G+   I+ +   +D
Sbjct: 347 PYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHILAADEMKD 406

Query: 118 PSLRKKGSGNIYIKNLHP-AIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENE 176
             L +    N+ +K          +   TFS   N L          V+   G V   + 
Sbjct: 407 HRLDEFDLKNMPLKKQRELKKKAAASKATFS--WNSLYMNQDAVLGSVAAKLG-VQKADL 463

Query: 177 SDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTN-----------VYVKN 225
            D  ++  AV   L    E +V   V K      ++    KF+N           + VKN
Sbjct: 464 IDPENSNSAVKQALA---EAHVIGDVRKYFETKGVD--LTKFSNLKSPSQRDDRVILVKN 518

Query: 226 IDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFK 285
               T++EE  ELF  +GK+   ++             V F D A+   A  +L    FK
Sbjct: 519 FPFGTTREELGELFVPFGKLERLLMPPAG-----TIAIVQFRDIASGRSAFSKLAFKRFK 573

Query: 286 GQKLYVGRAQKK------------------------------YERLQELKKQYEAARLEK 315
           G  +Y+ +  K                                E +   K + +    E+
Sbjct: 574 GTVIYLEKGPKDCFTKAASNEDAMEHDEEKSAKEAGPSSADLLESVSSKKTEDKEDEDEQ 633

Query: 316 LAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN------SRGFGFVCF 369
           +     V++F+KNL+     ++L + F  F     A+V             S GFGFV F
Sbjct: 634 VVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEF 693

Query: 370 STPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
            T E+AT  I+  +  ++ G  + + ++ R+
Sbjct: 694 RTKEQATAVISAMDGTVIDGHKIQLKLSHRQ 724

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 21/188 (11%)

Query: 202 VSKKDRQSKLEE----VKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK 257
           VS K  + K +E    V     ++++KN++ +T+ ++  + F  +     A ++   + K
Sbjct: 619 VSSKKTEDKEDEDEQVVDGPTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPK 678

Query: 258 LR------GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAA 311
            +      GFGFV F     A   +  ++     G K+          +L+   +Q  A 
Sbjct: 679 QKNKVLSMGFGFVEFRTKEQATAVISAMDGTVIDGHKI----------QLKLSHRQGNAG 728

Query: 312 RLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFST 371
             EK     G  + VKNL      + + E F  FG + S +V +    ++RGF FV F  
Sbjct: 729 SQEKKKAKNG-KIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFVL 787

Query: 372 PEEATKAI 379
           P+EA  A+
Sbjct: 788 PKEAENAM 795

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 141 SLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200
           + H T +  G I   ++  +  G SR F F+ ++NE DA DA+   DG  +   ++ V +
Sbjct: 28  TTHATSNVDGLITDLRILKNREGKSRRFAFIGYKNEQDALDAVNYFDGSFIYTSKIEVDM 87

Query: 201 HVSKKD 206
             S  D
Sbjct: 88  AKSFAD 93

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 86/185 (46%), Gaps = 3/185 (1%)

Query: 212 EEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
           E++   + N +++ N+  + + E+  + FG+ G++  A +   S G+ RG G V F    
Sbjct: 111 EKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRHRGMGTVEFTSPE 169

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAAR-LEKLAKYQGVNLFVKNL 329
               A+ + N +EF G+ L+V +     E ++ L    E         +     +F+ NL
Sbjct: 170 GVDNAIRDFNGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNL 229

Query: 330 DDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAG 389
             S+  + LK+ F   G +  A +  D  G SRGFG V + T EE   AI   N   V G
Sbjct: 230 PYSMTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDG 289

Query: 390 KPLYV 394
           + L V
Sbjct: 290 RILQV 294

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 120/305 (39%), Gaps = 55/305 (18%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSL--GYAYVNFHDHEAGPKAI 96
           S+++G L    +   L+D F   G V  +R   D IT+     G   V F   E    AI
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEV--LRA--DIITSRGRHRGMGTVEFTSPEGVDNAI 175

Query: 97  EQLNYTLIKGKPCRIMWSQRD----------PSLRKKGSG----------NIYIKNLHPA 136
              N     G+P   ++ ++D          P +R++ +            ++I NL  +
Sbjct: 176 RDFNGVEFMGRP---LFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYS 232

Query: 137 IDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA-----VDGMLM 191
           +  ++L + F   G+++   +  D NG SRGFG V +  + +  +AIE      VDG ++
Sbjct: 233 MTWQTLKDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRIL 292

Query: 192 NDQE-----------------VYVALHVSKKDRQSKLEEVKA----KFTNVYVKNIDQET 230
             +E                     + +      S+  E       + T +Y  N+   T
Sbjct: 293 QVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTT 352

Query: 231 SQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLY 290
           +  +  +LF   G++  A L+ D  G   G   + +E+   A   +  LN   + G  L 
Sbjct: 353 ATGDLYDLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLD 412

Query: 291 VGRAQ 295
           +  A+
Sbjct: 413 ISYAK 417

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 60/299 (20%), Positives = 114/299 (38%), Gaps = 28/299 (9%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAV 186
           +I+I NL      + LH+ F   G +L   + T   G  RG G V F +     +AI   
Sbjct: 120 SIFIGNLSFDATPEDLHDFFGQAGEVLRADIIT-SRGRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 187 DGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTN-----------VYVKNIDQETSQEEF 235
           +G+    + ++V       +    L  ++ +F +           V++ N+    + +  
Sbjct: 179 NGVEFMGRPLFVRQDNPPPEPMESLPPMRERFNDYPPEGRPPMFEVFIVNLPYSMTWQTL 238

Query: 236 EELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV---- 291
           ++LF + G +  A +E D  G  RGFG V +        A++  N  +  G+ L V    
Sbjct: 239 KDLFREAGDVIRADIELDRNGFSRGFGTVFYGTQEEMFNAIERFNGFDVDGRILQVREGK 298

Query: 292 ---GRAQKKYERLQELKKQYEAARLEKLAKY---------QGVNLFVKNLDDSIDDEKLK 339
              G            +++ E       +++         +   ++  NL  +     L 
Sbjct: 299 NSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENVVGGGERSTLIYCSNLPLTTATGDLY 358

Query: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           + F   G +  A++  DE+G   G   + +   E+A   I   N     G  L ++ A+
Sbjct: 359 DLFETIGRVRHAELKFDESGAPTGIAVIEYENVEDADFCIQRLNNYNYGGCDLDISYAK 417

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 302 QELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNS 361
           +E++  YE    EK+ +    ++F+ NL      E L + F   G +  A ++    G  
Sbjct: 103 REMEPPYE----EKIDRNYDNSIFIGNLSFDATPEDLHDFFGQAGEVLRADIITSR-GRH 157

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           RG G V F++PE    AI + N     G+PL+V
Sbjct: 158 RGMGTVEFTSPEGVDNAIRDFNGVEFMGRPLFV 190

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 83/175 (47%), Gaps = 3/175 (1%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL 279
           +V++ N+  +T+ E+  +LFG+ G +  A +   S G  RG G V + +     +A+   
Sbjct: 8   SVFIGNLTYDTTPEDLRQLFGEVGHVVRADI-ITSRGHHRGMGTVEYTNAQDVDEAIRRF 66

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
           N ++F  ++L+V R       + E +++     L +     G  +FV NL  SI  + LK
Sbjct: 67  NGMDFMHRELFVRRDNPP--PVGERRERRGPGPLPRRTHPGGFEIFVANLPYSISWQTLK 124

Query: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           + F     +  A V  D  G SRGFG V  +T E    AI   N   + G+ L V
Sbjct: 125 DMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEGRILEV 179

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 80/185 (43%), Gaps = 19/185 (10%)

Query: 120 LRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDA 179
           + +  S +++I NL      + L + F   G+++   + T   G  RG G V + N  D 
Sbjct: 1   MSRNYSNSVFIGNLTYDTTPEDLRQLFGEVGHVVRADIITSR-GHHRGMGTVEYTNAQDV 59

Query: 180 RDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT-------------NVYVKNI 226
            +AI   +GM    +E++V     ++D    + E + +                ++V N+
Sbjct: 60  DEAIRRFNGMDFMHRELFV-----RRDNPPPVGERRERRGPGPLPRRTHPGGFEIFVANL 114

Query: 227 DQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKG 286
               S +  +++F +  ++  A +  D++G  RGFG V          A++  N  E +G
Sbjct: 115 PYSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRENQIAAIERWNGYELEG 174

Query: 287 QKLYV 291
           + L V
Sbjct: 175 RILEV 179

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 97/258 (37%), Gaps = 29/258 (11%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91
           +    G  ++V  L  ++S   L D+F     V    V  DA    S G+  V     E 
Sbjct: 101 RTHPGGFEIFVANLPYSISWQTLKDMFKECSEVIHADVSVDA-DGYSRGFGTVYVTTREN 159

Query: 92  GPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGN 151
              AIE+ N   ++G+   +    +   +   G G+ Y+    P+ D           G 
Sbjct: 160 QIAAIERWNGYELEGRILEVR-EGKGTDVGSAGRGDSYVPKQIPSYDYD---------GE 209

Query: 152 ILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKL 211
               +V  +           H EN S       +V G    + E Y     S  +  SK 
Sbjct: 210 YRGTEVRAE---------LPHSENAS------VSVSGKASPEYEQYTP---SDVEFTSKA 251

Query: 212 EEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAA 271
               AK   +Y +N+   T++ +  +LF   GK+  A L+ DSEG   G     FE  A 
Sbjct: 252 APGGAKNRIIYCENMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVAD 311

Query: 272 AAKAVDELNELEFKGQKL 289
           A + ++ LN   + G  L
Sbjct: 312 AQECIERLNNYHYGGCDL 329

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%)

Query: 118 PSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENES 177
           P     G   I++ NL  +I  ++L + F     ++   V+ D +G SRGFG V+     
Sbjct: 99  PRRTHPGGFEIFVANLPYSISWQTLKDMFKECSEVIHADVSVDADGYSRGFGTVYVTTRE 158

Query: 178 DARDAIEAVDG 188
           +   AIE  +G
Sbjct: 159 NQIAAIERWNG 169

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/317 (21%), Positives = 140/317 (44%), Gaps = 60/317 (18%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVS-SIRVCRDAITNTSLGYAYVNFHDHEAG 92
           +TS   LY+G+L+P+ +E  +  I++ +G  +  +++ +++    + GY +V F  + A 
Sbjct: 48  DTSSTQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAA 107

Query: 93  PKAIEQ--LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETF-STF 149
             A+ +  L   +   +  ++ W+    +   + S  I++ +L P +    L E F S +
Sbjct: 108 TNALLKTGLPIPVDASRTLKLNWASFATTPGSEFS--IFVGDLAPNVTESQLFELFISRY 165

Query: 150 GNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR- 207
            + L+ K+  D+  GVS+G+GFV F NE++ + ++  + G+ +N + + V+     K R 
Sbjct: 166 SSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSRF 225

Query: 208 -----------------------------QSKLEEVKAKF----------------TNVY 222
                                        Q+ L++ +  +                T V+
Sbjct: 226 QSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTVF 285

Query: 223 VKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNEL 282
           +  +    +++E    F  +G+I   V  K   GK  G GFV + D ++A  A+ ++   
Sbjct: 286 IGGLSSLVTEDELRAYFQPFGQI---VYVKIPVGK--GCGFVQYVDRSSAENAIAKMQGF 340

Query: 283 EFKGQ--KLYVGRAQKK 297
                  +L  GR+ K+
Sbjct: 341 PIGNSRVRLSWGRSAKQ 357

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/297 (18%), Positives = 110/297 (37%), Gaps = 51/297 (17%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFG--NILSCKVATDENGVSRGFGFVHFENESDARDA 182
           S  +Y+ +L P+     + + ++T G  N+    +     G + G+ FV F +       
Sbjct: 51  STQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSN------ 104

Query: 183 IEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELF-GK 241
           + A + +L     + V    + K   +          +++V ++    ++ +  ELF  +
Sbjct: 105 LAATNALLKTGLPIPVDASRTLKLNWASFATTPGSEFSIFVGDLAPNVTESQLFELFISR 164

Query: 242 YGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYER 300
           Y    +A +  D   G  +G+GFV F + A   +++ E+  +   G+ + V    K   R
Sbjct: 165 YSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRVSTTSKNKSR 224

Query: 301 LQE-----------------------------LKKQY-------EAARLEKLAKYQGVNL 324
            Q                              L +Q        +   L + A      +
Sbjct: 225 FQSGNPASAAPASPASTAVNSPGLAQGSNVQTLLQQSQFIYPVQQQPALSQFADPNNTTV 284

Query: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITE 381
           F+  L   + +++L+  F PFG I   K+        +G GFV +     A  AI +
Sbjct: 285 FIGGLSSLVTEDELRAYFQPFGQIVYVKIPVG-----KGCGFVQYVDRSSAENAIAK 336

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 91/189 (48%), Gaps = 20/189 (10%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGK--ITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAV 276
           T +Y+ ++D   ++ + ++++   G+  +   +++  S G   G+ FV F  + AA    
Sbjct: 52  TQLYMGDLDPSWTEGDIKQIWATLGEANVQVKLIKNSSGGGNSGYCFVEFPSNLAAT--- 108

Query: 277 DELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDE 336
              N L   G  + V       +  + LK  + +      +++   ++FV +L  ++ + 
Sbjct: 109 ---NALLKTGLPIPV-------DASRTLKLNWASFATTPGSEF---SIFVGDLAPNVTES 155

Query: 337 KLKEEF-APFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           +L E F + + +  +AK++ D+ TG S+G+GFV F    E  +++ E     + G+ + V
Sbjct: 156 QLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLEMQGVFLNGRAIRV 215

Query: 395 AIAQRKEVR 403
           +   + + R
Sbjct: 216 STTSKNKSR 224

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 95/187 (50%), Gaps = 8/187 (4%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           ++V++I  + + EEF + F ++  I  +V+ KDSE + RGFGFV+F       +A+ +  
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 281 ELEFKGQKLYVG------RAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSID 334
           + +FK + L +       R+++   R +   K Y+ +  E+L K +   L ++N+  S  
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKP-KLIIRNMPWSCR 146

Query: 335 DEK-LKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
           D   LK+ F+ FGT+  AK+ +   G   GF FV         +AI E     + G+ + 
Sbjct: 147 DAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQVA 206

Query: 394 VAIAQRK 400
           +  A +K
Sbjct: 207 IDFAIQK 213

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 87/186 (46%), Gaps = 28/186 (15%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++++    +++   + FS F  I    +  D    SRGFGFV F  E D ++A+    
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEF------------ 235
                ++   + + ++K+  +SK  E + +  +   K    E+++EE             
Sbjct: 88  KAKFKNR--LLRIDIAKRRERSKRNEPRQESEHKSYK----ESNEEELMKGKPKLIIRNM 141

Query: 236 ----------EELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFK 285
                     ++LF ++G +  A + K + GKL GF FV  +  +A  +A++E  +++  
Sbjct: 142 PWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKID 201

Query: 286 GQKLYV 291
           G+++ +
Sbjct: 202 GRQVAI 207

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 78/366 (21%), Positives = 149/366 (40%), Gaps = 61/366 (16%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+V  +    ++    D FS    +    + +D+    S G+ +V+F   +   +A+ Q
Sbjct: 27  TLFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDS-EKQSRGFGFVSFAVEDDTKEALAQ 85

Query: 99  LNYTLIKGKPCRI-MWSQRDPSLRK--------------------KGSGNIYIKNLHPAI 137
                 K +  RI +  +R+ S R                     KG   + I+N+  + 
Sbjct: 86  ARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRNMPWSC 145

Query: 138 -DNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEV 196
            D   L + FS FG ++  K+     G   GF FV  +  S  + AIE    M ++ ++V
Sbjct: 146 RDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKIDGRQV 205

Query: 197 YV--ALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS 254
            +  A+  +K +   K++E +           DQE+  E+ +        +     EK+ 
Sbjct: 206 AIDFAIQKNKWEEHKKVQEPE-----------DQES--EDADNADDGDDDVDIDNDEKEE 252

Query: 255 EGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLE 314
           +  L      N +D   +++  +  +E+E               E ++E + +      +
Sbjct: 253 KDNLE-----NSDDDEESSQQGESEDEVELNSD-----------EEVEEPQPR------Q 290

Query: 315 KLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSA-KVMRDETGNSRGFGFVCFSTPE 373
           K  K +  ++FV+N+      E L+  F  FG +  A  V+  ETG ++G  FV F T E
Sbjct: 291 KKNKQESFSIFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFKTEE 350

Query: 374 EATKAI 379
             ++ +
Sbjct: 351 AFSECV 356

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+++    +DE+  + F+ F  I  + +++D    SRGFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQAR 87

Query: 384 QQIVAGKPLYVAIAQRKE-VRRNQLAQQ 410
           +     + L + IA+R+E  +RN+  Q+
Sbjct: 88  KAKFKNRLLRIDIAKRRERSKRNEPRQE 115

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 11/90 (12%)

Query: 190 LMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSA- 248
           L +D+EV       KK++Q           +++V+N+  + +QE  E  FGK+G +  A 
Sbjct: 277 LNSDEEVEEPQPRQKKNKQESF--------SIFVRNVPYDATQESLESHFGKFGPVKYAL 328

Query: 249 -VLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
            VL+K++ G  +G  FV F+   A ++ VD
Sbjct: 329 PVLDKET-GLAKGTAFVAFKTEEAFSECVD 357

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 256 GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG 292
           G+ RG+GFV + DH AA   +  LN  E   Q++  G
Sbjct: 558 GRSRGYGFVEYRDHKAALMGLRWLNAHEVTRQEILEG 594

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 92/181 (50%), Gaps = 26/181 (14%)

Query: 208 QSKLEEVKAKFTN----VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFG 262
           Q+K E  KA  +     +++  ++ +T+++   E FGKYG +T   + KD + G+ RGFG
Sbjct: 144 QTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFG 203

Query: 263 FVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV 322
           F++FE       +VDE+     K Q +  G       ++ + K+       +K  K    
Sbjct: 204 FLSFE----KPSSVDEV----VKTQHILDG-------KVIDPKRAIPRDEQDKTGK---- 244

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITE 381
            +FV  +   +  ++ +E F+ +GTI  A++M D +TG SRGFGFV + + +   +    
Sbjct: 245 -IFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQN 303

Query: 382 K 382
           K
Sbjct: 304 K 304

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 88/171 (51%), Gaps = 21/171 (12%)

Query: 24  TTTESETPKVETSGAS--LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGY 81
           T T+ E  K + S  S  +++G L    +E  L + F   G+V+ +++ +D  T  S G+
Sbjct: 143 TQTKEERSKADLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGF 202

Query: 82  AYVNFHDHEAGPKAIEQLNYT--LIKGK---PCRIMWSQRDPSLRKKGSGNIYIKNLHPA 136
            +++F      P +++++  T  ++ GK   P R +     P   +  +G I++  + P 
Sbjct: 203 GFLSFEK----PSSVDEVVKTQHILDGKVIDPKRAI-----PRDEQDKTGKIFVGGIGPD 253

Query: 137 IDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFVHFENESDARDAIEAV 186
           +  K   E FS +G I+  ++  D++ G SRGFGFV +    D+ DA++ V
Sbjct: 254 VRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY----DSADAVDRV 300

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/313 (23%), Positives = 126/313 (40%), Gaps = 73/313 (23%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++++   + ++ L + FS F  I    V  D N  SRGFGFV F  E D ++A+    
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT---------------------------- 219
               N   + V +   ++DR  K  EV  K T                            
Sbjct: 88  KTKFNGHILRVDI-AKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 220 -NVYVKNIDQETSQE-EFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
             + ++N+        + +++FG+YG +  A + +  +GKL GF FV  +  +    A++
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 278 ELNELEFKGQKLYVGRAQKKYERLQELKK------------------------------- 306
              +L+  G+K+ V  A +K  R ++ KK                               
Sbjct: 207 NTKDLKIDGRKVAVDFAVQK-NRWEDYKKAQPEMNDKDDNESGNEDAEENHDDEEDENEE 265

Query: 307 ---QYEAARLEKLAKYQGVN------LFVKNLDDSIDDEKLKEEFAPFGTITSA-KVMRD 356
              Q + A   K +K +  N      +FV+N+     +E L   F+ FG++  A  V+  
Sbjct: 266 EDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATEESLAPHFSKFGSVKYALPVIDK 325

Query: 357 ETGNSRGFGFVCF 369
            TG ++G  FV F
Sbjct: 326 STGLAKGTAFVAF 338

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 88/200 (44%), Gaps = 21/200 (10%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           ++V++I Q+ + E+  + F  +  I  AV+ KD+  + RGFGFV+F       +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVN----------------- 323
           + +F G  L V  A K+ +R ++  +  E +  E   K  G N                 
Sbjct: 88  KTKFNGHILRVDIA-KRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGEDSMLKGK 146

Query: 324 --LFVKNLDDSIDDE-KLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAIT 380
             L ++N+  S  D  KLK+ F  +GT+  A + R   G   GF FV          A+ 
Sbjct: 147 PKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKISNCRIALE 206

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
                 + G+ + V  A +K
Sbjct: 207 NTKDLKIDGRKVAVDFAVQK 226

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 46/78 (58%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+++   + DE+L + F+ F  I  A V++D    SRGFGFV F+  ++  +A+ +  
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKRSRGFGFVSFAVEDDTKEALAKAR 87

Query: 384 QQIVAGKPLYVAIAQRKE 401
           +    G  L V IA+R++
Sbjct: 88  KTKFNGHILRVDIAKRRD 105

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/339 (20%), Positives = 121/339 (35%), Gaps = 88/339 (25%)

Query: 17  IEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITN 76
           IE    P++  S+         +L+V  +   V++  L D FS    +    V +D    
Sbjct: 5   IENVEVPSSNVSKQNDDGLDMKTLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NK 63

Query: 77  TSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRK-------------- 122
            S G+ +V+F   +   +A+ +   T   G   R+  ++R    +K              
Sbjct: 64  RSRGFGFVSFAVEDDTKEALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSE 123

Query: 123 --------------------KGSGNIYIKNLHPAI-DNKSLHETFSTFGNILSCKVATDE 161
                               KG   + I+N+  +  D   L + F  +G ++   +    
Sbjct: 124 KITGQNNEDEDDADGEDSMLKGKPKLIIRNMPWSCRDPVKLKKIFGRYGTVVEATIPRKR 183

Query: 162 NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKK---------------- 205
           +G   GF FV  +  S+ R A+E    + ++ ++V V   V K                 
Sbjct: 184 DGKLCGFAFVTMKKISNCRIALENTKDLKIDGRKVAVDFAVQKNRWEDYKKAQPEMNDKD 243

Query: 206 ---------------------------DRQSKLEEVKAKFTN------VYVKNIDQETSQ 232
                                      D+ SK +E K K  N      V+V+N+  + ++
Sbjct: 244 DNESGNEDAEENHDDEEDENEEEDRQVDQASKNKESKRKAQNKREDFSVFVRNVPYDATE 303

Query: 233 EEFEELFGKYGKITSA--VLEKDSEGKLRGFGFVNFEDH 269
           E     F K+G +  A  V++K S G  +G  FV F+D 
Sbjct: 304 ESLAPHFSKFGSVKYALPVIDK-STGLAKGTAFVAFKDQ 341

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 15/25 (60%)

Query: 256 GKLRGFGFVNFEDHAAAAKAVDELN 280
           G+ RG+GFV F DH  A   +  LN
Sbjct: 550 GRSRGYGFVEFRDHKNALMGLRWLN 574

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 91/173 (52%), Gaps = 9/173 (5%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN------GVSRGFGFVHFENESDAR 180
           +I+IKNL+ +  N++L + F  F   +  +V T  +       +S GFGFV F  +  A 
Sbjct: 664 SIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQAN 723

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKA--KFTNVYVKNIDQETSQEEFEEL 238
             I A+DG +++  ++ + L   ++  QS   + K+  K   + VKN+  E ++++  EL
Sbjct: 724 AVIAAMDGTVIDGHKIQLKLS-HRQASQSGNTKTKSNKKSGKIIVKNLPFEATRKDVFEL 782

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
           F  +G++ S  + K  +   RGF FV F     A  A+D+L+ +   G++L +
Sbjct: 783 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRLVM 835

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 103/442 (23%), Positives = 170/442 (38%), Gaps = 79/442 (17%)

Query: 19  EQTAPTTTESETP--KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITN 76
           E+  P  T+ E    K+  +G  L++  +  T  E     +FSP G +  + V  D  T 
Sbjct: 325 ERAVPQKTDEELAIEKINQTG-RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTG 383

Query: 77  TSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPA 136
            S G+AYV F D +    A  +L+  + +G+   I+  +   S R        +KN+ P 
Sbjct: 384 QSKGFAYVLFKDSKNAVNAYVELDKQIFQGRLLHILPGEEKKSHR---LDEFDLKNM-PL 439

Query: 137 IDNKSL-------HETFSTFGNILSCKVATDENGVSRGFG-----FVHFENESDA-RDAI 183
              K L        +TFS   N L          V+   G      +  EN S A + A+
Sbjct: 440 KKQKELKRKAAASRQTFS--WNSLYMNQDAVLGSVAAKLGLEKSQLIDAENSSSAVKQAL 497

Query: 184 EAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTN------VYVKNIDQETSQEEFEE 237
              +  ++ D   Y     SK    +K  ++K+  TN      + VKN    T++EE  E
Sbjct: 498 --AEAHVIGDVRKYFE---SKGVDLTKFSQLKS--TNQRDDKVILVKNFPFGTTREELGE 550

Query: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
           +F  YGK+   ++             V F D  +A  A  +L+   FK   +Y+ R  K 
Sbjct: 551 MFLPYGKLERLLMPPAG-----TIAIVQFRDTTSARAAFTKLSYKRFKDGIIYLERGPKD 605

Query: 298 ---------------------------------YERLQELKKQYEAARLEKLAKYQGVNL 324
                                             E  +++ +    A  E +     V++
Sbjct: 606 CFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDVTEGSSNAHDEDVIDGPTVSI 665

Query: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN------SRGFGFVCFSTPEEATKA 378
           F+KNL+ S  ++ L + F  F     A+V             S GFGFV F T E+A   
Sbjct: 666 FIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQANAV 725

Query: 379 ITEKNQQIVAGKPLYVAIAQRK 400
           I   +  ++ G  + + ++ R+
Sbjct: 726 IAAMDGTVIDGHKIQLKLSHRQ 747

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 7/119 (5%)

Query: 78  SLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPS-------LRKKGSGNIYI 130
           S+G+ +V F   E     I  ++ T+I G   ++  S R  S          K SG I +
Sbjct: 708 SMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKTKSNKKSGKIIV 767

Query: 131 KNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
           KNL      K + E F++FG + S +V    +  +RGF FV F    +A +A++ + G+
Sbjct: 768 KNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGV 826

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 11/102 (10%)

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVA 158
           ++  ++KG P  +     D +LR+  +  +  K+ H A++        S    I   K+ 
Sbjct: 1   MSRIIVKGLPVYLT----DDNLREHFTKRLRQKHSHQAVNG-------SGPDLITDVKIL 49

Query: 159 TDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200
            D NG SR FGF+ + NE DA DA+E  +G  +N  ++ V++
Sbjct: 50  RDRNGESRRFGFIGYRNEEDAFDAVEYFNGSFINTSKIEVSM 91

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF++N+  +  +E  ++ F+PFG +    V  D  TG S+GF +V F   + A  A  E 
Sbjct: 347 LFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVEL 406

Query: 383 NQQIVAGKPLYVAIAQRKEVRR 404
           ++QI  G+ L++   + K+  R
Sbjct: 407 DKQIFQGRLLHILPGEEKKSHR 428

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 81/182 (44%), Gaps = 15/182 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKY-GKITSAVLEK---DSEGKL--RGFGFVNFEDHAAA 272
            ++++KN++  T+ +   + F  + G + + V  K     +GK    GFGFV F     A
Sbjct: 663 VSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQGKTLSMGFGFVEFRTKEQA 722

Query: 273 AKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDS 332
              +  ++     G K+ +  + ++  +    K         K  K  G  + VKNL   
Sbjct: 723 NAVIAAMDGTVIDGHKIQLKLSHRQASQSGNTKT--------KSNKKSG-KIIVKNLPFE 773

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
              + + E F  FG + S +V +    ++RGF FV F  P+EA  A+ + +   + G+ L
Sbjct: 774 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLHGVHLLGRRL 833

Query: 393 YV 394
            +
Sbjct: 834 VM 835

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 324 LFVKNLDDSIDDEKLKEEF-----------APFGT----ITSAKVMRDETGNSRGFGFVC 368
           + VK L   + D+ L+E F           A  G+    IT  K++RD  G SR FGF+ 
Sbjct: 4   IIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFGFIG 63

Query: 369 FSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           +   E+A  A+   N   +    + V++A+
Sbjct: 64  YRNEEDAFDAVEYFNGSFINTSKIEVSMAK 93

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 96/424 (22%), Positives = 172/424 (40%), Gaps = 62/424 (14%)

Query: 24  TTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAY 83
           +  E+   K+  +G  L++  +    +E     +FSP G +  + V  D  T  S G+AY
Sbjct: 288 SAEEAALTKIRATG-RLFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAY 346

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGS--GNIYIKNLHPAIDNKS 141
           V F D E    A  +L+  + +G+   I+     P+  KK        +KNL P    + 
Sbjct: 347 VLFKDPEHAANAYIELDKQIFQGRLLHIL-----PADAKKTHRLDEFDLKNL-PLKKQRE 400

Query: 142 L-------HETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE--AVDGMLMN 192
           L        +TFS     ++            G       +  ++  A++    +  ++ 
Sbjct: 401 LKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSAVKQALAEAHVIG 460

Query: 193 DQEVYV---ALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAV 249
           D   Y     + +++ ++  K+ E   +   + VKN    T++EE  ELF  +GKI   +
Sbjct: 461 DVRKYFEARGVDLTQFEKFKKVTERDDRI--ILVKNFPHGTTREELAELFLPFGKIERML 518

Query: 250 LEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY----------- 298
           +             + + D  AA  A  +L+   FK   LY+ +  K             
Sbjct: 519 MPPSG-----TIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPRGDELL 573

Query: 299 ------ERLQELKKQYEAARLEKLAKYQG----------VNLFVKNLDDSIDDEKLKEEF 342
                 E ++E+KK  E   ++  +K             V++FVKNL+ S    +L E+F
Sbjct: 574 EGDAAPEDVKEIKKSVEDV-MDADSKTPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKF 632

Query: 343 APFGTITSAKV-MRDETGN-----SRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
            PF     A+V  + +  N     S GFGF+ F T E+A   I   +  ++ G  + + I
Sbjct: 633 KPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKI 692

Query: 397 AQRK 400
           + ++
Sbjct: 693 SHKQ 696

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 93/184 (50%), Gaps = 7/184 (3%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT------DENGVSRGFGFVHFENESDAR 180
           +I++KNL+ +  +  L E F  F   +  +V T       +  +S GFGF+ F  +  A 
Sbjct: 613 SIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAG 672

Query: 181 DAIEAVDGMLMNDQEVYVAL-HVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELF 239
             I A+DG +++  ++ + + H      ++     K     + VKN+  E ++++  ELF
Sbjct: 673 AVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKNLPFEATRKDVFELF 732

Query: 240 GKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYE 299
             +G++ S  + K  +   RGF FV F   + A  A+D+L  +   G++L +  A+++ +
Sbjct: 733 SSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESD 792

Query: 300 RLQE 303
            ++E
Sbjct: 793 DVEE 796

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 12/177 (6%)

Query: 25  TTESETPKVETSGASLYVGELEPTVSEALLYDIFSP-----IGSVSSIRVCRDAITNTSL 79
           T  SE   ++    S++V  L  + + A L + F P     +  V +    +++    S+
Sbjct: 599 TPSSEATAIDGPTVSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSM 658

Query: 80  GYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRK-------KGSGNIYIKN 132
           G+ ++ F   E     I  ++  +I G   ++  S +  SL K       K SG I +KN
Sbjct: 659 GFGFIEFRTKEQAGAVIAAMDGAVIDGHKIQLKISHKQSSLPKTSKGSKKKISGKIIVKN 718

Query: 133 LHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
           L      K + E FS+FG + S +V    +  +RGF FV F   S+A +A++ + G+
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGV 775

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 1/82 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF++N+     +E  K+ F+P+G +    V  D  TG S+GF +V F  PE A  A  E 
Sbjct: 303 LFLRNILYDATEEDFKQLFSPYGELEEVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIEL 362

Query: 383 NQQIVAGKPLYVAIAQRKEVRR 404
           ++QI  G+ L++  A  K+  R
Sbjct: 363 DKQIFQGRLLHILPADAKKTHR 384

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 85/191 (44%), Gaps = 23/191 (12%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLE-----KDSEGKLR-GFGFVNFEDHAAA 272
            +++VKN++  T+  +  E F  +     A ++     K+S+ KL  GFGF+ F     A
Sbjct: 612 VSIFVKNLNFSTTSAQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQA 671

Query: 273 AKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLF----VKN 328
              +  ++     G K+             +LK  ++ + L K +K     +     VKN
Sbjct: 672 GAVIAAMDGAVIDGHKI-------------QLKISHKQSSLPKTSKGSKKKISGKIIVKN 718

Query: 329 LDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVA 388
           L      + + E F+ FG + S +V +    ++RGF FV F  P EA  A+ +     + 
Sbjct: 719 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLL 778

Query: 389 GKPLYVAIAQR 399
           G+ L +  A++
Sbjct: 779 GRRLVMQYAEQ 789

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 152 ILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKD 206
           I   K+  D++G SR F F+ + +E DA DAIE  +G  ++   + VA+  S  D
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAKSFAD 91

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 348 ITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 398
           IT  K+++D++GNSR F F+ + + ++A  AI   N   +    + VA+A+
Sbjct: 37  ITDVKIVKDKSGNSRRFAFIGYRSEQDAFDAIEYFNGSFIDTARIEVAMAK 87

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 92/195 (47%), Gaps = 12/195 (6%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
              ++V+NI  + +  E  + F ++  I  AV+ KD+ G  RGFGFV+F   +    A+D
Sbjct: 15  LKTLFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALD 74

Query: 278 ELNELEFKGQKLYVGRAQK--KYERLQELKKQYEAARLEKL--------AKYQGV-NLFV 326
           +  + +FKG+ L V  A++  + ++  E + Q  A   EK         A  +G   L +
Sbjct: 75  KGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLII 134

Query: 327 KNLDDSIDD-EKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQ 385
           +N+  S  D  KLK+ F  FG +  A + R   G   GF FV         KAI E    
Sbjct: 135 RNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGL 194

Query: 386 IVAGKPLYVAIAQRK 400
            + G+ + V  A +K
Sbjct: 195 KIDGREVAVDFAVQK 209

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 87/187 (46%), Gaps = 24/187 (12%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++N+     +  L + FS F  I    +  D  G SRGFGFV F  ESD + A++   
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT----------------------NVYVKN 225
                 + + V +   +++R  K +E +A+ +                       + ++N
Sbjct: 78  KTQFKGRLLRVDV-AKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEALMRGKPKLIIRN 136

Query: 226 IDQETSQ-EEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284
           +        + +++FG++G +  A + + ++GKL GF FV  +  +   KA++E   L+ 
Sbjct: 137 MPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCRKAIEECKGLKI 196

Query: 285 KGQKLYV 291
            G+++ V
Sbjct: 197 DGREVAV 203

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 45/78 (57%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+N+     D +L + F+ F  I  A +++D  G+SRGFGFV F+   +   A+ +  
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGR 77

Query: 384 QQIVAGKPLYVAIAQRKE 401
           +    G+ L V +A+R+E
Sbjct: 78  KTQFKGRLLRVDVAKRRE 95

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHA 270
           +V+V+N+  + +QE  E  F K+G +  A+  +D E  L +G  FV F+D +
Sbjct: 289 SVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDES 340

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 318 KYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEAT 376
           + +  ++FV+N+      E L+  F+ FG +  A  ++D ETG  +G  FV F   +E+T
Sbjct: 284 RRENFSVFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFK--DEST 341

Query: 377 KAITEKNQQIVAGKPLYVA 395
                 N  +V  K L ++
Sbjct: 342 FDTCVANAPVVDSKSLLIS 360

>Scas_558.1
          Length = 435

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 101/221 (45%), Gaps = 17/221 (7%)

Query: 212 EEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
           E+V   + N ++V N+  + + E+  + F   G++  A +   S+G  RG G V F +  
Sbjct: 97  EKVNRNYANSIFVGNLTYDCTPEDLRDYFSGIGEVVRADIIT-SKGHHRGMGTVEFTNSR 155

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQK-----KYERLQELKKQYEAARLEKLAK------- 318
              +A+ + +   F  ++++V +        + ER    +    ++R + ++        
Sbjct: 156 DVEEAIRQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQS 215

Query: 319 --YQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEAT 376
              QG  +FV NL  SI+ + LK+ F   G +  A V  D  G SRGFG V F T ++  
Sbjct: 216 NMKQGYEIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDME 275

Query: 377 KAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARNQM 417
           +AI   N+  V G+ L V        R + +  Q Q +N M
Sbjct: 276 RAIDRYNRFEVDGRTLDVREGHSNN-RNDDMNIQHQTQNAM 315

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/371 (20%), Positives = 136/371 (36%), Gaps = 65/371 (17%)

Query: 88  DHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFS 147
           D   GP    + +Y  +  +     + ++   + +  + +I++ NL      + L + FS
Sbjct: 70  DRRRGPSRYAKGDYGPVLARELDSTYEEK---VNRNYANSIFVGNLTYDCTPEDLRDYFS 126

Query: 148 TFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR 207
             G ++   + T + G  RG G V F N  D  +AI   D     D++++V       D 
Sbjct: 127 GIGEVVRADIITSK-GHHRGMGTVEFTNSRDVEEAIRQYDSSYFMDRQIFVRQDNPPPD- 184

Query: 208 QSKLEEVKAKFTN-------------------------VYVKNIDQETSQEEFEELFGKY 242
             + E   ++ T                          ++V N+    + +  +++F + 
Sbjct: 185 NGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGYEIFVANLPYSINWQALKDMFKEC 244

Query: 243 GKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQ 302
           G +  A +E D  G+ RGFG V F       +A+D  N  E  G+ L V R      R  
Sbjct: 245 GDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRYNRFEVDGRTLDV-REGHSNNRND 303

Query: 303 ELKKQY--------------------------EAARLEKLAKYQGVN--------LFVKN 328
           ++  Q+                          E A        +GV         ++  N
Sbjct: 304 DMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNRTSTFTEGVVEGGERNTLIYCSN 363

Query: 329 LDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVA 388
           L  S     L + F   G + +A++  D  G + G   V F + ++A   I   N+    
Sbjct: 364 LPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAIVEFISQDDADVCIERLNKYNYG 423

Query: 389 GKPLYVAIAQR 399
           G  L ++ A+R
Sbjct: 424 GCDLEISYAKR 434

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/333 (21%), Positives = 124/333 (37%), Gaps = 79/333 (23%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTS--LGYAYVNFHDHEAGPKAI 96
           S++VG L    +   L D FS IG V    V  D IT+     G   V F +     +AI
Sbjct: 106 SIFVGNLTYDCTPEDLRDYFSGIGEV----VRADIITSKGHHRGMGTVEFTNSRDVEEAI 161

Query: 97  EQLNYTLIKGK---------PCRIMWSQRDPSLRKKGSGN-------------------- 127
            Q + +    +         P     ++R PS R     +                    
Sbjct: 162 RQYDSSYFMDRQIFVRQDNPPPDNGRNERTPSRRTTAPSSRQQDISSGAYSMQSNMKQGY 221

Query: 128 -IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA- 185
            I++ NL  +I+ ++L + F   G+++   V  D  G SRGFG V F    D   AI+  
Sbjct: 222 EIFVANLPYSINWQALKDMFKECGDVMRADVELDRAGRSRGFGTVIFRTRDDMERAIDRY 281

Query: 186 ----VDGMLMNDQEVYVA-----LHVSKKDRQSKLEEVKAKFTN---------------- 220
               VDG  ++ +E +       +++  + + +   +  +  T+                
Sbjct: 282 NRFEVDGRTLDVREGHSNNRNDDMNIQHQTQNAMTNDATSDATSNERSLPTQPSEPASNR 341

Query: 221 -----------------VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGF 263
                            +Y  N+   T++ +  +LF   GK+ +A L+ D  G+  G   
Sbjct: 342 TSTFTEGVVEGGERNTLIYCSNLPPSTARSDLYDLFESIGKVRNAELKYDRNGETTGVAI 401

Query: 264 VNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
           V F     A   ++ LN+  + G  L +  A++
Sbjct: 402 VEFISQDDADVCIERLNKYNYGGCDLEISYAKR 434

>Sklu_2085.2 YOR319W, Contig c2085 3158-3787
          Length = 209

 Score = 65.1 bits (157), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 6/119 (5%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            +LY+G ++P V++ LLY++F  +  +S IR  RD I +T  GYA++ F   E     ++
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 98  QLNYTL------IKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFG 150
            +N T+      +K +      +   PS   +    +++KNL   +D  +L + F  FG
Sbjct: 70  VMNNTVQLYNRTLKVRRANSNTAASQPSKHVEIGAKLFVKNLDDLVDVAALAKIFGKFG 128

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 80/187 (42%), Gaps = 17/187 (9%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNF---EDHAAAAK 274
           T +Y+ NID   +++   ELF +   I+     +D      +G+ F+ F   ED     K
Sbjct: 10  TTLYIGNIDPNVTKDLLYELFIQVSPISKIRYPRDKILDTHQGYAFIEFFTKEDADYVVK 69

Query: 275 AVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSID 334
            ++  N ++   + L V RA       Q   K  E           G  LFVKNLDD +D
Sbjct: 70  VMN--NTVQLYNRTLKVRRANSNTAASQP-SKHVEI----------GAKLFVKNLDDLVD 116

Query: 335 DEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
              L + F  FG  +    +           ++ ++T +++ +A+ + N QIV  + + V
Sbjct: 117 VAALAKIFGKFGPFSKQPEIFHVKQADYKCAYIYYTTFDDSDQALAKLNNQIVFNRSISV 176

Query: 395 AIAQRKE 401
             A + E
Sbjct: 177 DYAFKDE 183

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/323 (21%), Positives = 128/323 (39%), Gaps = 89/323 (27%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++++  ++ ++ L + FS F  I    V  D N  SRGFGFV F  E D + A++   
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEF------------ 235
              ++  ++ V +   ++DR  K E+  A+      K ID+ +S+  +            
Sbjct: 84  KTKLDGAQLKVDI-ARRRDRSGKNEDKSAQ------KEIDRNSSKRSYGDENTEGGEEDE 136

Query: 236 -------------------------EELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
                                    +++FGKYG +  A + +  +GKL GF FV     +
Sbjct: 137 SSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKIS 196

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLA------------- 317
              KA+++   L   G+K+ V  A +K  + +E K +YE    E                
Sbjct: 197 NCKKALEDTKNLTIDGRKVAVDFAVQK-NKWEEYKTKYEKEDDEAKDDGSDSSSDKEDKI 255

Query: 318 ------------------------------KYQGVNLFVKNLDDSIDDEKLKEEFAPFGT 347
                                         + +  ++FV+N+     +E L + F+ FG 
Sbjct: 256 SVSDSEGDEDGEDVEEEEEVEEEKPRKQKNRREDFSVFVRNVPYDATEESLFDHFSKFGP 315

Query: 348 ITSA-KVMRDETGNSRGFGFVCF 369
           +  A  V+   TG ++G  FV F
Sbjct: 316 VKYALPVIDKNTGLAKGTAFVAF 338

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 84/200 (42%), Gaps = 20/200 (10%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           ++V++I +  + E+  + F  +  I  AV+ KD   K RGFGFV+F        A+ E  
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 281 ELEFKGQKLYV--GRAQKKYERLQELKKQYEAARLEKLAKYQGVN--------------- 323
           + +  G +L V   R + +  + ++   Q E  R      Y   N               
Sbjct: 84  KTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLKGK 143

Query: 324 --LFVKNLDDSIDD-EKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAIT 380
             L ++N+  S  D  KLK+ F  +G +  A + R   G   GF FV  +      KA+ 
Sbjct: 144 PKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKALE 203

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
           +     + G+ + V  A +K
Sbjct: 204 DTKNLTIDGRKVAVDFAVQK 223

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 48/78 (61%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+++ +S+ DE+L + F+ F  I  A V++D    SRGFGFV F+  ++   A+ E  
Sbjct: 24  LFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKKSRGFGFVSFAVEDDTKIALKEAR 83

Query: 384 QQIVAGKPLYVAIAQRKE 401
           +  + G  L V IA+R++
Sbjct: 84  KTKLDGAQLKVDIARRRD 101

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 87/216 (40%), Gaps = 41/216 (18%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+V  +  +V++  L D FS    +    V +D +   S G+ +V+F   +    A+++
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKD-VNKKSRGFGFVSFAVEDDTKIALKE 81

Query: 99  LNYTLIKGKPCRIMWSQR--------DPSLRK---------------------------K 123
              T + G   ++  ++R        D S +K                           K
Sbjct: 82  ARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDESSLLK 141

Query: 124 GSGNIYIKNLHPAI-DNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDA 182
           G   + I+N+  +  D   L + F  +G ++   +    +G   GF FV     S+ + A
Sbjct: 142 GKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKISNCKKA 201

Query: 183 IEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKF 218
           +E    + ++ ++V V   V K    +K EE K K+
Sbjct: 202 LEDTKNLTIDGRKVAVDFAVQK----NKWEEYKTKY 233

 Score = 33.9 bits (76), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 55/219 (25%), Positives = 87/219 (39%), Gaps = 40/219 (18%)

Query: 97  EQLNYTLIKGKPCRIM----WSQRDPSLRKK--GSGNIYIKNLHP-AIDNKSLHETFSTF 149
           E+   +L+KGKP  I+    WS RDP+  KK  G   + +    P   D K     F T 
Sbjct: 133 EEDESSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTM 192

Query: 150 GNILSCKVA--------TDENGVSRGFGF---------VHFENESD------------AR 180
             I +CK A         D   V+  F             +E E D              
Sbjct: 193 NKISNCKKALEDTKNLTIDGRKVAVDFAVQKNKWEEYKTKYEKEDDEAKDDGSDSSSDKE 252

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFG 240
           D I   D     D E        ++++  K +  +  F+ V+V+N+  + ++E   + F 
Sbjct: 253 DKISVSDSEGDEDGEDVEEEEEVEEEKPRKQKNRREDFS-VFVRNVPYDATEESLFDHFS 311

Query: 241 KYGKITSA--VLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           K+G +  A  V++K++ G  +G  FV F+D       VD
Sbjct: 312 KFGPVKYALPVIDKNT-GLAKGTAFVAFKDEKTYKYCVD 349

>Scas_645.14
          Length = 717

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 89/204 (43%), Gaps = 35/204 (17%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE----------NGVSRGFGFVHFEN 175
           GNI+I  ++  ID   +   F  FG+ILS K+  D           +    G+GF+ F  
Sbjct: 181 GNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVL 240

Query: 176 ESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQ----SKLEEVK--AKFTNVYVKNIDQE 229
            S A + I   +G ++   ++++  HV +K+R+    S ++E     KF  +++ N+   
Sbjct: 241 GSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNLPTT 300

Query: 230 TSQEEFEELFGKYGKITSAVL-------------------EKDSEGKLRGFGFVNFEDHA 270
            +    + +  K     S VL                     +    L+G+GFVN   H 
Sbjct: 301 LTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLGSHE 360

Query: 271 AAAKAVDELNELEFKGQKLYVGRA 294
            A K +  L+ LE+KG +L V +A
Sbjct: 361 QALKVIQTLDGLEWKGNRLVVNKA 384

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 11/109 (10%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSR----------GFGFVCFSTP 372
           N+F+  ++  ID+ K++  F  FG+I S K+  D   NS           G+GF+ F   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 373 EEATKAITEKNQQIVAGKPLYVAI-AQRKEVRRNQLAQQIQARNQMRFQ 420
            +A++ I E N +I+ G  L++    +RKE  R Q +   +  +  +F+
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFK 290

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 53/127 (41%), Gaps = 52/127 (40%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT-------------------------- 159
            N+Y+K++  +  +  L++ FS FG+I+S KV T                          
Sbjct: 524 SNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQEHN 583

Query: 160 DEN-----------------------GVSRGFGFVHFENESDARDAIEAVDGMLMNDQEV 196
           D+N                       G SRG+GFV FEN  DA  AI A DG++++   +
Sbjct: 584 DKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPNNI 643

Query: 197 YVALHVS 203
              L+VS
Sbjct: 644 ---LNVS 647

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 54/131 (41%), Gaps = 50/131 (38%)

Query: 320 QGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM------------------------- 354
           Q  NL+VK++  S  D++L + F+ FG I S+KV+                         
Sbjct: 522 QESNLYVKHIPLSWRDDELNDFFSQFGDIISSKVITVGGSKKLDNQNENDKENQEEQEQE 581

Query: 355 ----RDE--------------------TGNSRGFGFVCFSTPEEATKAITEKNQQIVA-G 389
                D+                     G SRG+GFVCF  P +A++AI   +  I++  
Sbjct: 582 HNDKNDQEVEEGGEEEEEEEDEDENLPVGFSRGYGFVCFENPLDASRAIMATDGVIISPN 641

Query: 390 KPLYVAIAQRK 400
             L V+ AQ++
Sbjct: 642 NILNVSFAQKR 652

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 86/193 (44%), Gaps = 41/193 (21%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD----------SEGKLRGFGFVNFEDH 269
           N+++  I+ +  + +   LF K+G I S  L  D          +     G+GF++F   
Sbjct: 182 NIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFISFVLG 241

Query: 270 AAAAKAVDELNELEFKGQKLYVGRA--QKKYERLQ--ELKKQYEAARLEKLAKYQGVNLF 325
           + A++ ++E N    +G KL++     +K+ ER+Q   +K+  +  + +         +F
Sbjct: 242 SQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKC--------IF 293

Query: 326 VKNLDDSIDD-------EKLKEEFA---PFGTITS---------AKVMRDETGNSRGFGF 366
           + NL  ++ D       +K+K E +   P   I S            + +++   +G+GF
Sbjct: 294 IGNLPTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGF 353

Query: 367 VCFSTPEEATKAI 379
           V   + E+A K I
Sbjct: 354 VNLGSHEQALKVI 366

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 35/195 (17%), Positives = 77/195 (39%), Gaps = 40/195 (20%)

Query: 35  TSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTS---------LGYAYVN 85
           T   ++++G +   + E+ +  +F   GS+ SI++  D + N++         +GY +++
Sbjct: 178 THPGNIFIGGINHKIDESKIRALFEKFGSILSIKLFHDRLMNSNTNNSTSSNPIGYGFIS 237

Query: 86  FHDHEAGPKAIEQLNYTLIKGKPC------------RIMWSQRDPSLRKKGSGNIYIKNL 133
           F       + I + N  +I+G               RI WS    +   +    I+I NL
Sbjct: 238 FVLGSQASECINEFNGKIIEGTKLFLNYHVERKERERIQWSHIKENNDDEKFKCIFIGNL 297

Query: 134 HPAIDNKSLHETFSTFGNILSCKVAT-------------------DENGVSRGFGFVHFE 174
              + + ++          LS  + +                   +++   +G+GFV+  
Sbjct: 298 PTTLTDLTIDLILDKIKTELSEVLPSLQILSYYFPQSKNVNNNINNKSSPLKGYGFVNLG 357

Query: 175 NESDARDAIEAVDGM 189
           +   A   I+ +DG+
Sbjct: 358 SHEQALKVIQTLDGL 372

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 64.3 bits (155), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           + +  ++YVG L+P VS+ LLY++F  +  VS IR  +D +     G+A+V         
Sbjct: 3   QNTECTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCD 62

Query: 94  KAIEQLNYTL-IKGKPCRIMWSQRDP--SLRKKGSGNIYIKNLHPAIDNKSLHETFSTFG 150
            AI+ LN T+ + GK  ++  +  +   S        +++KNL   ID   L + F  FG
Sbjct: 63  FAIKSLNNTVSLFGKVLKVRRTLENAKNSAPVFARAKLFVKNLDSTIDAVQLQKLFGKFG 122

Query: 151 NILS-CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
            +    ++ T ++G  R   +V+F     + +A+E ++  ++ +Q + +
Sbjct: 123 PLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALEKLNNQIVANQIISI 170

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 16/181 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAVD 277
             VYV N+D + S+E   ELF +   ++     KD  + + +GF FV     A    A+ 
Sbjct: 7   CTVYVGNLDPQVSKELLYELFVQVAPVSRIRYPKDKVKQEHQGFAFVELFSEADCDFAIK 66

Query: 278 ELNE-LEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDE 336
            LN  +   G+ L V R          L+    +A +   AK     LFVKNLD +ID  
Sbjct: 67  SLNNTVSLFGKVLKVRRT---------LENAKNSAPVFARAK-----LFVKNLDSTIDAV 112

Query: 337 KLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
           +L++ F  FG +     +      +    +V F+T   + +A+ + N QIVA + + +  
Sbjct: 113 QLQKLFGKFGPLAKPPQLFTLKDGALRCAYVYFTTFRHSDEALEKLNNQIVANQIISIDY 172

Query: 397 A 397
           A
Sbjct: 173 A 173

>Kwal_55.20154
          Length = 522

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 149/342 (43%), Gaps = 67/342 (19%)

Query: 20  QTAPTTTESETPKVE---TSGASLYVGELEPTVSEALLYDIFSPIGSVS-SIRVCRDAIT 75
            T+ + T S++P  E   T   SLY+G+L+P   EA +  +++ +G  +  I++ R + +
Sbjct: 24  HTSMSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGS 83

Query: 76  -NTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIM---WSQRDPSLRKKGSGNIYIK 131
              + GY +V F  H     A+ + N  +I     RI+   W+    +   + S  +++ 
Sbjct: 84  PGHNSGYCFVEFPSHTNASNALLK-NGLVIPNTGNRILKLNWASFATTPGNEYS--VFVG 140

Query: 132 NLHPAIDNKSLHETF-STFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGM 189
           ++ P +    L E F S + + L+ K+  D+  GVS+G+GFV F  ES+ + ++  + G+
Sbjct: 141 DVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGV 200

Query: 190 LMNDQEVYVALHVSKKDR---------------------------QSKLEEVKAKF---- 218
            +N + + V+   + K+R                           Q    + +++F    
Sbjct: 201 FLNGRAIRVS--TTSKNRPKFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPV 258

Query: 219 --------------TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFV 264
                         T V++  +    +++E    F  +G I   V  K   GK  G GFV
Sbjct: 259 QQQPTLTQYTDPNNTTVFIGGLSSLVTEDELRAFFQPFGSI---VYVKIPVGK--GCGFV 313

Query: 265 NFEDHAAAAKAVDELNELEFKGQ--KLYVGRAQKKYERLQEL 304
            + D  +A  A+ ++          +L  GR+ K+   +Q++
Sbjct: 314 QYVDRLSAETAIAKMQGFPIGNSRIRLSWGRSAKQAAVMQKV 355

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 56/295 (18%), Positives = 117/295 (39%), Gaps = 49/295 (16%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFG--NI-LSCKVATDENGVSRGFGFVHFENESDARD 181
           S ++Y+ +L P  D  ++   ++T G  N+ +    ++   G + G+ FV F + ++A +
Sbjct: 44  SNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSGSPGHNSGYCFVEFPSHTNASN 103

Query: 182 AIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELF-G 240
           A+     ++ N     + L+       +          +V+V ++    ++ +  ELF  
Sbjct: 104 ALLKNGLVIPNTGNRILKLN------WASFATTPGNEYSVFVGDVAPNVTEAQLFELFIS 157

Query: 241 KYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYE 299
           +Y    +A +  D   G  +G+GFV F   +   +++ E+  +   G+ + V    K   
Sbjct: 158 RYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLEMQGVFLNGRAIRVSTTSKNRP 217

Query: 300 RL-------------------QELKKQYEAARLEK-----------LAKYQGVN---LFV 326
           +                         Q+ A + +            L +Y   N   +F+
Sbjct: 218 KFQQVQPPLQQQQHQQHAFAKHSHAPQFNAVQPQSQFIYPVQQQPTLTQYTDPNNTTVFI 277

Query: 327 KNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITE 381
             L   + +++L+  F PFG+I   K+        +G GFV +     A  AI +
Sbjct: 278 GGLSSLVTEDELRAFFQPFGSIVYVKIPVG-----KGCGFVQYVDRLSAETAIAK 327

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 90/212 (42%), Gaps = 28/212 (13%)

Query: 200 LHVSKKDRQSKL---EEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKIT---SAVLEKD 253
           LH S    +S+    E    +  ++Y+ ++D    +     ++   G+       +    
Sbjct: 23  LHTSMSGTRSQSPASEHHSTRSNSLYMGDLDPNWDEAAIRAVWATLGEPNVQIKLIRSSG 82

Query: 254 SEGKLRGFGFVNFEDHAAAAKAVDELNELEF--KGQKLYVGRAQKKYERLQELKKQYEAA 311
           S G   G+ FV F  H  A+ A+ + N L     G ++              LK  + + 
Sbjct: 83  SPGHNSGYCFVEFPSHTNASNALLK-NGLVIPNTGNRI--------------LKLNWASF 127

Query: 312 RLEKLAKYQGVNLFVKNLDDSIDDEKLKEEF-APFGTITSAKVMRDE-TGNSRGFGFVCF 369
                 +Y   ++FV ++  ++ + +L E F + + +  +AK++ D+ TG S+G+GFV F
Sbjct: 128 ATTPGNEY---SVFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKF 184

Query: 370 STPEEATKAITEKNQQIVAGKPLYVAIAQRKE 401
               E  +++ E     + G+ + V+   +  
Sbjct: 185 GQESEQQRSLLEMQGVFLNGRAIRVSTTSKNR 216

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 92/200 (46%), Gaps = 18/200 (9%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
              ++V+ +  E++ EEF   F ++  I  AV+ KD EG  RGFGFV+F        A++
Sbjct: 14  LKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALN 73

Query: 278 ELNELEFKGQKLYVGRAQKKYERLQELKKQYEAA--------RLEKLAKYQGVN------ 323
           +  + +F G+ L +  A K+ ER +  K   E +        + E+ +K +  N      
Sbjct: 74  QARKTKFMGRLLRIDIA-KRRERSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGK 132

Query: 324 --LFVKNLDDSIDD-EKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAIT 380
             L ++N+  S  D  KLK+ F  +GT+  A + R   G   GF FV  +       AI 
Sbjct: 133 PKLIIRNMPWSCRDPTKLKKIFGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIE 192

Query: 381 EKNQQIVAGKPLYVAIAQRK 400
                 + G+ + V  A +K
Sbjct: 193 GTKDLKIDGRKVAVDFAIQK 212

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 3/96 (3%)

Query: 314 EKLAKYQGVNL---FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFS 370
           +K+ K +G++L   FV+ +     DE+    F+ F  I  A +++D  G SRGFGFV F+
Sbjct: 4   KKVIKDEGLDLKTLFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFA 63

Query: 371 TPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQ 406
             ++   A+ +  +    G+ L + IA+R+E  R +
Sbjct: 64  VEDDTKTALNQARKTKFMGRLLRIDIAKRRERSRGK 99

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 30/194 (15%)

Query: 146 FSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD-----GMLM--------- 191
           FS F  I    +  D  G SRGFGFV F  E D + A+         G L+         
Sbjct: 35  FSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFMGRLLRIDIAKRRE 94

Query: 192 ------NDQEVYVALHVS--KKDRQSKLEE----VKAKFTNVYVKNIDQETSQ-EEFEEL 238
                 +  EV  A  V   K + +SK E+    +K K   + ++N+        + +++
Sbjct: 95  RSRGKKDADEVSSAPSVDNVKDEEESKPEDDNDLMKGK-PKLIIRNMPWSCRDPTKLKKI 153

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRA--QK 296
           FG YG +  A + +  +G+L GF FV     +    A++   +L+  G+K+ V  A  + 
Sbjct: 154 FGLYGTVVEATIPRKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAVDFAIQKN 213

Query: 297 KYERLQELKKQYEA 310
           ++E  +   K+ EA
Sbjct: 214 RWEDYKNEHKELEA 227

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 43/106 (40%), Gaps = 25/106 (23%)

Query: 103 LIKGKPCRIM----WSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVA 158
           L+KGKP  I+    WS RDP+                      L + F  +G ++   + 
Sbjct: 128 LMKGKPKLIIRNMPWSCRDPT---------------------KLKKIFGLYGTVVEATIP 166

Query: 159 TDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSK 204
              +G   GF FV     S+ + AIE    + ++ ++V V   + K
Sbjct: 167 RKRDGRLCGFAFVTMNRISNCKAAIEGTKDLKIDGRKVAVDFAIQK 212

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 254 SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG 292
           S G+ RG+GFV F DH AA   +  LN  E    ++  G
Sbjct: 554 SGGRSRGYGFVEFRDHKAALMCLRWLNAHEVSRDEILEG 592

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAA 271
           +++V+N+  + +QE  E  FG +G +  A+   D E G  +G  FV F    A
Sbjct: 297 SIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSEDA 349

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSA-KVMRDETGNSRGFGFVCFST 371
           ++FV+N+      E L+  F  FG +  A  V+  ETG ++G  FV F +
Sbjct: 297 SIFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRS 346

>Kwal_27.11832
          Length = 686

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 88/190 (46%), Gaps = 13/190 (6%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           ++V++I  + + EE    F     I  AV+ KD +   RGFGFV+F        A+D+  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV---------NLFVKNLDD 331
           + +FKG+ L V  A++   R +  K Q  AA  E  +  Q            L V+N+  
Sbjct: 83  KTKFKGRLLRVDIAKR---RDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPW 139

Query: 332 SIDD-EKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
           S+ + ++LK+ F  +GT+  AK+ +   G   GF FV          AI E     + G+
Sbjct: 140 SVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGR 199

Query: 391 PLYVAIAQRK 400
            + V  A +K
Sbjct: 200 QVAVDFAVQK 209

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 86/188 (45%), Gaps = 19/188 (10%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++++     ++ L   FS    I    +  D+   SRGFGFV F  E D +DA++   
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 188 GMLMNDQEVYVALHVSKKDR-----------------QSKLEEVKAKFTNVYVKNIDQET 230
                 + + V +   ++DR                 Q K +E+      + V+N+    
Sbjct: 83  KTKFKGRLLRVDI-AKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWSV 141

Query: 231 SQ-EEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKL 289
              +E +++F +YG +  A + K  +GKL GF FV  +  A+   A++E   L+  G+++
Sbjct: 142 RNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQV 201

Query: 290 YVGRAQKK 297
            V  A +K
Sbjct: 202 AVDFAVQK 209

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+++     DE+L   F+    I  A +++D+  NSRGFGFV F+  ++   A+ +  
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKNSRGFGFVSFAVEDDTKDALDKAR 82

Query: 384 QQIVAGKPLYVAIAQRKE 401
           +    G+ L V IA+R++
Sbjct: 83  KTKFKGRLLRVDIAKRRD 100

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/189 (19%), Positives = 78/189 (41%), Gaps = 24/189 (12%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           +L+V  +    ++  L + FS +  +    + +D   N S G+ +V+F   +    A+++
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDK 80

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRKK----------------------GSGNIYIKNLHPA 136
              T  KG+  R+  ++R    +K                       G   + ++N+  +
Sbjct: 81  ARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVRNMPWS 140

Query: 137 IDN-KSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQE 195
           + N   L + F  +G ++  K+    +G   GF FV  +  +  + AIE    + +  ++
Sbjct: 141 VRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLKIGGRQ 200

Query: 196 VYVALHVSK 204
           V V   V K
Sbjct: 201 VAVDFAVQK 209

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 204 KKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFG 262
           K DR  + +  K +   V+V+N+  + +QE  EE F K+G +  A+  +D E G  +G  
Sbjct: 276 KVDRSDRPKPNKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSA 335

Query: 263 FVNFEDHAAAAKAVD 277
           FV F+   A  + V+
Sbjct: 336 FVVFQTQEAFDECVN 350

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 21/39 (53%)

Query: 254 SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG 292
           S G+ RG+GFV F DH AA   +  LN  E    +L  G
Sbjct: 549 STGRSRGYGFVEFRDHKAALMGLRWLNAHEVTKSELLEG 587

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 318 KYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPE 373
           K + + +FV+N+      E L+E F  FG +  A  ++D ETG ++G  FV F T E
Sbjct: 287 KKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQE 343

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 118 PSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI-LSCKVATDENGVSRGFGFVHFENE 176
           P   KK    ++++N+      +SL E F+ FG +  +  V   E G+++G  FV F+ +
Sbjct: 283 PKPNKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQ 342

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 85/173 (49%), Gaps = 8/173 (4%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN------GVSRGFGFVHFENESDAR 180
           +I+IKNL+ +  ++ L E F  F   +  +V T  +       +S GFGF  F+ +  A 
Sbjct: 652 SIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQAN 711

Query: 181 DAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT--NVYVKNIDQETSQEEFEEL 238
             I A++G +++  ++ + L   +    +     K K     + VKN+  E ++++  EL
Sbjct: 712 AVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFEL 771

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
           F  +G++ S  + K  +   RGF FV F     A  A+D+L  +   G++L +
Sbjct: 772 FSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 824

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 105/447 (23%), Positives = 179/447 (40%), Gaps = 82/447 (18%)

Query: 18  EEQTAPTTTESE----TPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDA 73
           EE    T+ ESE      K+  +G  L++  +  T +E     +FSP G +  + +  D 
Sbjct: 307 EETEVETSQESEEEKSLKKIRETG-RLFLRNILYTATEDDFRKLFSPYGELEEVHIAVDT 365

Query: 74  ITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGS--GNIYIK 131
            T  S G+AYV F + +    A  +L+  + +G+   I+     P+  KK        +K
Sbjct: 366 RTGQSKGFAYVLFKNADNAATAFVELDKQIFQGRLLHIL-----PADAKKSHKLDEFDLK 420

Query: 132 NLHPAIDNKSL-------HETFS---TFGN---ILSCKVATDENGVSRGFGFVHFENESD 178
           NL P    + L        +TFS    + N   +LS     D+ G+ +    +  EN S 
Sbjct: 421 NL-PLKKQRELKRKANSAQQTFSWNSLYMNQDAVLSS--VADKLGMKKS-ELIDAENSSS 476

Query: 179 A-RDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEE 237
           A + A+   +  ++ D   +         + ++L+  +     + VKN    T++EE  E
Sbjct: 477 AVKQAL--AEASVIGDVRKFFETRGVDLTKFAQLKNSERDDRVILVKNFPYGTTREEIAE 534

Query: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRA--- 294
           LF  +GK+   +L             + F D  AA  A  +++   FK   +Y+ +    
Sbjct: 535 LFLPFGKLQRLLLPPSG-----TIAILQFRDVPAARAAFSKISYKRFKDGIIYLEKGPSD 589

Query: 295 ----QKKYERLQELKKQYEAARLEKLAKYQG----------------------------- 321
                 + + L E +   + A   K AK  G                             
Sbjct: 590 CFTRDAQGDELVESETDIQKA-TAKEAKISGADLLEAQSLPAADKDDHDDDDDDDDVQAG 648

Query: 322 --VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR----DETGN--SRGFGFVCFSTPE 373
             V++F+KNL+ S   ++L E+F PF     A+V       + G   S GFGF  F T E
Sbjct: 649 PTVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKE 708

Query: 374 EATKAITEKNQQIVAGKPLYVAIAQRK 400
           +A   I+     I+ G  L + ++ R+
Sbjct: 709 QANAVISAMEGTILDGHKLQLKLSHRQ 735

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 72/165 (43%), Gaps = 13/165 (7%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGS--VSSIRVCRDAI---TNTSLGYAYVNFHDHEAG 92
            S+++  L  + +   L + F P     V+ ++   D        S+G+ +  F   E  
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 93  PKAIEQLNYTLIKGKPCRIMWSQRDPS--------LRKKGSGNIYIKNLHPAIDNKSLHE 144
              I  +  T++ G   ++  S R  +         +KK  G I +KNL      K + E
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFE 770

Query: 145 TFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
            FS+FG + S +V    +  +RGF FV F    +A +A++ + G+
Sbjct: 771 LFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 815

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 44/79 (55%), Gaps = 1/79 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF++N+  +  ++  ++ F+P+G +    +  D  TG S+GF +V F   + A  A  E 
Sbjct: 332 LFLRNILYTATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVEL 391

Query: 383 NQQIVAGKPLYVAIAQRKE 401
           ++QI  G+ L++  A  K+
Sbjct: 392 DKQIFQGRLLHILPADAKK 410

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 73/167 (43%), Gaps = 14/167 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK------LRGFGFVNFEDHAAA 272
            ++++KN++  T+ ++  E F  +     A ++   + K        GFGF  F+    A
Sbjct: 651 VSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMGFGFAEFKTKEQA 710

Query: 273 AKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDS 332
              +  +      G KL +  + ++             A  +K  K QG  + VKNL   
Sbjct: 711 NAVISAMEGTILDGHKLQLKLSHRQ-------GTSTTNASSKKKKKNQG-KIIVKNLPFE 762

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
              + + E F+ FG + S +V +    ++RGF FV F  P+EA  A+
Sbjct: 763 ATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 809

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 53/105 (50%), Gaps = 1/105 (0%)

Query: 14  QLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDA 73
           QLK+  +   +TT + + K + +   + V  L    +   ++++FS  G + S+RV +  
Sbjct: 728 QLKLSHRQGTSTTNASSKKKKKNQGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVPK-K 786

Query: 74  ITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP 118
              ++ G+A+V F   +    A++QL    + G+   + + ++DP
Sbjct: 787 FDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMEFVEQDP 831

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 32/64 (50%)

Query: 143 HETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHV 202
           H++      +   K+  + +G SR F F+ F +E DA D +   +G  ++  ++ V++  
Sbjct: 30  HQSTDVQSYLSDVKLMKNRDGESRRFAFIGFRDEEDAFDCVNYFNGTFVDTSKIEVSMAK 89

Query: 203 SKKD 206
           S  D
Sbjct: 90  SFAD 93

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/296 (25%), Positives = 120/296 (40%), Gaps = 42/296 (14%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTS--LGYAYVNFHDHEAGPKAI 96
           S++VG L    +   L + FS IG V    V  D IT+     G   V F + +   +AI
Sbjct: 137 SIFVGNLTYDSTPEDLTEFFSQIGKV----VRADIITSRGHHRGMGTVEFTNSDDVDRAI 192

Query: 97  EQLNYTLIKGKPCRIMWSQRDPS-------------LR-KKGSGNIYIKNLHPAIDNKSL 142
            Q +      +   +      PS             LR  + +  + +KNL  +++ ++L
Sbjct: 193 RQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLPASVNWQAL 252

Query: 143 HETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDG------MLMNDQEV 196
            + F   GN+    V  D +GVS G G V F +  D   AIE  +G      +L    + 
Sbjct: 253 KDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKE 312

Query: 197 YVALHVSKKD-----RQSKLEEVKAKFTN-----------VYVKNIDQETSQEEFEELFG 240
            V  H    D       S + E   KFT            +Y  N+   T++ +  +LF 
Sbjct: 313 SVHNHSDGDDVDIPMDDSPVNEEARKFTENVVGGGERNRLIYCSNLPFSTAKSDLYDLFE 372

Query: 241 KYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
             GK+ +A L  DS+G   G   V +++   A   ++ LN   + G  L +  A++
Sbjct: 373 TIGKVNNAELRYDSKGAPTGIAVVEYDNVDDADVCIERLNNYNYGGCDLDISYAKR 428

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 86/184 (46%), Gaps = 4/184 (2%)

Query: 212 EEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
           E+V   ++N ++V N+  +++ E+  E F + GK+  A +   S G  RG G V F +  
Sbjct: 128 EKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT-SRGHHRGMGTVEFTNSD 186

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLD 330
              +A+ + +   F  +K++V   Q        +K++    R E     +   + VKNL 
Sbjct: 187 DVDRAIRQYDGAFFMDRKIFV--RQDNPPPSNNIKERKALDRGELRHNRKTHEVIVKNLP 244

Query: 331 DSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
            S++ + LK+ F   G +  A V  D  G S G G V F   ++  +AI + N   + G 
Sbjct: 245 ASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGN 304

Query: 391 PLYV 394
            L V
Sbjct: 305 VLDV 308

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 19/128 (14%)

Query: 302 QELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNS 361
           +EL   YE    EK+ +    ++FV NL      E L E F+  G +  A ++    G+ 
Sbjct: 120 RELDSTYE----EKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIIT-SRGHH 174

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA---------IAQRK-----EVRRNQL 407
           RG G V F+  ++  +AI + +      + ++V          I +RK     E+R N+ 
Sbjct: 175 RGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDNPPPSNNIKERKALDRGELRHNRK 234

Query: 408 AQQIQARN 415
             ++  +N
Sbjct: 235 THEVIVKN 242

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 82/402 (20%), Positives = 146/402 (36%), Gaps = 128/402 (31%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           GN++I  +   +   +L ETF  FG I S K+  D   V  G GF+ F   S+A + I  
Sbjct: 139 GNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFDNKNV--GIGFLSFMLGSEAAECIRC 196

Query: 186 VDGMLM-----NDQEVYVALHVSKKDRQSKL----------------------------- 211
           ++G  +     ++  +++  H+ +K+R+                                
Sbjct: 197 MNGTKIRSDNGDEGTLFINYHIERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGKHN 256

Query: 212 -EEVKAKFTN-----------VYVKNIDQETSQE-----EFEELFGKYGKITSAVLEKDS 254
             E+ +  TN           V++ N+  +   E     +  E F     I+       S
Sbjct: 257 SPELNSWSTNNSSDDLTINNCVFIGNLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHS 316

Query: 255 EGKLRGFGFVNFEDHAAAAKAVDELNE--LEFKGQKLYVGRAQKK----------YERLQ 302
             + +G+GF+  +++  A + + E++    EF G  +   +A  K          Y +  
Sbjct: 317 LNQYKGYGFIKLQNNDQARRIIHEISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTT 376

Query: 303 ELKKQYEAARLEKLAKYQG----------------------------------------- 321
           E   +     LE+ + Y G                                         
Sbjct: 377 ETNPKTRNNYLEQTSPYAGGINTFPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEG 436

Query: 322 ---VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM------RDET-----------GNS 361
               N++VK++     D+ L   + PFG I S K++      R+E            G S
Sbjct: 437 QQESNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGIS 496

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAG--KPLYVAIAQRKE 401
           RG+GFV F+ P +A  AI   +   + G  + L V+ AQ+K+
Sbjct: 497 RGYGFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKK 538

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 71/138 (51%), Gaps = 20/138 (14%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT--------------DEN---GVSRGFG 169
           NIY+K++     +K L   +  FGNI+SCK+ T              DE+   G+SRG+G
Sbjct: 441 NIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYG 500

Query: 170 FVHFENESDARDAIEAVDGMLMND--QEVYVAL-HVSKKDRQSKLEEVKAKFTNVYVKNI 226
           FV+F N  DA  AI + DG  +    Q++ V+     KKD QS L+E  +  ++  + N 
Sbjct: 501 FVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSLLDESLSNESSDQIDNS 560

Query: 227 DQETSQEEFEELFGKYGK 244
           ++   +E+      K+G+
Sbjct: 561 EKTNEKEKRNHSSAKFGQ 578

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 19/105 (18%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVL---------EKDSE--------GKLRGF 261
           +N+YVK++  + S ++    +  +G I S  +         EK +         G  RG+
Sbjct: 440 SNIYVKHVPLDWSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGY 499

Query: 262 GFVNFEDHAAAAKAVDELNELEFKG--QKLYVGRAQKKYERLQEL 304
           GFV F +   AA A+   +    +G  QKL V  AQKK +  Q L
Sbjct: 500 GFVYFANPLDAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSL 544

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 35  TSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPK 94
           T   +L++G +   +S   L + F   G++SS+++  D   N ++G  +++F       +
Sbjct: 136 THPGNLFIGGIPKNMSLNTLMETFDKFGTISSLKILFD---NKNVGIGFLSFMLGSEAAE 192

Query: 95  AIEQLNYTLIK 105
            I  +N T I+
Sbjct: 193 CIRCMNGTKIR 203

>Scas_157.1
          Length = 232

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 85/173 (49%), Gaps = 8/173 (4%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIG-SVSSIRVCRDAITNTSLGYAYVNFHDHEAG 92
            T  + LY+G+L+P   E ++  I+  +G S   +++  ++    + GY +V F   E G
Sbjct: 43  NTGSSQLYMGDLDPNWDENVIRQIWRDLGESNVHVKMMWNSNLGVNQGYCFVEFPSMEHG 102

Query: 93  PKAIEQLNYTLIKGKPCR---IMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETF-ST 148
             A+ + N  +I G P R   + W+    +    G  ++++ +L P +    L E F   
Sbjct: 103 NNALLK-NGIVIPGFPQRRLKLNWASAGANGNNSGF-SVFVGDLSPNVTEAQLFELFIGR 160

Query: 149 FGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200
           + +    KV  D+  GVS+ +GFV F + +D +  +  + G+ +N + + V L
Sbjct: 161 YPSTCHAKVVHDQLTGVSKCYGFVKFNSATDQQRVLVEMQGVFLNGRSIKVGL 213

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 90/177 (50%), Gaps = 17/177 (9%)

Query: 36  SGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA 95
           SG ++YVG ++P +++  LY++F  I  V  I+  +D +     GYA++ F++      A
Sbjct: 7   SGNTVYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYA 66

Query: 96  IEQLNYT------LIKGKPCRIMWSQRDPSLRKKGS-------GNIYIKNLHPAIDNKSL 142
           I+ +N T      LIK +  ++  S    +L    S         ++IKNL  +ID+  L
Sbjct: 67  IKIMNNTVRLYDRLIKVR--QVTNSTGTTNLPSNISKDMILPIAKLFIKNLADSIDSDQL 124

Query: 143 HETFSTFGNILS-CKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
            + F+ FG ++   ++    NG  +   +V+FE+   A  AI++++  L+ +  + V
Sbjct: 125 VKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFEDFEKADLAIKSLNNQLVANNRITV 180

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 74/178 (41%), Gaps = 6/178 (3%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK-LRGFGFVNFEDHAAAAKAVDEL 279
           VYV NID   ++E+  ELF +   +      KD   +  +G+ F+ F +   A  A+  +
Sbjct: 11  VYVGNIDPRITKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIM 70

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLK 339
           N       +L   R          L        +  +AK     LF+KNL DSID ++L 
Sbjct: 71  NNTVRLYDRLIKVRQVTNSTGTTNLPSNISKDMILPIAK-----LFIKNLADSIDSDQLV 125

Query: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 397
           + F  FG +     +   +       +V F   E+A  AI   N Q+VA   + V  A
Sbjct: 126 KIFNKFGKLIREPEIFYLSNGKLKCAYVYFEDFEKADLAIKSLNNQLVANNRITVDYA 183

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 86/169 (50%), Gaps = 15/169 (8%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A++YVG ++  V++ LLY++F+ +G V  ++  +D I+    G+A++ F         + 
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLN 65

Query: 98  QLNYTL-IKGKPCRIMWS----QRDPSLRKK-------GSGNIYIKNLHPAIDNKSLHET 145
            +N  + +  K  +I  S    Q+D + +K            +++K++   ++ + L + 
Sbjct: 66  VMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRHLTQL 125

Query: 146 FSTFGNILSC-KVATDENGVSRGFGFVHFENESDARDAIEAVDG-MLMN 192
           FS FG +    +V T  NG  R   F++F+   +A  AI+ ++G  +MN
Sbjct: 126 FSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMN 173

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 89/188 (47%), Gaps = 9/188 (4%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK-LRGFGFVNFEDHAAAAKAVDEL 279
           +YV NID + ++E   ELF + G++      KD   +  +GF F+ F   A A   ++ +
Sbjct: 8   IYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

Query: 280 NE-LEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKL 338
           N  ++   + L + R+ +  ++    KK    A L  +AK     +FVK++ D+++   L
Sbjct: 68  NNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAK-----VFVKDIADTVEVRHL 122

Query: 339 KEEFAPFGTIT-SAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIA 397
            + F+ FG +  + +V     G  R   F+ F   + A  AI   N Q +  K   +  A
Sbjct: 123 TQLFSKFGPLAKTPEVFTVSNGEVRC-AFIYFKFYDNADLAIQTLNGQFIMNKKASLEYA 181

Query: 398 QRKEVRRN 405
            ++  R+N
Sbjct: 182 FKENGRKN 189

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 76/168 (45%), Gaps = 19/168 (11%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIE 184
             IY+ N+   +  + L+E F+  G +   K   D+ +   +GF F+ F + +DA    +
Sbjct: 6   ATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADA----D 61

Query: 185 AVDGMLMNDQEVYVAL-------HVSKKDRQSKLEEVKAKF---TNVYVKNIDQETSQEE 234
            V  ++ N+ ++Y  +          +KD  +K  E+ A       V+VK+I        
Sbjct: 62  YVLNVMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASLLPVAKVFVKDIADTVEVRH 121

Query: 235 FEELFGKYGKI--TSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
             +LF K+G +  T  V    S G++R   F+ F+ +  A  A+  LN
Sbjct: 122 LTQLFSKFGPLAKTPEVFTV-SNGEVRC-AFIYFKFYDNADLAIQTLN 167

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 116/288 (40%), Gaps = 40/288 (13%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           + +KNL P  ++  +   F T G+IL   V    +G S+    + F   S    A+ AV 
Sbjct: 39  VLVKNLPPNYNHHKVRRYFKTCGSILQIDVTDSTDGDSK-LARIEF---SSYDQALTAVS 94

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKY--GKI 245
             L       +  H      Q  +E++    + ++V N        +   L  +Y    I
Sbjct: 95  RTLKK-----IGFH------QITVEQLTD--STIWVTNFPPGYDASKLRNLLSQYIDSPI 141

Query: 246 TSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELK 305
            S  L   +    R F +V+      A KA + LN +E    KL V +     ER +   
Sbjct: 142 LSIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKL-VAKISNVNERTERTD 200

Query: 306 KQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DET--GNSR 362
                      A   G  + VKNL D I  + L + F  FG    A+++  DET  G   
Sbjct: 201 N----------AISDGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHS 250

Query: 363 GFGFVCFSTPEEATKAITEKNQQIVAGKPLYV------AIAQRKEVRR 404
            + F+ F     A  A++  N  ++ GKPL+V      A  +R+EV+R
Sbjct: 251 RYAFITFKNKASADNALS-LNGAVMNGKPLHVSKVMRKAYLERQEVKR 297

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 131/316 (41%), Gaps = 38/316 (12%)

Query: 113 WSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFV 171
           WS  +        GN+Y++ +   +  + L   F+ FG IL  K+  D N   S GFGFV
Sbjct: 178 WSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFV 237

Query: 172 HFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQ--------SKLEEVKAKFTNVYV 223
            +   S A + I+ ++G LMN   ++V  HV +K+R+           +E   KF  V+V
Sbjct: 238 SYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERIHFDQWKQNEQEESTKFKGVFV 297

Query: 224 KNIDQETSQEEFEELFGKYGKITSAVLEK------DSEGKLRGFGFVNFEDHAAAAKAVD 277
            N+   T++ +            S VLEK      D E     F   N + +   ++  +
Sbjct: 298 GNLPIFTTENKL--------LTPSIVLEKFKKALPDCEMVSYFFPKTNSQTNVEYSETDE 349

Query: 278 EL---NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV---NLFVKNLDD 331
           +    + L    +   V       E  +   ++ E  +L+ + K+      ++ +KN   
Sbjct: 350 DSKSESPLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIEKHHDNGDEDIVMKNDAT 409

Query: 332 SIDDEKLKEEFAPFGTITSAKVMRDETGNS-------RGFGFVCFSTPEEATKAITEKNQ 384
           +  D ++ +  +     T A    +ET +S       +G+GF  F+T E A K I   N 
Sbjct: 410 TSSDTEVPKSSSSSDDETEA--TNEETCSSQNEESPLKGYGFFRFATHEMALKCIETFND 467

Query: 385 QIVAGKPLYVAIAQRK 400
               G  L V  A +K
Sbjct: 468 SQWYGHQLVVNKAIQK 483

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 53/98 (54%), Gaps = 17/98 (17%)

Query: 320 QGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM---------------RDET-GNSRG 363
           Q  NL+VK+L     DE L + F  FG I SAK++               +DE  G S+G
Sbjct: 728 QESNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKG 787

Query: 364 FGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 400
           +GFVCF  P +A++A+   +  ++ +   L+V+ AQR+
Sbjct: 788 YGFVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRR 825

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 20/112 (17%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT---------DEN-------GVSRGFG 169
            N+Y+K+L     ++ L++ F  FG I+S K+ T         D++       G S+G+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 170 FVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK-LEEVKAKFTN 220
           FV F+N  DA  A+   DG+ +N       L VS   R+SK ++ +K   +N
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNT---LFVSFAQRRSKSIDSIKGPVSN 838

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 55/104 (52%), Gaps = 17/104 (16%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSA--------VLEKDSE--------GKLRGFG 262
           +N+YVK++  +   E+  + F K+G+I SA        + E+D +        GK +G+G
Sbjct: 730 SNLYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYG 789

Query: 263 FVNFEDHAAAAKAVDELNELEFKGQK-LYVGRAQKKYERLQELK 305
           FV F++   A++A+   + L+      L+V  AQ++ + +  +K
Sbjct: 790 FVCFQNPLDASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIK 833

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%)

Query: 28  SETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFH 87
           SE P       +LYV  +   +++  L  IF+  G +  +++  D+ TN S+G+ +V++ 
Sbjct: 181 SENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYA 240

Query: 88  DHEAGPKAIEQLNYTLIKGKPCRIMW 113
                   I++LN  L+ G P  + +
Sbjct: 241 LGSQASNCIKELNGNLMNGSPLFVNY 266

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 252 KDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQE 303
           ++ E  L+G+GF  F  H  A K ++  N+ ++ G +L V +A +K+ + Q 
Sbjct: 438 QNEESPLKGYGFFRFATHEMALKCIETFNDSQWYGHQLVVNKAIQKFHQHQH 489

>Scas_705.22
          Length = 869

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 8/173 (4%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD------ENGVSRGFGFVHFENESDAR 180
           +I+IKNL+    +  L + F TF   +  +V T       +  +S GFGF  F  +  A 
Sbjct: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701

Query: 181 DAIEAVDGMLMNDQEVYVAL--HVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
             I A+DG +++   + + L       +  S  +  K K   + VKN+  E ++++  EL
Sbjct: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFEL 761

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
           F  +G++ S  + K  +   RGF FV F     A  A+D+L  +   G++L +
Sbjct: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 313 LEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFST 371
           +EK++K     LF++N+  +  ++  ++ F PFG +    V  D  TG S+GF ++ F  
Sbjct: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377

Query: 372 PEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR 404
           P+EA +A  E ++QI  G+ L++  A  K+  R
Sbjct: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 87/417 (20%), Positives = 160/417 (38%), Gaps = 61/417 (14%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91
           K+  +G  L++  +  T +E     +F P G +  + V  D  T  S G+AY+ F D + 
Sbjct: 322 KISKTG-RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKE 380

Query: 92  GPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSL-------HE 144
             +A  +L+  + +G+   I+ +    S R        +KN+ P    + L        +
Sbjct: 381 AVQAYIELDKQIFQGRLLHILPADAKKSHR---LDEFDLKNM-PLKKQRELKKKDNASRQ 436

Query: 145 TFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE--AVDGMLMNDQEVYV---A 199
           TFS     ++            G       +   +  A++    +  ++ D   Y     
Sbjct: 437 TFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKG 496

Query: 200 LHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR 259
           + ++K  +    E+  AK   + VKN    T++EE  ELF  +GK+   ++         
Sbjct: 497 VDLTKFAQTKSPEQRDAKV--ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSG----- 549

Query: 260 GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY-----------------ERLQ 302
               V + D  +   A  +L    FK   +Y+ +  K                   E + 
Sbjct: 550 TIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVV 609

Query: 303 ELKKQY------------EAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITS 350
           E+K               E    E +A    V++F+KNL+ +    +L + F  F     
Sbjct: 610 EVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVV 669

Query: 351 AKVMR-------DETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
           A+V         D+T  S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 670 AQVKTKPDPKHADKTL-SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 66/165 (40%), Gaps = 13/165 (7%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGS--VSSIRVCRD---AITNTSLGYAYVNFHDHEAG 92
            S+++  L  T +   L   F       V+ ++   D   A    S+G+ +  F   E  
Sbjct: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700

Query: 93  PKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIK--------NLHPAIDNKSLHE 144
              I  L+ T+I G   ++  S R  S     S              NL      K + E
Sbjct: 701 NAVISALDGTVIDGHRIQLKLSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFE 760

Query: 145 TFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
            F++FG + S +V    +  +RGF FV F    +A +A++ + G+
Sbjct: 761 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 805

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 324 LFVKNLDDSIDDEKLKEEFA----------PFGT-ITSAKVMRDETGNSRGFGFVCFSTP 372
           + VK L   + D+ LK+ F           P  + IT  K++R+  G SR F F+ +   
Sbjct: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63

Query: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398
           E+A  A+   N   +    L V++A+
Sbjct: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89

 Score = 36.6 bits (83), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 152 ILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKD 206
           I   K+  +  G SR F F+ + NE DA DA+   +G  +N  ++ V++  S  D
Sbjct: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFAD 93

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           E F  FG + S +V +    ++RGF FV F  P+EA  A+
Sbjct: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 799

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 135/313 (43%), Gaps = 33/313 (10%)

Query: 114 SQRDPSLRKKGSGNIYIKNLHPAID----NKSLHETFSTFGNILSCKVATDENGVSRGFG 169
           S  DPS  +  S  I++ +L   +     N S+ + F+ +G I+S KV  D    +R + 
Sbjct: 109 SSDDPSFSRPSSC-IFVASLAATLSDSELNASVTKEFAKYGKIVSVKVLRDP--ANRPYA 165

Query: 170 FVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQE 229
           FV + ++ +A +A+    G  +N++ +       ++ + ++   + + F N     ++ +
Sbjct: 166 FVQYASDDEALNALSQAQGTTLNNRNIRC-----ERAKVNRTVFISSSFANP----LEGK 216

Query: 230 TSQEEFEELFGKYGKITSAVLEKD---------SEGKLRGFGFVNFEDHAAAAKAVDELN 280
            + E+  +L  K+G++   V  +D         SE     F    + D A  A    +LN
Sbjct: 217 LTVEKVVDLMSKFGELEQVVPSRDQMYKKNYYPSEVANSWFIQYAYRDDAIRAYLQMKLN 276

Query: 281 ELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEK--LAK----YQGVNLFVKNLDDSID 334
             E+  +         ++  L    K  E  RLE+    K        ++F+  L+  + 
Sbjct: 277 -YEYMVEWAQNVDVPPRFNLLLSKAKICEKERLERERFGKQPIFIDNKSIFIGQLNFKVT 335

Query: 335 DEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
              L E F+ +G I +  ++  +    + F F+ + TP  A KA+  +N  I   K L+V
Sbjct: 336 KPLLLERFSKYGEIDNCNLIHKQE-QLKCFAFIKYKTPASAAKALERENHSIFVEKILHV 394

Query: 395 AIAQRKEVRRNQL 407
            I +    RR+ +
Sbjct: 395 QIREVSNSRRSSI 407

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           I+I  L+  +    L E FS +G I +C +   +  + + F F+ ++  + A  A+E  +
Sbjct: 325 IFIGQLNFKVTKPLLLERFSKYGEIDNCNLIHKQEQL-KCFAFIKYKTPASAAKALEREN 383

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKA 216
             +  ++ ++V +      R+S ++  K+
Sbjct: 384 HSIFVEKILHVQIREVSNSRRSSIDSNKS 412

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/338 (21%), Positives = 138/338 (40%), Gaps = 77/338 (22%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVS-SIRVCR--DA-ITNTSLGYAYVNFHDH 89
            T G+ LY+G+L+P+  EA++  I++ +G  +  +R+    DA     +LGY +V F   
Sbjct: 80  STPGSQLYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSP 139

Query: 90  EAGPKAIEQLNYTLIKG---KPCRIMWSQRDPSLRKKGSG---------------NIYIK 131
                A+ + N   I G   K  ++ WS +       GSG               +I++ 
Sbjct: 140 AHASNALMK-NGMEIPGFVHKKLKLNWSAQS---VNNGSGASVANGAVANQQTNNSIFVG 195

Query: 132 NLHPAIDNKSLHETF-STFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGM 189
           +L P++    L + F + + + +  KV  D+  G+S+G+GFV F++  D + A+  + G 
Sbjct: 196 DLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGC 255

Query: 190 LMNDQEVYVAL-----------------------------------------HVSKKDRQ 208
            +N + + + +                                          V+   +Q
Sbjct: 256 FLNGRAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQ 315

Query: 209 SKLEE-VKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFE 267
             L        T V+V  +    +++E    F  +G I   +  K   GK  G GFV + 
Sbjct: 316 PVLNHFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTI---IYVKIPAGK--GCGFVQYV 370

Query: 268 DHAAAAKAVDELNELEFKGQ--KLYVGRAQKKYERLQE 303
           + ++A  A+ ++          +L  GR+ KK   +Q+
Sbjct: 371 ERSSAETAITKMQGFPIANSRVRLSWGRSAKKTALIQK 408

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 71/151 (47%), Gaps = 8/151 (5%)

Query: 251 EKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEA 310
           + D   K  G+ FV F   A A+ A+ + N +E  G   +V +  K     Q +     A
Sbjct: 121 DADFHRKNLGYCFVEFPSPAHASNALMK-NGMEIPG---FVHKKLKLNWSAQSVNNGSGA 176

Query: 311 ARLEKLAKYQGVN--LFVKNLDDSIDDEKLKEEFA-PFGTITSAKVMRDE-TGNSRGFGF 366
           +        Q  N  +FV +L  S+ + +L + F   + +   AKVM D+ TG S+G+GF
Sbjct: 177 SVANGAVANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGF 236

Query: 367 VCFSTPEEATKAITEKNQQIVAGKPLYVAIA 397
           V F +  +  +A+ E     + G+ + + IA
Sbjct: 237 VKFKSSMDQQRALVEMQGCFLNGRAIKIGIA 267

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/307 (20%), Positives = 114/307 (37%), Gaps = 64/307 (20%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFG--NI---LSCKVATDENGVSRGFGFVHFENESDARDA 182
           +Y+ +L P+ D   +   ++  G  NI   +      D +  + G+ FV F + + A +A
Sbjct: 86  LYMGDLDPSWDEAVVKGIWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNA 145

Query: 183 IEAVDGMLMNDQEVYVALHVSKK---DRQSKLEEVKAKFTN-----------VYVKNIDQ 228
                 ++ N  E+   +H   K     QS      A   N           ++V ++  
Sbjct: 146 ------LMKNGMEIPGFVHKKLKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAP 199

Query: 229 ETSQEEFEELF-GKYGKITSA-VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKG 286
             ++ +  +LF  KY     A V+     G  +G+GFV F+      +A+ E+      G
Sbjct: 200 SVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNG 259

Query: 287 QKLYVGRA---------------------------QKKYERLQELKKQYEAAR-----LE 314
           + + +G A                           Q+      +L +Q+  A      L 
Sbjct: 260 RAIKIGIAGGNNNNNSNSNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLN 319

Query: 315 KLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEE 374
                    +FV  L   + +++L+  F PFGTI   K+        +G GFV +     
Sbjct: 320 HFTDPNNTTVFVGGLSPLVTEDELRSYFEPFGTIIYVKIPA-----GKGCGFVQYVERSS 374

Query: 375 ATKAITE 381
           A  AIT+
Sbjct: 375 AETAITK 381

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 85/184 (46%), Gaps = 5/184 (2%)

Query: 212 EEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
           E++   ++N ++V N+  +   E+ +E F + G++  A +   S G  RG G V F +  
Sbjct: 154 EKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHHRGMGTVEFTNAD 212

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLD 330
              +A+   +      ++++V +     E ++   +     R    A   G  +F+ NL 
Sbjct: 213 DVDEAIRRFDGSTLLDREIFVRQDNPPPESMRAPPR---ERRPRIQASAPGYEVFIANLP 269

Query: 331 DSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGK 390
            S++ + LK+ F   G +  A V  D  G SRG+G V + T EE   AI   N   + G+
Sbjct: 270 YSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGR 329

Query: 391 PLYV 394
            L V
Sbjct: 330 VLDV 333

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 85/194 (43%), Gaps = 32/194 (16%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++I NL  +++ ++L + F   G++L   V  D +G SRG+G V+++ + + + AIE  +
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYN 322

Query: 188 GMLMNDQEVYV--------------ALHVSKKDRQSKL-------EEVKAKFT------- 219
           G  +  + + V                    +D +  L       E +  +FT       
Sbjct: 323 GYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHESLNTEFTEMATGGG 382

Query: 220 ----NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKA 275
                ++V N+   T+Q +  +LF   GK+  A L+    GK  G   V +++ A A   
Sbjct: 383 DQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAAVVEYDNPADAEVC 442

Query: 276 VDELNELEFKGQKL 289
           +  LN   + G+ L
Sbjct: 443 ISRLNSYNYGGRDL 456

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 302 QELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNS 361
           +EL   YE    EK+ +    ++FV NL      E LKE F+  G +  A ++    G+ 
Sbjct: 146 RELDSTYE----EKMNRNYSNSIFVGNLTYDCQPEDLKEYFSQIGEVVRADIIT-SRGHH 200

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           RG G V F+  ++  +AI   +   +  + ++V
Sbjct: 201 RGMGTVEFTNADDVDEAIRRFDGSTLLDREIFV 233

>Kwal_27.12337
          Length = 209

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 22/126 (17%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++YVG ++P V+  +LY++F  I  V+ IR  +D I  T  G+A+V F++ +    A + 
Sbjct: 11  TVYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKC 70

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRK-KGSGN-------------IYIKNLHPAIDNKSLHE 144
           LN +L            R   +RK  G+G+             +++KN+   +D  +L  
Sbjct: 71  LNNSL--------RLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATALTR 122

Query: 145 TFSTFG 150
            FS FG
Sbjct: 123 IFSKFG 128

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 77/175 (44%), Gaps = 15/175 (8%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVDEL 279
           VYV N+D + ++E   ELF +   +      KD   +  +GF FV F +      A   L
Sbjct: 12  VYVGNVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEA--ARLEKLAKYQGVNLFVKNLDDSIDDEK 337
           N             + + Y+R  +++K   A  A   + A   G  LFVKN+D+ +D   
Sbjct: 72  NN------------SLRLYDRTLKVRKANGAGHAPANQNALDVGAKLFVKNIDELVDATA 119

Query: 338 LKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           L   F+ FG +  A  +           +V ++T E + KA+ + N Q+V  K +
Sbjct: 120 LTRIFSKFGPLAKAPEIFYLKQGVLKCAYVSYTTFEHSDKALAKLNNQMVMNKCI 174

 Score = 29.6 bits (65), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 37  GASLYVGELEPTVSEALLYDIFS---PIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           GA L+V  ++  V    L  IFS   P+     I   +  +    L  AYV++   E   
Sbjct: 103 GAKLFVKNIDELVDATALTRIFSKFGPLAKAPEIFYLKQGV----LKCAYVSYTTFEHSD 158

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPS 119
           KA+ +LN  ++  K   + ++ ++ S
Sbjct: 159 KALAKLNNQMVMNKCISLDYALKEGS 184

>Scas_665.4
          Length = 219

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 87/177 (49%), Gaps = 17/177 (9%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            ++YVG ++P V++  LY++F  +  +S +R  +D I     GYA++ F+  +     I+
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQ 69

Query: 98  QLNYTL-IKGKPCRIMWSQRDPSLRKKGSGN--------------IYIKNLHPAIDNKSL 142
            +N T+ +  +  ++  S ++P+    G+                +++KNL  +I+N  L
Sbjct: 70  VMNNTVALYDRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQL 129

Query: 143 HETFSTFGNIL-SCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
            + F  FG +    ++    NG  R   +++F+   ++  AI  ++  L+ ++ + V
Sbjct: 130 IKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRINV 185

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 84/185 (45%), Gaps = 12/185 (6%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVD 277
           T VYV NID + ++E+  ELF +   I+     KD   ++ +G+ F+ F      AK V 
Sbjct: 10  TTVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEF----YTAKDVQ 65

Query: 278 ELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGV----NLFVKNLDDSI 333
            + ++      LY  R  K  + +Q        A   + +    V     LFVKNLD+SI
Sbjct: 66  YVIQVMNNTVALY-DRFLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESI 124

Query: 334 DDEKLKEEFAPFGTI-TSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392
           ++ +L + F  FG +    ++     G  R   ++ F   E +  AI + N +++  K +
Sbjct: 125 ENPQLIKLFQKFGPLFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRI 183

Query: 393 YVAIA 397
            V  A
Sbjct: 184 NVDYA 188

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 83/187 (44%), Gaps = 26/187 (13%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFVHFENESDARDAIEAV 186
           +Y+ N+ P +  + L+E F     I   +   D+   + +G+ F+ F    D +  I+ +
Sbjct: 12  VYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVM 71

Query: 187 DGML-MNDQEVYVALHVSKKDRQSKL----------EEVKAKFTNVYVKNIDQETSQEEF 235
           +  + + D+  ++ +  S ++  S +          + +      ++VKN+D+     + 
Sbjct: 72  NNTVALYDR--FLKVRQSVQNPTSSMGGANTSENSNQSIVLPIAKLFVKNLDESIENPQL 129

Query: 236 EELFGKYGKITSAVLEKD------SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKL 289
            +LF K+G      L KD      S GKLR   ++ F+ +  +  A+ +LN      +++
Sbjct: 130 IKLFQKFGP-----LFKDPEIFFLSNGKLRC-AYIYFKFYENSDMAIAKLNNELIVNKRI 183

Query: 290 YVGRAQK 296
            V  A K
Sbjct: 184 NVDYAFK 190

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 9/105 (8%)

Query: 24  TTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDA----ITNTSL 79
            T+E+    +    A L+V  L+ ++    L  +F   G +      +D     ++N  L
Sbjct: 99  NTSENSNQSIVLPIAKLFVKNLDESIENPQLIKLFQKFGPL-----FKDPEIFFLSNGKL 153

Query: 80  GYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKG 124
             AY+ F  +E    AI +LN  LI  K   + ++ ++ +  K  
Sbjct: 154 RCAYIYFKFYENSDMAIAKLNNELIVNKRINVDYAFKENTSNKNA 198

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 81/192 (42%), Gaps = 10/192 (5%)

Query: 212 EEVKAKFTN-VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHA 270
           E+V   +TN ++V N+  + + E+ ++ F + GK+  A +   S G  RG G V F    
Sbjct: 99  EKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIIT-SRGHHRGMGTVEFTSGE 157

Query: 271 AAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAK--------YQGV 322
              +A+ + +      ++++V +     E          +     + K         +G 
Sbjct: 158 EVDEAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGY 217

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEK 382
            L + NL  SI  + LK  F  FG +  A V  D TG S G G V F   E+  KA    
Sbjct: 218 ELMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHF 277

Query: 383 NQQIVAGKPLYV 394
           N   + GK L V
Sbjct: 278 NGFEIEGKVLEV 289

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 69/178 (38%), Gaps = 32/178 (17%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTS--LGYAYVNFHDHEAGPKAI 96
           S++VG L    +   L D FS +G V    V  D IT+     G   V F   E   +AI
Sbjct: 108 SIFVGNLTYDCTPEDLKDFFSQVGKV----VRADIITSRGHHRGMGTVEFTSGEEVDEAI 163

Query: 97  EQLNYTLI-------------------------KGKPCRIMWSQRDPSLRKKGSGNIYIK 131
            + +   +                          G    +   ++    +KKG   + I 
Sbjct: 164 RKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGY-ELMIL 222

Query: 132 NLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
           NL  +I  ++L   F  FG++L   V  D  G+S G G V F+N+ D   A E  +G 
Sbjct: 223 NLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEHFNGF 280

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 302 QELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNS 361
           +EL   YE    EK+ +    ++FV NL      E LK+ F+  G +  A ++    G+ 
Sbjct: 91  RELDSTYE----EKVNRNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSR-GHH 145

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           RG G V F++ EE  +AI + +   +  + ++V
Sbjct: 146 RGMGTVEFTSGEEVDEAIRKFDGAYLMNRQIFV 178

>KLLA0C14388g complement(1251548..1252159) similar to sp|Q99181
           Saccharomyces cerevisiae YOR319w HSH49 essential yeast
           splicing factor, start by similarity
          Length = 203

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 80/165 (48%), Gaps = 6/165 (3%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCR---DAITNTSLGYAYVNFHDHEAGPKA 95
           ++YVG L+  V+++LLY++F   G +S I+  +   D   +    YA++ F + +     
Sbjct: 4   TVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVC 63

Query: 96  IEQLNYTLIKGKPCRIMWSQRDPSLRKKGSG-NIYIKNLHPAIDNKSLHETFSTFGNIL- 153
               N   + GKP ++  S + P       G  +++KNL  +ID   L   F  FG +L 
Sbjct: 64  KLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAKLFVKNLDESIDVPQLSNIFKIFGKLLR 123

Query: 154 SCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
             +V   +NG  R   +V F     + +A++ ++   + ++ +Y+
Sbjct: 124 KPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYI 167

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 25/191 (13%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD----SEGKLRGFGFVNF--EDHAAAAK 274
           VYV N+D   ++    ELF + G I+     K+     + +   + F+ F  +D     K
Sbjct: 5   VYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVNDDVDYVCK 64

Query: 275 AVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSID 334
             D  N +   G+ L V R+ K          Q E    +      G  LFVKNLD+SID
Sbjct: 65  LFD--NRVSLYGKPLKVRRSNK----------QPETTDFD-----VGAKLFVKNLDESID 107

Query: 335 DEKLKEEFAPFGTIT-SAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLY 393
             +L   F  FG +    +V   + G  R   +V F+T + + +A+ + N+  +A K +Y
Sbjct: 108 VPQLSNIFKIFGKLLRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIY 166

Query: 394 VAIAQRKEVRR 404
           +  A + ++++
Sbjct: 167 IDYAYKDDMQK 177

 Score = 38.1 bits (87), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 79/184 (42%), Gaps = 25/184 (13%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT---DENGVSRG-FGFVHFENESDAR 180
           S  +Y+ NL   ++   L+E F   G I   K      DE+      + F+ F N     
Sbjct: 2   SNTVYVGNLDSRVNKSLLYELFVQAGPISYIKFPKEKQDEDDSQHSKYAFIKFVN----- 56

Query: 181 DAIEAVDGMLMNDQEVY-VALHVSKKDRQSKLE--EVKAKFTNVYVKNIDQETSQEEFEE 237
           D ++ V  +  N   +Y   L V + ++Q +    +V AK   ++VKN+D+     +   
Sbjct: 57  DDVDYVCKLFDNRVSLYGKPLKVRRSNKQPETTDFDVGAK---LFVKNLDESIDVPQLSN 113

Query: 238 LFGKYGKITSAVLEKD-----SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG 292
           +F  +GK+    L K        G LR   +V F     + +A+ +LNE     + +Y+ 
Sbjct: 114 IFKIFGKL----LRKPEVFYLQNGTLRC-AYVWFTTFKHSDEALQQLNETNLANKLIYID 168

Query: 293 RAQK 296
            A K
Sbjct: 169 YAYK 172

 Score = 32.0 bits (71), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 15/99 (15%)

Query: 23  PTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDA----ITNTS 78
           P TT+ +       GA L+V  L+ ++    L +IF   G     ++ R      + N +
Sbjct: 86  PETTDFDV------GAKLFVKNLDESIDVPQLSNIFKIFG-----KLLRKPEVFYLQNGT 134

Query: 79  LGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRD 117
           L  AYV F   +   +A++QLN T +  K   I ++ +D
Sbjct: 135 LRCAYVWFTTFKHSDEALQQLNETNLANKLIYIDYAYKD 173

>Kwal_0.250
          Length = 216

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 92/215 (42%), Gaps = 34/215 (15%)

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDP-SLRKKGSG-------------NIY 129
           V F + E   KAI++ +     G+   +   +  P S+R + SG              I+
Sbjct: 4   VEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYEIF 63

Query: 130 IKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA---- 185
           I NL  +   +SL + F   GN     V  D NG S+GFG V FE   +AR A++     
Sbjct: 64  IANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQHF 123

Query: 186 -VDGMLMNDQEVY-------------VALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETS 231
            ++G ++  +  Y             V+  ++ +   +  E  K+    +YV N+   T+
Sbjct: 124 DLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSN--TIYVDNLPYATA 181

Query: 232 QEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNF 266
           Q +  +LF   G +  A L+ D + K  G   V++
Sbjct: 182 QSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 2/118 (1%)

Query: 262 GFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQG 321
           G V F +    +KA+ + +   F G++L+V   +     ++  +   +   LE+   + G
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERF--HPG 59

Query: 322 VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
             +F+ NL  S   + LK+ F   G  T A V  D  G S+GFG V F T +EA  A+
Sbjct: 60  YEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTAL 117

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 83/218 (38%), Gaps = 20/218 (9%)

Query: 169 GFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT--------N 220
           G V F N      AI+  DG     +E++V             E    K T         
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYE 61

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELN 280
           +++ N+   TS +  ++LF   G  T A ++ D  G+ +GFG V FE    A  A+D+  
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGRSKGFGTVIFETIDEARTALDKFQ 121

Query: 281 ELEFKGQKLYVGRAQKKYER---------LQELKKQYEAARLEKLAKYQGVNLFVKNLDD 331
             + +G+ L + R    +E             +  Q E A  E    ++   ++V NL  
Sbjct: 122 HFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGE---GHKSNTIYVDNLPY 178

Query: 332 SIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCF 369
           +     L + F   G +  A++  D      G   V +
Sbjct: 179 ATAQSDLYDLFETIGVVERAELKYDRKVKPTGAAIVSY 216

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 88/427 (20%), Positives = 156/427 (36%), Gaps = 105/427 (24%)

Query: 26  TESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCR-------DAITNTS 78
           T SE P+      +L++G+L+P+  EA +  ++  +G    +++ R          T+++
Sbjct: 16  TSSEPPR------TLWMGDLDPSFDEATIQHVWLTVGHQVQVKLIRAKKNLLIPCSTSST 69

Query: 79  L----------------------------GYAYVNFHDHEAGPKAIEQLNYTLIKGKPCR 110
           L                            GY +V F + +   +A  QLN T +      
Sbjct: 70  LSASHVDEERIQINGVSFIDPNTTQLHHAGYCFVQFANLQEA-QAGLQLNATPLPNVVSP 128

Query: 111 IMWSQRDPSLRKK-----GSG-------------NIYIKNLHPAIDNKSLHETFST-FGN 151
              +  +P+ ++       SG             ++++ +L P      L   F T F +
Sbjct: 129 TTRNPTNPTGKRNFRLNWASGATLQSDIPATPEFSLFVGDLSPTATEAHLLSLFQTKFKS 188

Query: 152 ILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSK 210
           + + +V TD   G SR FGFV F +E + R A+  ++G+    +++ VA    + +   +
Sbjct: 189 VKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGRQLRVAYATPRNNLLQQ 248

Query: 211 LEEVKAKFTNVYVKNIDQETSQEEFEELFG--KYGKITSAVLEKDSEGKLRGFGFVNFED 268
            +   A            +T  +    L G     ++ +A L +  +  L G        
Sbjct: 249 QQAHPAPPAPPSPPAPPAQTLPDSLGLLVGVPSLAQLDAASLGRAQQPLLLG-------- 300

Query: 269 HAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKN 328
              AA ++   N L                           AA  +  A      +F+  
Sbjct: 301 ---AAGSLVGSNSLPL-------------------------AAPRQLPADTANTTVFIGG 332

Query: 329 LDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVA 388
           L + I + +L   F PFG I S KV        RG GFV F    +A  AI      IV 
Sbjct: 333 LSNMISEGQLHALFMPFGNILSVKV-----PPGRGCGFVRFENRMDAEAAIQGMQGFIVG 387

Query: 389 GKPLYVA 395
           G  + ++
Sbjct: 388 GNAIRLS 394

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 25  TTESETPKVETSGASLYVGELEPTVSEALLYDIF-SPIGSVSSIRVCRDAITNTSLGYAY 83
           T +S+ P   T   SL+VG+L PT +EA L  +F +   SV ++RV  D IT  S  + +
Sbjct: 151 TLQSDIPA--TPEFSLFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGF 208

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWS 114
           V F D +   +A+ ++N    +G+  R+ ++
Sbjct: 209 VRFADEKERRRALAEMNGVWCQGRQLRVAYA 239

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           +T+  ++++G L   +SE  L+ +F P G++ S++V          G  +V F +     
Sbjct: 322 DTANTTVFIGGLSNMISEGQLHALFMPFGNILSVKV------PPGRGCGFVRFENRMDAE 375

Query: 94  KAIEQLNYTLIKGKPCRIMWSQ 115
            AI+ +   ++ G   R+ W +
Sbjct: 376 AAIQGMQGFIVGGNAIRLSWGR 397

>YGR250C (YGR250C) [2197] chr7 complement(991180..993525) Protein
           with three RNA recognition motif (RRM) domains, has
           similarity to human 64K polyadenylation factor [2346 bp,
           781 aa]
          Length = 781

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 95/464 (20%), Positives = 171/464 (36%), Gaps = 114/464 (24%)

Query: 35  TSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPK 94
           T   +++VG +  ++S   L  +FS  G + S+++  D       GY ++++        
Sbjct: 192 TYPGNIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASL 251

Query: 95  AIEQLNYTLIKGKPC------------RIMW-----SQRDPSLRKKGSGNIYIKN----- 132
            I++LN   + G               RI W     +  D + R    GN+   N     
Sbjct: 252 CIKELNGRTVNGSTLFINYHVERKERERIHWDHVKENNNDDNFRCLFIGNLPYHNPEKVE 311

Query: 133 --LHPA----IDNKSLHETFSTF------------------------GNILSCKVATDEN 162
             + P     +  K L + F  F                        G++ S K + + N
Sbjct: 312 TLITPKEVIEVIKKELSKKFPDFDIISYYFPKRSNTRSSSSVSFNEEGSVESNKSSNNTN 371

Query: 163 G------VSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKK--------DRQ 208
           G      + +G+GF+   N   A  AIE  +G + +   + V   V  K        DR 
Sbjct: 372 GNAQDEDMLKGYGFIKLINHEQALAAIETFNGFMWHGNRLVVNKAVQHKVYNNHNSHDRH 431

Query: 209 SKLEEVK----AKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFV 264
             +         +F N  + + +  T        + +Y    +     +    +R F   
Sbjct: 432 PSISNHNDMEVLEFANNPMYDYNNYT--------YDRYYFNNNKNGNSNDTSNVRYF--- 480

Query: 265 NFEDHAAAAKAVDELNELEFKGQKLYVGRAQK-------KYERLQELKKQYEAARLEKLA 317
              D   +    ++++    + +    GR Q+       K++  Q     Y       ++
Sbjct: 481 ---DSVRSTPVAEKMDLFYPQRESFSEGRGQRVPRFMGNKFDMYQYPSTSYSLPI--PMS 535

Query: 318 KYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVM---------RDET---------- 358
             Q  NL+VK++  S  DE L + +  FG I S KV+         R ++          
Sbjct: 536 NQQESNLYVKHIPLSWTDEDLYDFYKSFGEIISVKVITVGGSKNKYRQQSNDSSSDNDLP 595

Query: 359 -GNSRGFGFVCFSTPEEATKAITEKN-QQIVAGKPLYVAIAQRK 400
            G+SRG+GFV F +P +A KAI   +  Q+   + L V+ AQ++
Sbjct: 596 VGSSRGYGFVSFESPLDAAKAILNTDGYQVSKDQVLSVSFAQKR 639

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDET-GNSRGFGFVCFSTPEEATKAITE 381
           N+FV  +  S+   +L   F+ +G I S K++ D+T G   G+GF+ +    +A+  I E
Sbjct: 196 NIFVGGIAKSLSIGELSFLFSKYGPILSMKLIYDKTKGEPNGYGFISYPLGSQASLCIKE 255

Query: 382 KNQQIVAGKPLYVAI-AQRKEVRR 404
            N + V G  L++    +RKE  R
Sbjct: 256 LNGRTVNGSTLFINYHVERKERER 279

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 37/59 (62%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAV 186
           +++  LH A+D   L ++F  +G+I SC++  D++G SRG+GFV F +  D++     +
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 39/58 (67%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITE 381
           LFV  L  ++D+ +L++ F  +G I S +++RD+ G SRG+GFV F++ E++ +   E
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRE 174

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           +  ++V  +     + E ++ F KYG I S  + +D +GK RG+GFV F  +  + +   
Sbjct: 114 YRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFR 173

Query: 278 EL 279
           EL
Sbjct: 174 EL 175

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 97/261 (37%), Gaps = 30/261 (11%)

Query: 168 FGFVHFENESDARDAIEAVDGMLMNDQEVYV------ALHVSKKDRQSKLEEVKAKFTN- 220
            G V F N +D   AI   DG  +N + ++V         +S+    +       +  + 
Sbjct: 1   MGTVEFNNSTDVDTAIRDCDGAFLNGRAIFVRQDNPPPAEISRTGNNNGPPPPPKRAHDE 60

Query: 221 ---VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
              V+V  +    + +E +++F   G +  A +  D +GK RGFG V          A+ 
Sbjct: 61  GFEVFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIR 120

Query: 278 ELNELEFKGQKLYVGRAQKKYERLQELKKQYEAAR----------------LEKLAKYQG 321
                E+KG+ L V   +    R           R                ++ LA   G
Sbjct: 121 HWTGTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTG 180

Query: 322 VN----LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATK 377
            +    +F +N+  S  +  L + F     +   K++ +  G+     +  F TPE+A  
Sbjct: 181 GDRNSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADI 240

Query: 378 AITEKNQQIVAGKPLYVAIAQ 398
            I++ ++       L V  A+
Sbjct: 241 CISKLDKYSYGDHELKVTYAR 261

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/198 (19%), Positives = 77/198 (38%), Gaps = 30/198 (15%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +++  L  +++ + L + F   G++L   V TD +G SRGFG V+   +    DAI    
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGKSRGFGTVYMATKEQQNDAIRHWT 123

Query: 188 GMLMNDQEVYVA---------------LHVSKKDRQSKLEEVKAKFTN------------ 220
           G     + + V                 ++ ++ R      +K K  +            
Sbjct: 124 GTEYKGRVLDVKEGKGTSTRTAATGADTYIPRQPRNEPPATLKPKPLDIDPLAITTGGDR 183

Query: 221 ---VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
              ++ +N+   T++ +  +LFG    +    L  + EG      +  FE    A   + 
Sbjct: 184 NSVIFCENMPSSTTESDLYDLFGSVAPVIITKLLLNPEGHFTRNSYCQFETPEDADICIS 243

Query: 278 ELNELEFKGQKLYVGRAQ 295
           +L++  +   +L V  A+
Sbjct: 244 KLDKYSYGDHELKVTYAR 261

>Kwal_14.1851
          Length = 535

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 125/325 (38%), Gaps = 51/325 (15%)

Query: 39  SLYVGELEPTVSEALLYDIF-SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           SL+VG+L PT +EA L  +F     SV ++RV  D IT  S  + +V F D +   +A+ 
Sbjct: 175 SLFVGDLSPTATEAHLLSLFQKKFKSVKTVRVMTDPITGASRCFGFVRFGDEQERRRALV 234

Query: 98  QLNYTLIKGKPCR---------IMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFST 148
           ++N    +G+  R         +MW     S + + +      +  P   ++S  ++   
Sbjct: 235 EMNGVWCQGRNLRVAYATPRNNVMWQLTQNSHQSQQNDQFLQNDQLPHFQHRSQVQSHHQ 294

Query: 149 FGNILSCKVAT--DENGVSRGFGF---------------------VHFENESDARDAIEA 185
                   ++        S GFG                      +   N S A   ++ 
Sbjct: 295 HHPRHHLNLSQIHQHQHASLGFGSEPAAPSQYQTSAPAFHPNNYQMTQSNYSQAPLLMKT 354

Query: 186 VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAK---FTN-----VYVKNIDQETSQEEFEE 237
            + ++ N+   + A  VS     + + +  A    FTN     V++  +  + S+ +   
Sbjct: 355 ANSLVNNNLINFPASDVSSDHVPAFMAQPTAPRSAFTNPNNTTVFIGGLTSQISERQLHS 414

Query: 238 LFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQ--KLYVGRAQ 295
           LF  +G I +    K   GK  G GFV +     A  A+  +      G   +L  GR  
Sbjct: 415 LFSPFGAIINV---KIPPGK--GCGFVKYAYRIDAEAAIQGMQGFIVGGNPIRLSWGRTS 469

Query: 296 K---KYERLQELKKQYEAARLEKLA 317
               ++  +Q++     AA L + A
Sbjct: 470 ADTGRHSAMQDMPSCLPAANLNRAA 494

 Score = 36.2 bits (82), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           +F+  L   I + +L   F+PFG I + K+        +G GFV ++   +A  AI    
Sbjct: 398 VFIGGLTSQISERQLHSLFSPFGAIINVKIPP-----GKGCGFVKYAYRIDAEAAIQGMQ 452

Query: 384 QQIVAGKPLYVA 395
             IV G P+ ++
Sbjct: 453 GFIVGGNPIRLS 464

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 84/170 (49%), Gaps = 12/170 (7%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVS-SIRVCRDAITNTS-----LGYAYVNFHDHEAGP 93
           LY+G+L P  +E  +  I+S +G  +  +++ + +  N S      GY +V F +  A  
Sbjct: 58  LYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMAAS 117

Query: 94  KAIEQ--LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETF-STFG 150
            A+ +  L   +      ++ W+    +   + +  +++ +L P +    L E F S + 
Sbjct: 118 NALMKSGLRVPMDSNYALKLNWASFATAPGSEFT--LFVGDLAPNVTEAQLFELFISRYS 175

Query: 151 NILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVA 199
           + L+ K+  D+  GVS+G+GFV F NE + + A+  + G  +N + + V 
Sbjct: 176 STLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVG 225

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 87/192 (45%), Gaps = 25/192 (13%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGK-------ITSAVLEKDSEGKLRGFGFVNFEDHAA 271
           T +Y+ +++ + ++ + + ++   G+       I S+   K       G+ FV F +  A
Sbjct: 56  TQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPNQMA 115

Query: 272 AAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDD 331
           A+ A+ +       G ++         +    LK  + +      +++    LFV +L  
Sbjct: 116 ASNALMK------SGLRV-------PMDSNYALKLNWASFATAPGSEF---TLFVGDLAP 159

Query: 332 SIDDEKLKEEF-APFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEKNQQIVAG 389
           ++ + +L E F + + +  +AK++ D+ TG S+G+GFV F    E  +A+ E     + G
Sbjct: 160 NVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNG 219

Query: 390 KPLYVAIAQRKE 401
           + + V    + +
Sbjct: 220 RAIRVGTTSKNK 231

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 76/184 (41%), Gaps = 15/184 (8%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFG------NILSCKVATDENGVSR-GFGFVHFEN 175
           + S  +Y+ +L+P      +   +S  G       ++        + V+  G+ FV F N
Sbjct: 53  QNSTQLYMGDLNPDWTENDIKSIWSMLGEPNVQVKLIKSSNPNKSHAVNNSGYCFVEFPN 112

Query: 176 ESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEF 235
           +  A +A+      +  D       +  K +  S      ++FT ++V ++    ++ + 
Sbjct: 113 QMAASNALMKSGLRVPMDSN-----YALKLNWASFATAPGSEFT-LFVGDLAPNVTEAQL 166

Query: 236 EELF-GKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
            ELF  +Y    +A +  D   G  +G+GFV F +     +A+ E+      G+ + VG 
Sbjct: 167 FELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGRAIRVGT 226

Query: 294 AQKK 297
             K 
Sbjct: 227 TSKN 230

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/350 (20%), Positives = 137/350 (39%), Gaps = 87/350 (24%)

Query: 35  TSGASLYVGELEPTVSEALLYDIFSPIGSVS-SIRVCRDAITNT----------SLGYAY 83
           T+G  LY+G+L+PT  +  +  I++ +G  + ++R+  +   N           + GY +
Sbjct: 51  TTGNQLYMGDLDPTWDKNTVRQIWASLGEANINVRMMWNNTLNNGSRSSMGPKNNQGYCF 110

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKP---CRIMWS--------QRDPSLRKKGSGNIYIKN 132
           V+F        A+ + N  LI   P    ++ W+            +++   + +I++ +
Sbjct: 111 VDFPSSTHAANALLK-NGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGNNCSIFVGD 169

Query: 133 LHPAIDNKSLHETF-STFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDGML 190
           L P +    L E F + + +    K+  D+  G+S+G+GFV F N  + + A+  + G+ 
Sbjct: 170 LAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVF 229

Query: 191 MNDQEVYVA------LHVSKKD----RQSKL--EEVKAKF-------------------- 218
           +N + + V        HVS  +      S L  E V ++F                    
Sbjct: 230 LNGRAIKVGPTSGQQQHVSGNNDYNRSSSSLNNENVDSRFLSKGQSFLSNGNNNMGFKRN 289

Query: 219 -----------------------TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE 255
                                  T V++  +    +++E    F  +G I   V  K   
Sbjct: 290 HMSQFIYPVQQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTI---VYVKIPV 346

Query: 256 GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQ--KLYVGRAQKKYERLQE 303
           GK    GFV + D  +A  A+  +          +L  GR+ K+   LQ+
Sbjct: 347 GKC--CGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQ 394

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 66/141 (46%), Gaps = 12/141 (8%)

Query: 259 RGFGFVNFEDHAAAAKAVDELNEL--EFKGQKLYVGRAQKKYERLQELKKQYEAARLEKL 316
           +G+ FV+F     AA A+ +   L   F  +KL +  A   Y          ++      
Sbjct: 106 QGYCFVDFPSSTHAANALLKNGMLIPNFPNKKLKLNWATSSYSNSNNSLNNVKSGN---- 161

Query: 317 AKYQGVNLFVKNLDDSIDDEKLKEEFAP-FGTITSAKVMRDE-TGNSRGFGFVCFSTPEE 374
                 ++FV +L  ++ + +L E F   + + + AK++ D+ TG S+G+GFV F+  +E
Sbjct: 162 ----NCSIFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDE 217

Query: 375 ATKAITEKNQQIVAGKPLYVA 395
              A++E     + G+ + V 
Sbjct: 218 QQLALSEMQGVFLNGRAIKVG 238

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 25/201 (12%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAV----LEKDSEGKLRGFGFVNFEDHAAAAKAV 276
           ++V N    ++ E  + LF +YG    +V    L+ DS    R F +++F     A  A+
Sbjct: 185 LWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKFDSN---RRFAYIDFASSDEANTAM 241

Query: 277 DELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLD---DSI 333
            +LN     G  L V ++        E  K+ +AA LEK        +F++ LD    S+
Sbjct: 242 SKLNNTSHDGYILVVKKSNP-----HEKSKRTDAATLEKR------EIFIRKLDFYKVSL 290

Query: 334 DD-EKLKEEFAPFGTITSAKVMRDETGNSR--GFGFVCFSTPEEATKAITEKNQQIVAGK 390
               KL E++ P   ++          N +  GF FV ++  E A KA+ E N  +  G+
Sbjct: 291 SKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKAL-ELNMSVFEGR 349

Query: 391 PLYVAIAQRKEVRRNQLAQQI 411
            L V+IA RK     Q  ++I
Sbjct: 350 VLAVSIADRKPYLERQEVKRI 370

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 116/284 (40%), Gaps = 43/284 (15%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIG-SVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAI 96
           A+L+V    P  +   L  +FS  G SV S+R+      +++  +AY++F   +    A+
Sbjct: 183 ATLWVTNFAPNSTVETLKALFSQYGGSVLSVRLPSLKF-DSNRRFAYIDFASSDEANTAM 241

Query: 97  EQLN------YTLIKGKPCRIMWSQRD--PSLRKKGSGNIYIKNL-HPAIDNKSLHETFS 147
            +LN      Y L+  K      S+R    +L K+    I+I+ L    +    L +   
Sbjct: 242 SKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKR---EIFIRKLDFYKVSLSKLTKLVE 298

Query: 148 TFGNILSCKVATDENGVSR-----GFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHV 202
            +G +    +   E+ V+      GF FV + NE  A+ A+E    M + +  V   L V
Sbjct: 299 KYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALEL--NMSVFEGRV---LAV 353

Query: 203 SKKDRQSKLE--EVKAKFTNVYVKN-------IDQETSQEEFEELFGKYGK-----ITSA 248
           S  DR+  LE  EVK        +N          + S+++   L  +        I + 
Sbjct: 354 SIADRKPYLERQEVKRILNTKKPQNDMISMYPFTDKVSKDQLRALITEKASLKDEDIKAI 413

Query: 249 VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVG 292
            L  D EG       +  E    AAK    L+ +EFK + L  G
Sbjct: 414 YLVADHEG-----AVIQLESERIAAKVTMALHGIEFKRKVLKCG 452

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (55%), Gaps = 2/84 (2%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           S+++G L+    E  L+  FSP G V  IR+ RD+ TN   G+AYV F D ++  KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-L 366

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRK 122
           LN   I G   ++  S R  ++RK
Sbjct: 367 LNEKKINGNGRKLRVS-RCKNMRK 389

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKAITE 381
           ++F+ NLD    +E L + F+P G +   +++RD   N  +GF +V F   +   KA+  
Sbjct: 308 SVFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALL- 366

Query: 382 KNQQIVAGKPLYVAIAQRKEVRRNQLAQ 409
            N++ + G    + +++ K +R++Q AQ
Sbjct: 367 LNEKKINGNGRKLRVSRCKNMRKSQPAQ 394

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 29/132 (21%), Positives = 66/132 (50%), Gaps = 16/132 (12%)

Query: 169 GFVHFENESDARDAIEAVDGMLMNDQEVYV--ALHVSKKDRQSKLEEVKAKFTNVYVKNI 226
            ++ ++++S  +  ++ ++G + +D  + +    H +  D +           +V++ N+
Sbjct: 265 AYIVYKDKSALKPLLQHLNGFVFHDHHLRIDSVAHPAPHDNKR----------SVFIGNL 314

Query: 227 DQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVDELNE--LE 283
           D E  +E   + F   G++    + +DS+  + +GF +V F+D  +  KA+  LNE  + 
Sbjct: 315 DFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKAL-LLNEKKIN 373

Query: 284 FKGQKLYVGRAQ 295
             G+KL V R +
Sbjct: 374 GNGRKLRVSRCK 385

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           S++VG L+    E  L+  F P G +  +R+ RD+ TN   G+AYV F D ++  KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 99  LNYTLIKGKPCRIMWSQRDPSLRK 122
               + +GK  R +   R  ++RK
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRK 443

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 51/100 (51%), Gaps = 2/100 (2%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKAITE 381
           ++FV NLD    +E L + F P G I   +++RD   N  +GF +V F   +  +KA+  
Sbjct: 360 SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLL 419

Query: 382 KNQQIVAGKPLY-VAIAQRKEVRRNQLAQQIQARNQMRFQ 420
             ++I  GK    + I++ K +R+ Q  Q     N++  Q
Sbjct: 420 HEKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQ 459

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 35/158 (22%)

Query: 161 ENGVSRGFGFVHFENESDARDAIEA----------------VDGMLMNDQEVYV--ALHV 202
           E  + R   FVH +    +RD+I A                ++G + ND  + V    H 
Sbjct: 294 EEALPRKVAFVH-QKLHKSRDSINAYAVYGSSNPVKIMCQYLNGKVFNDHHLRVDSVTHP 352

Query: 203 SKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGF 261
           S  D++           +V+V N+D E  +E   + F   G I    + +DS+  + +GF
Sbjct: 353 SPHDKRR----------SVFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGF 402

Query: 262 GFVNFEDHAAAAKAVDELNELEF----KGQKLYVGRAQ 295
            +V F+D  + +KA+  L+E +     K +KL + R +
Sbjct: 403 AYVQFKDFQSVSKAL-LLHEKKIHEGKKARKLRISRCK 439

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 91/204 (44%), Gaps = 33/204 (16%)

Query: 221 VYVKNIDQETSQEEFEELF------GKYGKITSAVLEK------DSEGKL---RGFGFVN 265
           V++ N+  +T+QEE            + G++T A + +       ++GK    +GF +V+
Sbjct: 107 VWIGNMAFDTTQEELRRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYVD 166

Query: 266 FEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVN-- 323
           F   +A   AV  L+E +  G+ L +  A           K Y+    +        N  
Sbjct: 167 FA-TSAQMDAVIGLSEAQLNGRNLLIKNA-----------KSYDGRPAKNDLISMSKNPP 214

Query: 324 ---LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVCFSTPEEATKAI 379
              LFV NL     DE LK+ F   G I   ++    ++G  +GF FV F     AT A+
Sbjct: 215 SRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAAL 274

Query: 380 TEKNQQIVAGKPLYVAIAQRKEVR 403
           T+++ + +AG+PL +   + +  R
Sbjct: 275 TDRSCRAIAGRPLRMEYGEDRSKR 298

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    ++ LL   F   G +  IR+     +    G+A+V+F D      A+   
Sbjct: 218 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDR 277

Query: 100 NYTLIKGKPCRIMWSQ 115
           +   I G+P R+ + +
Sbjct: 278 SCRAIAGRPLRMEYGE 293

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 52.0 bits (123), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 98/203 (48%), Gaps = 27/203 (13%)

Query: 221 VYVKNIDQETSQEEFEE-LFGKYGKITSAVLEKD----------SEGKL---RGFGFVNF 266
           V++ N+  +T++E+    + GK       + E+D          ++GK    +GF +V+F
Sbjct: 115 VWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRVNMPLAKNDGKQIKNKGFCYVDF 174

Query: 267 EDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVN-LF 325
           +       A+ +L+E +  G+ L + +  K YE       + +   L  ++K      LF
Sbjct: 175 KTQEQVEAAI-KLSESQLNGRNLLI-KNSKSYE------GRPDKTDLVSMSKNPPSRILF 226

Query: 326 VKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVCFSTPEEATKAITEKNQ 384
           V NL     DE L++ F   G I   ++    ++G  +GF FV F   E AT A+ +K+ 
Sbjct: 227 VGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDKSC 286

Query: 385 QIVAGKPLYVAIAQ---RKEVRR 404
           + +AG+PL +   +   +++VR+
Sbjct: 287 RKIAGRPLRMEFGEDRSKRQVRK 309

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    ++ LL   F   G +  IR+     +    G+A+V+F + E    A++  
Sbjct: 225 LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALKDK 284

Query: 100 NYTLIKGKPCRIMWSQ 115
           +   I G+P R+ + +
Sbjct: 285 SCRKIAGRPLRMEFGE 300

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 20/120 (16%)

Query: 80  GYAYVNFHDHEAGPKAIE----QLN--YTLIK------GKPCR--IMWSQRDPSLRKKGS 125
           G+ YV+F   E    AI+    QLN    LIK      G+P +  ++   ++P  R    
Sbjct: 168 GFCYVDFKTQEQVEAAIKLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSKNPPSRI--- 224

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT-DENGVSRGFGFVHFENESDARDAIE 184
             +++ NL     ++ L + F   G I+  ++AT  ++G  +GF FV F+NE  A +A++
Sbjct: 225 --LFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEGATNALK 282

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 72/166 (43%), Gaps = 20/166 (12%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +++K   P ++   L E FS +G +   K+ +       GF FV FE    A  AI+ V+
Sbjct: 39  LHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPESAEQAIKDVN 91

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS 247
           G +  D  + V+       R             + ++N+ +  + +E ++L  +   + +
Sbjct: 92  GKMFADMPLTVSYSRMPMPR-----------FRIKIRNLPEGIAWQELKDL-ARENNLET 139

Query: 248 AVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
             L  D+     G G + F       +A+++LN  EF+G  L V R
Sbjct: 140 TFLSVDTS-NFDGTGALEFSSEEILEEALEKLNNYEFRGNVLAVER 184

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 7/85 (8%)

Query: 314 EKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPE 373
           E+  +Y    L VK     +++ +L E F+P+G +   K+M        GF FV F  PE
Sbjct: 29  EQEGEYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS-------GFAFVEFEKPE 81

Query: 374 EATKAITEKNQQIVAGKPLYVAIAQ 398
            A +AI + N ++ A  PL V+ ++
Sbjct: 82  SAEQAIKDVNGKMFADMPLTVSYSR 106

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 72/154 (46%), Gaps = 15/154 (9%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V    P V E  L +IFSP G++  +++          G+A+V F   E+  
Sbjct: 33  EYSTTRLHVKPFPPDVEEHELDEIFSPYGALKEVKLMS--------GFAFVEFEKPESAE 84

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
           +AI+ +N  +    P  + +S R P  R +    I I+NL   I  + L +  +   N+ 
Sbjct: 85  QAIKDVNGKMFADMPLTVSYS-RMPMPRFR----IKIRNLPEGIAWQELKD-LARENNLE 138

Query: 154 SCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +  ++ D +    G G + F +E    +A+E ++
Sbjct: 139 TTFLSVDTSNFD-GTGALEFSSEEILEEALEKLN 171

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++VK    +  + E +E+F  YG +    L       + GF FV FE   +A +A+ +
Sbjct: 37  TRLHVKPFPPDVEEHELDEIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKD 89

Query: 279 LNELEFKGQKLYVGRAQKKYERLQ 302
           +N   F    L V  ++    R +
Sbjct: 90  VNGKMFADMPLTVSYSRMPMPRFR 113

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 75/166 (45%), Gaps = 24/166 (14%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +++K   P + +  + E F  FG +   K+         GF FV FE    A  AI+ V 
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKILN-------GFAFVEFEEAESASQAIQNVA 106

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELF--GKYGKI 245
           G +  D  + V    SKK        +K +F  V ++N+ +  + +E ++L    +    
Sbjct: 107 GKMFADYPLEVVF--SKK--------LKPRF-RVIIRNLPEGCAWQELKDLARDNQLETT 155

Query: 246 TSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
            S+V  +D +G     G + F       +A+++LN +EF+G  L V
Sbjct: 156 FSSVNTRDFDGT----GALEFPTEEILQEAIEKLNNIEFRGSVLAV 197

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 70/157 (44%), Gaps = 17/157 (10%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V    P V++A + +IF P G++  I++          G+A+V F + E+  
Sbjct: 48  ELSDTRLFVKPFPPDVTDAEMKEIFEPFGALKEIKILN--------GFAFVEFEEAESAS 99

Query: 94  KAIEQLNYTLIKGKPCRIMWSQR-DPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152
           +AI+ +   +    P  +++S++  P  R      + I+NL      + L +      N 
Sbjct: 100 QAIQNVAGKMFADYPLEVVFSKKLKPRFR------VIIRNLPEGCAWQELKDL--ARDNQ 151

Query: 153 LSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
           L    ++       G G + F  E   ++AIE ++ +
Sbjct: 152 LETTFSSVNTRDFDGTGALEFPTEEILQEAIEKLNNI 188

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 20/120 (16%)

Query: 295 QKKYERLQELKKQYEAA-----------RLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFA 343
           +K YE+  E  K YE A           R++   +     LFVK     + D ++KE F 
Sbjct: 16  EKPYEKPYE--KPYETAPPPQSYENFNNRVDDDEELSDTRLFVKPFPPDVTDAEMKEIFE 73

Query: 344 PFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVR 403
           PFG +   K++        GF FV F   E A++AI     ++ A  PL V  +++ + R
Sbjct: 74  PFGALKEIKIL-------NGFAFVEFEEAESASQAIQNVAGKMFADYPLEVVFSKKLKPR 126

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAV 276
           T ++VK    + +  E +E+F  +G +    +       L GF FV FE+  +A++A+
Sbjct: 52  TRLFVKPFPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEFEEAESASQAI 102

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDEL 279
           +Y+ N+++E ++ +   +F +YG     +L +D + G+ +GF ++ +ED  +   AVD L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLE 314
           N  +  G+ L +     + +R   L+K YEA + E
Sbjct: 93  NGFKIGGRALKIDHTFYRPKR--SLQKYYEAVKEE 125

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 38/74 (51%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A +Y+G L   ++E  +  +FS  G    + + RD  T  S G+AY+ + D  +   A++
Sbjct: 31  AYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVD 90

Query: 98  QLNYTLIKGKPCRI 111
            LN   I G+  +I
Sbjct: 91  NLNGFKIGGRALKI 104

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFVHFENESDARD 181
           K +  IYI NL+  +    +   FS +G  +   ++ DEN G S+GF ++ +E   D R 
Sbjct: 28  KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYE---DQRS 84

Query: 182 AIEAVDGM 189
            I AVD +
Sbjct: 85  TILAVDNL 92

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEK 382
           +++ NL+  + +  +   F+ +G      + RDE TG S+GF ++ +        A+   
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 383 NQQIVAGKPLYV 394
           N   + G+ L +
Sbjct: 93  NGFKIGGRALKI 104

>Scas_717.41
          Length = 379

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/168 (25%), Positives = 77/168 (45%), Gaps = 24/168 (14%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++     +    L+E F+ FG +   K+         GF FV FE    A  AIE V+
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEEVN 137

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKIT- 246
           G    +Q + V          SKL   + + T   ++N+ +  S +E ++L  ++   T 
Sbjct: 138 GKTFANQPLEVVY--------SKLPVKRYRLT---LRNLPEGCSWQELKDLAREHSLETT 186

Query: 247 -SAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
            S+V  +D +G     G + F +      A+++LN +EF+G  + V R
Sbjct: 187 FSSVNTRDFDGT----GALEFANEETLDTALEKLNNIEFRGSVITVER 230

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 42/86 (48%), Gaps = 8/86 (9%)

Query: 322 VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITE 381
             LFV+     + + +L E F PFG +   K++        GF FV F   + A KAI E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN-------GFAFVEFEEADSAAKAIEE 135

Query: 382 KNQQIVAGKPLYVAIAQRKEVRRNQL 407
            N +  A +PL V +  +  V+R +L
Sbjct: 136 VNGKTFANQPLEV-VYSKLPVKRYRL 160

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++V+    +  + E  E+F  +G +    +       L GF FV FE+  +AAKA++E
Sbjct: 83  TRLFVRPFPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEE 135

Query: 279 LNELEFKGQKLYV 291
           +N   F  Q L V
Sbjct: 136 VNGKTFANQPLEV 148

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 8/82 (9%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V      V EA L +IF+P G +  +++          G+A+V F + ++  
Sbjct: 79  ELSTTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKILN--------GFAFVEFEEADSAA 130

Query: 94  KAIEQLNYTLIKGKPCRIMWSQ 115
           KAIE++N      +P  +++S+
Sbjct: 131 KAIEEVNGKTFANQPLEVVYSK 152

>Scas_376.1
          Length = 404

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 103/211 (48%), Gaps = 25/211 (11%)

Query: 221 VYVKNIDQETSQEEFEELF------GKYGKITSAVLEK------DSEGKL---RGFGFVN 265
           V++ N+  +T++EE  +LF       + GK+T   + +       ++GK    +GF +++
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 266 FEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVN-L 324
           F+ +    +++ +L+E +  G+ + + +  K YE       + +   L  L+K      L
Sbjct: 189 FKTNEQM-ESIIKLSESQLNGRNMLI-KDSKSYE------GRPDKNDLVSLSKNPPSRIL 240

Query: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVCFSTPEEATKAITEKN 383
           FV NL     DE LK+ F   G I   ++    ++G  +GF F+ F + E AT A+ +K 
Sbjct: 241 FVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKT 300

Query: 384 QQIVAGKPLYVAIAQRKEVRRNQLAQQIQAR 414
            + +A +P+ +   + +  R+ +    ++ R
Sbjct: 301 CRKIAARPIRMEYGEDRSKRQVKRRDPVEPR 331

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 34/76 (44%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    ++ LL   F   G +  IR+     +    G+A+++F   E    A++  
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDK 299

Query: 100 NYTLIKGKPCRIMWSQ 115
               I  +P R+ + +
Sbjct: 300 TCRKIAARPIRMEYGE 315

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/283 (24%), Positives = 126/283 (44%), Gaps = 42/283 (14%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVS-SIRVCRDAITNTSLGYAYVNFHDHEAGPKAI 96
            +L++    P+ ++  + D+   I  V+ SIR+      NTS  +AY++    E     +
Sbjct: 117 CTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRF-NTSRRFAYIDVTSKEDARYCV 175

Query: 97  EQLN------YTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHP-AIDNKSLHETFSTF 149
           E+LN      YTL+      +  S+R  S   +G   I I+NL    +D   L E+F  F
Sbjct: 176 EKLNGLKIEGYTLVTKVSNPLEKSKRTDSATLEGR-EIMIRNLSTELLDENLLRESFEGF 234

Query: 150 GNI--LSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDR 207
           G+I  ++      E+  +    F+ FEN+  A  A++ ++  L+ ++E+ V+L     D+
Sbjct: 235 GSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERALQ-MNRSLLGNREISVSL----ADK 289

Query: 208 QSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKY---GKITSAVL-----------EKD 253
           +  LE  +       VK +    + +E E L   +    K++ +++           EKD
Sbjct: 290 KPFLERNE-------VKRLLASRNSKELETLICLFPLSDKVSPSLICQFLQEEIHINEKD 342

Query: 254 SEGKLRGFGF----VNFEDHAAAAKAVDELNELEFKGQKLYVG 292
               L    F    + F D   AAK +  LN  +F+G+ +  G
Sbjct: 343 IRKILLVSDFNGAIIIFRDSKFAAKMLMILNGSQFQGKVIRSG 385

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 52/99 (52%), Gaps = 13/99 (13%)

Query: 296 KKYERLQELKKQYEAARLEKLAKY--------QGVN----LFVKNLDDSIDDEKLKEEFA 343
           ++YE L+ +  + E    E+LAK+        QG +    +FV  L   +D+ +L++ F 
Sbjct: 69  QRYEELKTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFI 128

Query: 344 PFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITE 381
            FG I   +++RD+ T   RG+ FV F  PE + KA  E
Sbjct: 129 KFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 7   KTAEQLEQLKIEEQTAPTTTESETPKVETSG-ASLYVGELEPTVSEALLYDIFSPIGSVS 65
           KT    ++ ++EE+ A    E++T    T    +++VG L   V E  L   F   G + 
Sbjct: 75  KTINSRKEQELEEELAKWAPENDTNIQGTDPFRTIFVGRLHYDVDELELQKHFIKFGEIE 134

Query: 66  SIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNY---TLIKGK 107
            +R+ RD ITN   GYA+V F D E   KA  ++      +I+G+
Sbjct: 135 RVRIVRDKITNKPRGYAFVLFRDPECSKKAYREIGVHRGLMIRGR 179

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAV 276
           F  ++V  +  +  + E ++ F K+G+I    + +D    K RG+ FV F D   + KA 
Sbjct: 106 FRTIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAY 165

Query: 277 DEL 279
            E+
Sbjct: 166 REI 168

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 4/78 (5%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEA 185
            I++  LH  +D   L + F  FG I   ++  D+     RG+ FV F +   ++ A   
Sbjct: 108 TIFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYRE 167

Query: 186 VD---GMLMNDQEVYVAL 200
           +    G+++  +   V +
Sbjct: 168 IGVHRGLMIRGRSAIVDI 185

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 92/222 (41%), Gaps = 55/222 (24%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRD------AITNTSL------------- 79
           +L++G+L+P   E ++  I+  +G    +++ +        I +TS+             
Sbjct: 21  TLWMGDLDPGFDELIIASIWQSLGKSVKVKLIKSKTNALVPINSTSIPNNASSNALEING 80

Query: 80  --------------GYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQR--DPSLRK- 122
                         GY +V F   E   +A+  LN T I    C    S+R  D   RK 
Sbjct: 81  VSFIDPNKTNLHHAGYCFVEFESFEDAQQALT-LNATPIPNISCNTTASKRTNDDGKRKF 139

Query: 123 -----KGSG-----------NIYIKNLHPAIDNKSLHETFST-FGNILSCKVATDE-NGV 164
                 G+            ++++ +L P      L   F T + ++ + +V TD   G 
Sbjct: 140 RLNWANGATLHSTILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGA 199

Query: 165 SRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKD 206
           SR FGFV F NE++ R+A+  ++G+    +++ VA    + +
Sbjct: 200 SRCFGFVRFANETERRNALIEMNGVQFQGRQLRVAYATPRNN 241

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 2/92 (2%)

Query: 39  SLYVGELEPTVSEALLYDIF-SPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           SL+VG+L P  +EA L  +F +   SV ++RV  D IT  S  + +V F +      A+ 
Sbjct: 160 SLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALI 219

Query: 98  QLNYTLIKGKPCRIMW-SQRDPSLRKKGSGNI 128
           ++N    +G+  R+ + + R+   ++  SGN+
Sbjct: 220 EMNGVQFQGRQLRVAYATPRNNVAQQHLSGNL 251

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 41/86 (47%), Gaps = 16/86 (18%)

Query: 35  TSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRV-----CRDAITNTSLGYAYVNFHDH 89
            S  +++VG L P ++E  L+++F P G+++ +++     C            +V +++ 
Sbjct: 442 VSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPPGKQC-----------GFVKYNER 490

Query: 90  EAGPKAIEQLNYTLIKGKPCRIMWSQ 115
                AI  L   +I G P R+ W +
Sbjct: 491 LEAEAAINGLQGFIIMGSPIRLSWGR 516

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 64/154 (41%), Gaps = 20/154 (12%)

Query: 167 GFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTN------ 220
           G+ FV FE+  DA+ A+      + N   +      SK+       + +  + N      
Sbjct: 95  GYCFVEFESFEDAQQALTLNATPIPN---ISCNTTASKRTNDDGKRKFRLNWANGATLHS 151

Query: 221 ---------VYVKNIDQETSQEEFEELF-GKYGKI-TSAVLEKDSEGKLRGFGFVNFEDH 269
                    ++V ++    ++ +   LF  KY  + T  V+     G  R FGFV F + 
Sbjct: 152 TILPTPEFSLFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANE 211

Query: 270 AAAAKAVDELNELEFKGQKLYVGRAQKKYERLQE 303
                A+ E+N ++F+G++L V  A  +    Q+
Sbjct: 212 TERRNALIEMNGVQFQGRQLRVAYATPRNNVAQQ 245

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 5/79 (6%)

Query: 317 AKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEAT 376
           A      +FV  L+ +I++ +L E F PFGTIT  K+        +  GFV ++   EA 
Sbjct: 440 AGVSSTTVFVGGLNPNINELQLFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAE 494

Query: 377 KAITEKNQQIVAGKPLYVA 395
            AI      I+ G P+ ++
Sbjct: 495 AAINGLQGFIIMGSPIRLS 513

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE 184
           S  +++  L+P I+   L E F  FG I   K+        +  GFV +    +A  AI 
Sbjct: 444 STTVFVGGLNPNINELQLFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAIN 498

Query: 185 AVDGMLM 191
            + G ++
Sbjct: 499 GLQGFII 505

>Kwal_33.13496
          Length = 330

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAV 186
           ++I  L+P    K L   FS FG I   ++  D E G S  +GF+ F N+S    A   +
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 187 DGMLMNDQEVYV 198
           +G+L++D+ ++V
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 33  VETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAG 92
           ++ S   L++ +L P      L  IFS  G++  + + RD  T  SL Y ++ F +  + 
Sbjct: 242 IKPSEKVLFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSC 301

Query: 93  PKAIEQLNYTLIKGKPCRIMWSQ 115
             A  ++   LI  +   + + Q
Sbjct: 302 EAAYSKMEGVLIDDRRIHVDFCQ 324

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LF+  L+     + L   F+ FGTI   +++RD ETG S  +GF+ F+       A ++ 
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 383 NQQIVAGKPLYVAIAQ 398
              ++  + ++V   Q
Sbjct: 309 EGVLIDDRRIHVDFCQ 324

>Kwal_55.20972
          Length = 135

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 3/83 (3%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A ++VG L   ++E  +  IFS  G    +++ RD  +  S G+AY+ + D  +   A++
Sbjct: 34  AYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVD 93

Query: 98  QLNYTLIKGKPCRI---MWSQRD 117
            LN   I G+  R+   M++ RD
Sbjct: 94  NLNGVKIAGRSIRVDHTMFTPRD 116

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           ++V  + ++ ++ +   +F +YG      L +D E G+ +GF ++ +ED  +   AVD L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 280 NELEFKGQKLYV 291
           N ++  G+ + V
Sbjct: 96  NGVKIAGRSIRV 107

 Score = 33.9 bits (76), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARD 181
           K    I++  LH  +    +   FS +G  +  K+  D E+G S+GF ++ +E   D R 
Sbjct: 31  KDQAYIFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYE---DQRS 87

Query: 182 AIEAVDGM 189
            + AVD +
Sbjct: 88  TVLAVDNL 95

 Score = 32.3 bits (72), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           +FV  L   + +  +   F+ +G     K++RD E+G S+GF ++ +        A+   
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 383 NQQIVAGKPLYV 394
           N   +AG+ + V
Sbjct: 96  NGVKIAGRSIRV 107

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           S++VG L+    E  L+  F P G +  +R+ RD+ TN   G+AYV F D ++  KA+  
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL-- 337

Query: 99  LNYTLIKGKPCRIMWSQR 116
               L+  KP   M SQ+
Sbjct: 338 ----LLNEKP---MKSQK 348

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKAI 379
           ++FV NLD    +E L + F P G I   +++RD   N  +GF +V F   +   KA+
Sbjct: 280 SIFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKAL 337

>Scas_88.1
          Length = 256

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 342 FAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
           F+P+G +    V  D  TG S+GF ++ F  PE A  A  E ++QI  G+ L++  A+ K
Sbjct: 19  FSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEAK 78

Query: 401 EVRR 404
           +  R
Sbjct: 79  KSHR 82

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 16/101 (15%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           ++ K ID       F +LF  YG++    +  D+  G+ +GF ++ F++   A  A  EL
Sbjct: 8   IHCKGID-------FXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIEL 60

Query: 280 NELEFKGQKLYVGRAQ-KKYERLQE-------LKKQYEAAR 312
           ++  F+G+ L++  A+ KK  RL E       LKKQ E  R
Sbjct: 61  DKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKR 101

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%)

Query: 57  IFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQR 116
           +FSP G +  + V  D  T  S G+AY+ F + E    A  +L+  + +G+   I+ ++ 
Sbjct: 18  LFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAEA 77

Query: 117 DPSLR 121
             S R
Sbjct: 78  KKSHR 82

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 88/221 (39%), Gaps = 41/221 (18%)

Query: 144 ETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHV 202
           + FS +G +    VA D   G S+GF ++ F+N  +A DA   +D  +   + +++    
Sbjct: 17  QLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIELDKQIFQGRLLHILPAE 76

Query: 203 SKKDRQSKLEEVKAKFTNVYVK---------NIDQETSQEEFEELFGKYGKITSAVLEKD 253
           +KK    +L+E   K  N+ +K         N  Q+T    +  L+     + S+V  K 
Sbjct: 77  AKKSH--RLDEFDLK--NLPLKKQRELKRKANASQQTFS--WNSLYMNQDAVLSSVASKL 130

Query: 254 SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARL 313
              K       N    +A  +A+ E +          +G  +K +E             L
Sbjct: 131 GMEKSELIDPTN--SGSAVKQALAEAH---------VIGDVRKFFES--------RGVDL 171

Query: 314 EKLAKYQGVN------LFVKNLDDSIDDEKLKEEFAPFGTI 348
            K  +Y+  +      + VKN       E+L E F PFG +
Sbjct: 172 TKFVEYKSPSERDECVMLVKNFPFGTTKEELAELFLPFGKL 212

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 70/156 (44%), Gaps = 15/156 (9%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V      V E+ L +IF P G++  +++          G+A+V F + E+  
Sbjct: 101 ELSNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILN--------GFAFVEFEEAESAS 152

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
           KAIE++N      +P  +M+S+  P  R +    I +KNL      + L +      N L
Sbjct: 153 KAIEEVNGKTFANQPLEVMFSKM-PVKRFR----ITLKNLPEGCSWQELKDLARE--NNL 205

Query: 154 SCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
               ++  +    G G + F  E    DA+E ++ +
Sbjct: 206 ETTFSSVNSRDFDGTGALEFPTEEIMNDALEKLNNI 241

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+     + + +L E F PFG +   K++        GF FV F   E A+KAI E N
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 384 QQIVAGKPLYVAIAQ 398
            +  A +PL V  ++
Sbjct: 160 GKTFANQPLEVMFSK 174

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 73/166 (43%), Gaps = 24/166 (14%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++     +    L+E F  FG +   K+         GF FV FE    A  AIE V+
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKILN-------GFAFVEFEEAESASKAIEEVN 159

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKIT- 246
           G    +Q + V          SK+   + + T   +KN+ +  S +E ++L  +    T 
Sbjct: 160 GKTFANQPLEVMF--------SKMPVKRFRIT---LKNLPEGCSWQELKDLARENNLETT 208

Query: 247 -SAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
            S+V  +D +G     G + F        A+++LN +EF+G  + V
Sbjct: 209 FSSVNSRDFDGT----GALEFPTEEIMNDALEKLNNIEFRGSVISV 250

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++V+    +  + E  E+FG +G +    +       L GF FV FE+  +A+KA++E
Sbjct: 105 TRLFVRPFPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEE 157

Query: 279 LNELEFKGQKLYVGRAQKKYERLQ-ELKKQYEAARLEKL 316
           +N   F  Q L V  ++   +R +  LK   E    ++L
Sbjct: 158 VNGKTFANQPLEVMFSKMPVKRFRITLKNLPEGCSWQEL 196

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 72/168 (42%), Gaps = 24/168 (14%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++     +    L+E F  FG +   K+         GF FV FE    A  AIE V 
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKIT- 246
           G    +Q + V          SKL    AK   + +KN+ +  S ++ ++L  +    T 
Sbjct: 180 GKSFANQPLEVVY--------SKL---PAKRYRITMKNLPEGCSWQDLKDLARENSLETT 228

Query: 247 -SAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
            S+V  +D      G G + F       +A++ LN +EF+G  + V R
Sbjct: 229 FSSVNTRD----FDGTGALEFPSEEILVEALERLNNIEFRGSVITVER 272

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 7/73 (9%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++V+    +  + E  E+FG +G +    +       L GF FV FE+  +AAKA++E
Sbjct: 125 TRLFVRPFPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEFEEAESAAKAIEE 177

Query: 279 LNELEFKGQKLYV 291
           ++   F  Q L V
Sbjct: 178 VHGKSFANQPLEV 190

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+     + + +L E F PFG +   K++        GF FV F   E A KAI E +
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKILN-------GFAFVEFEEAESAAKAIEEVH 179

Query: 384 QQIVAGKPLYVAIAQ 398
            +  A +PL V  ++
Sbjct: 180 GKSFANQPLEVVYSK 194

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 13/100 (13%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V      V E+ L +IF P G +  +++          G+A+V F + E+  
Sbjct: 121 ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILN--------GFAFVEFEEAESAA 172

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL 133
           KAIE+++      +P  +++S+  P+ R +    I +KNL
Sbjct: 173 KAIEEVHGKSFANQPLEVVYSKL-PAKRYR----ITMKNL 207

>Kwal_33.14463
          Length = 393

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVCFSTPEEATKAITEK 382
           LFV NL     DE LK+ F   G I   ++    +TG  +GF FV F   E  T A+ +K
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 383 NQQIVAGKPLYVAIAQ---RKEVRR 404
             + +AG+PL +   +   +++VRR
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQVRR 321

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    ++ LL   F   G +  IR+     T    G+A+V+F D E    A++  
Sbjct: 237 LFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDK 296

Query: 100 NYTLIKGKPCRIMW------------------SQRDPSLRKKGSGN 127
               I G+P R+ +                  S+ +PSLR++ S N
Sbjct: 297 TCRKIAGRPLRMEFGEDRSKRQVRRRAPEAPVSRPEPSLREEHSSN 342

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 9/123 (7%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAI 183
           SG IY+  L      + L + FS FG++   ++A ++  G SR +GFV F N  D+R A 
Sbjct: 124 SGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAY 183

Query: 184 EAVDGMLMNDQEVYVAL--------HVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEF 235
           + ++  L+    + V L         + K  +++ +   KAK +   +K + +E  +E  
Sbjct: 184 DTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQRAFMSPPKAKKSAKELKKLAEEKHKERM 243

Query: 236 EEL 238
           E+L
Sbjct: 244 EKL 246

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 299 ERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE- 357
           ++L   KKQ    + +K +   G+ ++V  L     + +L + F+ FG +   ++ R++ 
Sbjct: 103 KKLDTSKKQKATKKDDKDSDISGI-IYVGRLPKGFHERELSKYFSQFGDLKEVRLARNKK 161

Query: 358 TGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
           TGNSR +GFV F   +++  A    N  ++ G  L V +
Sbjct: 162 TGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRL 200

>Scas_666.11
          Length = 224

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 316 LAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEE 374
           LA+Y  + L+V  L     + +L + F+ FG +   ++ R++ TGNSR +GF+ F+  ++
Sbjct: 89  LAEYSSI-LYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDD 147

Query: 375 ATKAITEKNQQIVAGKPLYVAI 396
           A  A    N  +V G  L V +
Sbjct: 148 ANIAQDAMNNYLVMGHLLQVRL 169

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAI 183
           S  +Y+  L      + L + FS FG++   ++A ++  G SR +GF+ F N+ DA  A 
Sbjct: 93  SSILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQ 152

Query: 184 EAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAK-FTNVYVKNIDQETSQEEFEELFGKY 242
           +A++  L+    + V L + K  +  KL + K + FT + +K   +E  +    +   + 
Sbjct: 153 DAMNNYLVMGHLLQVRL-LPKGAKIEKLYKYKKRAFTQMKIKKTAKELKERAHTKHEERM 211

Query: 243 GKITSA 248
            K+T A
Sbjct: 212 NKLTEA 217

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 51/91 (56%), Gaps = 3/91 (3%)

Query: 25  TTESETPKVETSGASLYVGELEPTVSEALLYDIF-SPIGSVSSIRVCRDAITNTSLGYAY 83
           T +S  P   T   SL+VG+L PT +EA L  +F +   SV ++RV  D +T +S  + +
Sbjct: 181 TLQSSIP--STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGF 238

Query: 84  VNFHDHEAGPKAIEQLNYTLIKGKPCRIMWS 114
           V F D +   +A+ +++    +G+  R+ ++
Sbjct: 239 VRFGDEDERRRALIEMSGKWFQGRALRVAYA 269

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 5/146 (3%)

Query: 260 GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK--YERLQELKKQYEAARLEKLA 317
           G+ FV FE    A  A+  LN             +Q    ++R   L     A     + 
Sbjct: 129 GYCFVEFETQKDAKFAL-SLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIP 187

Query: 318 KYQGVNLFVKNLDDSIDDEKLKEEF-APFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEA 375
                +LFV +L  +  +  L   F   F ++ + +VM D  TG+SR FGFV F   +E 
Sbjct: 188 STPEFSLFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDER 247

Query: 376 TKAITEKNQQIVAGKPLYVAIAQRKE 401
            +A+ E + +   G+ L VA A  + 
Sbjct: 248 RRALIEMSGKWFQGRALRVAYATPRN 273

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 41/98 (41%), Gaps = 6/98 (6%)

Query: 28  SETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFH 87
           S T   + +  +++VG L P  +E  L  +F P G + ++R+             +V F 
Sbjct: 350 SNTYNTDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGK------NCGFVKFE 403

Query: 88  DHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGS 125
                  +I+ L   ++ G P R+ W +   S  K  S
Sbjct: 404 KRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAKTNS 441

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 5/72 (6%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +++  L P      L   F  FG IL+ ++   +N      GFV FE   DA  +I+ + 
Sbjct: 362 VFVGGLVPKTTEFQLRSLFKPFGPILNVRIPNGKN-----CGFVKFEKRIDAEASIQGLQ 416

Query: 188 GMLMNDQEVYVA 199
           G ++    + ++
Sbjct: 417 GFIVGGSPIRLS 428

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 17/146 (11%)

Query: 167 GFGFVHFENESDARDAIEAVDGMLMND-------------QEVYVALHVSKKDRQSKLEE 213
           G+ FV FE + DA+ A+      L N              +  +     S    QS +  
Sbjct: 129 GYCFVEFETQKDAKFALSLNATPLPNFYSPTTNSQTNPTFKRTFRLNWASGATLQSSIPS 188

Query: 214 VKAKFTNVYVKNIDQETSQEEFEELF-GKYGKI-TSAVLEKDSEGKLRGFGFVNFEDHAA 271
              +F+ ++V ++    ++ +   LF  ++  + T  V+     G  R FGFV F D   
Sbjct: 189 T-PEFS-LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDE 246

Query: 272 AAKAVDELNELEFKGQKLYVGRAQKK 297
             +A+ E++   F+G+ L V  A  +
Sbjct: 247 RRRALIEMSGKWFQGRALRVAYATPR 272

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 44/81 (54%), Gaps = 8/81 (9%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           +++  L P +  + L + F  FGNILS K+   +N      GFV FE++ DA  AI+ + 
Sbjct: 469 VFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKN-----CGFVKFEHKIDAEAAIQGLQ 523

Query: 188 GMLMNDQEVYVAL---HVSKK 205
           G ++ +  + ++    HV+K 
Sbjct: 524 GFVLVENPIRLSWGRNHVAKN 544

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/323 (20%), Positives = 123/323 (38%), Gaps = 55/323 (17%)

Query: 128 IYIKNLHPAIDNKSLHETFST-FGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEA 185
           +++ +L P      L   F T F ++ + +V TD   G SR FGFV F NE + R A+  
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 186 VDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL-FGKYGK 244
           ++G+    + + VA       R + +   +    + +  ++    S+ E E+    +Y  
Sbjct: 296 MNGVHFQGRTLRVAY---ATPRSTTVMHTQGNNPHDHHVDVRNTISKAELEKSNLSQY-- 350

Query: 245 ITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQEL 304
           + +A        +LR    ++   +A+  +     N++   G  L  G  Q+ Y   Q  
Sbjct: 351 LMNASNNSQRANQLRSANKMHNYPNASGFQQTHYSNDIN-SGNGLQRGPPQRSYNPGQLH 409

Query: 305 KKQY--------------------EAARLEKLAKYQGVN--------------------L 324
              Y                    +  R + +     VN                    +
Sbjct: 410 YNSYNQPEVNYGTDMSGGYPPNRADLGRKDGMINTSFVNTQVSEAALNDFFATDPTNTTV 469

Query: 325 FVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQ 384
           FV  L  ++ +++L++ F PFG I S K+        +  GFV F    +A  AI     
Sbjct: 470 FVGGLGPTVQEQQLRKIFQPFGNILSIKIPP-----GKNCGFVKFEHKIDAEAAIQGLQG 524

Query: 385 QIVAGKPLYVAIAQRKEVRRNQL 407
            ++   P+ ++   R  V +N +
Sbjct: 525 FVLVENPIRLSWG-RNHVAKNMI 546

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 61/146 (41%), Gaps = 17/146 (11%)

Query: 167 GFGFVHFENESDARDAIEAVDGMLMN-------------DQEVYVALHVSKKDRQSKLEE 213
           G+ FV FE++ DA++ +      L N              Q  +     S    QS +  
Sbjct: 171 GYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGATLQSSIPT 230

Query: 214 VKAKFTNVYVKNIDQETSQEEFEELF-GKYGKI-TSAVLEKDSEGKLRGFGFVNFEDHAA 271
                 +++V ++    ++ +   LF  K+  + T  V+     G  R FGFV F +   
Sbjct: 231 TPEY--SLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEE 288

Query: 272 AAKAVDELNELEFKGQKLYVGRAQKK 297
             +A+ E+N + F+G+ L V  A  +
Sbjct: 289 RRRALIEMNGVHFQGRTLRVAYATPR 314

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 33  VETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAG 92
            + +  +++VG L PTV E  L  IF P G++ SI++             +V F      
Sbjct: 462 TDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGK------NCGFVKFEHKIDA 515

Query: 93  PKAIEQLNYTLIKGKPCRIMW 113
             AI+ L   ++   P R+ W
Sbjct: 516 EAAIQGLQGFVLVENPIRLSW 536

>Kwal_26.7179
          Length = 456

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 53/105 (50%), Gaps = 15/105 (14%)

Query: 11  QLEQLKIEEQTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVC 70
           Q   L+++  T PT  +++         S++VG L+   +E  L+  F   G +  +R+ 
Sbjct: 274 QNHHLRVDSVTHPTQHDNKR--------SVFVGNLDFEETEENLWKHFGKSGDIEYVRLI 325

Query: 71  RDAITNTSLGYAYVNFHDHEAGPKAI----EQLNYTLIKGKPCRI 111
           RD+ TN   G+AYV F D +   KA+    ++LN T   G+  R+
Sbjct: 326 RDSKTNMGKGFAYVQFRDFQTVNKALLLDGQKLNGT---GRKLRV 367

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 68/146 (46%), Gaps = 19/146 (13%)

Query: 169 GFVHFENESDARDAIEAVDGMLMNDQEVYV--ALHVSKKDRQSKLEEVKAKFTNVYVKNI 226
            +V + +++  + A E ++G L  +  + V    H ++ D +           +V+V N+
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPTQHDNKR----------SVFVGNL 300

Query: 227 DQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVDELNELEFK 285
           D E ++E   + FGK G I    L +DS+  + +GF +V F D     KA      L   
Sbjct: 301 DFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKA------LLLD 354

Query: 286 GQKLYVGRAQKKYERLQELKKQYEAA 311
           GQKL     + +  R + +KK + +A
Sbjct: 355 GQKLNGTGRKLRVTRCKNMKKTHSSA 380

 Score = 33.1 bits (74), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 4/112 (3%)

Query: 82  AYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKS 141
           AYV + D  A   A EQLN TL +    R+  S   P+ +     ++++ NL      ++
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVD-SVTHPT-QHDNKRSVFVGNLDFEETEEN 308

Query: 142 LHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMN 192
           L + F   G+I   ++  D +  + +GF +V F +      A+  +DG  +N
Sbjct: 309 LWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKAL-LLDGQKLN 359

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 20/135 (14%)

Query: 262 GFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQG 321
            +V + D AA   A ++LN   F+   L V               Q++  R         
Sbjct: 251 AYVVYADKAAVKIACEQLNGTLFQNHHLRVDSVTHPT--------QHDNKR--------- 293

Query: 322 VNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKAIT 380
            ++FV NLD    +E L + F   G I   +++RD   N  +GF +V F   +   KA+ 
Sbjct: 294 -SVFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALL 352

Query: 381 EKNQQIV-AGKPLYV 394
              Q++   G+ L V
Sbjct: 353 LDGQKLNGTGRKLRV 367

>Kwal_23.5864
          Length = 278

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFST---PEEATKA 378
            +FV  L  ++ + +L++EF  FG I   +V+RD+T N SRG+GF+ F        A + 
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 379 ITEKNQQIVAGKPLYVAIAQRKEVR 403
           I       + G+P+ V I + + V+
Sbjct: 162 IGVHRGVEIGGRPVIVDIERGRTVK 186

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86
           +++VG L  TV+E  L   F   G +  +RV RD  +N S GY ++ F
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMF 149

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEA 185
            +++  L   +    L + F  FG I   +V  D+ +  SRG+GF+ F+ E  AR A   
Sbjct: 102 TVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACRE 161

Query: 186 V 186
           +
Sbjct: 162 I 162

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAV 276
           +  V+V  +    ++ E ++ F ++G+I    + +D +  K RG+GF+ F++   A  A 
Sbjct: 100 YRTVFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTAC 159

Query: 277 DEL 279
            E+
Sbjct: 160 REI 162

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A +Y G L   ++E  +  IFS  G    I++ RD  T  S G+ Y+ + D  +   A++
Sbjct: 34  AYIYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVD 93

Query: 98  QLNYTLIKGKPCRI 111
            LN   I G+  ++
Sbjct: 94  NLNGATIAGRTIKV 107

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGK-LRGFGFVNFEDHAAAAKAVDEL 279
           +Y  ++++E ++ +   +F +YG      L +D E +  +GFG++ +ED  +   AVD L
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNL 95

Query: 280 NELEFKGQKLYVGRA 294
           N     G+ + V  A
Sbjct: 96  NGATIAGRTIKVDHA 110

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 342 FAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ +G     K++RD ET  S+GFG++ +        A+   N   +AG+ + V
Sbjct: 54  FSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKV 107

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAV 186
           IY  +L+  +    +   FS +G  +  K+  D E   S+GFG++ +E   D R  + AV
Sbjct: 36  IYFGSLNKELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYE---DQRSTVLAV 92

Query: 187 DGM 189
           D +
Sbjct: 93  DNL 95

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 7/75 (9%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+     + + +L E F+PFG +   K++        GF FV F   E A KAI E N
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 384 QQIVAGKPLYVAIAQ 398
            +  A +PL V  ++
Sbjct: 130 GKTFANQPLEVVYSK 144

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V      V E+ L +IFSP G +  +++          G+A+V F + E+  
Sbjct: 71  ELSTTRLFVRPFPFDVQESELNEIFSPFGPMKEVKILN--------GFAFVEFEESESAA 122

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDP 118
           KAI+++N      +P  +++S+  P
Sbjct: 123 KAIDEVNGKTFANQPLEVVYSKLPP 147

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++V+    +  + E  E+F  +G +    +       L GF FV FE+  +AAKA+DE
Sbjct: 75  TRLFVRPFPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDE 127

Query: 279 LNELEFKGQKLYV 291
           +N   F  Q L V
Sbjct: 128 VNGKTFANQPLEV 140

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 74/166 (44%), Gaps = 20/166 (12%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++     +    L+E FS FG +   K+         GF FV FE    A  AI+ V+
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKILN-------GFAFVEFEESESAAKAIDEVN 129

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS 247
           G    +Q + V          SKL   + +   + ++N+ +  + +E ++L  +   + +
Sbjct: 130 GKTFANQPLEVVY--------SKLPPQRFR---MILRNLPEGVAWQELKDL-ARENNLET 177

Query: 248 AVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
                ++  +  G G + F       +A+++LN +EF+G  + V R
Sbjct: 178 TFSSVNTR-EFDGTGALEFPTEEILEEALEKLNNIEFRGAVISVER 222

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 51/91 (56%), Gaps = 4/91 (4%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVCFSTPEEATKAITEK 382
           LFV NL     DE L++ F   G I   ++    ++G  +GF F+ F   +  T+A+T+K
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 383 NQQIVAGKPLYVAIAQ---RKEVRRNQLAQQ 410
           + + +AG+PL +   +   +++V+R + + Q
Sbjct: 291 SCRKIAGRPLRMEFGEDRSKRQVKRRENSSQ 321

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 37/76 (48%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    ++ LL   F   G +  +R+     +    G+A+++F D +   +A+   
Sbjct: 231 LFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDK 290

Query: 100 NYTLIKGKPCRIMWSQ 115
           +   I G+P R+ + +
Sbjct: 291 SCRKIAGRPLRMEFGE 306

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 316 LAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEE 374
           L +Y G+ ++V  L     +++L + FA FG +   ++ R++ TGNSR +GF+ F   E+
Sbjct: 86  LEEYSGI-IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKED 144

Query: 375 ATKAITEKNQQIVAGKPLYVAI 396
           A  A    N  ++ G  L V +
Sbjct: 145 AMIAQESMNNYLLMGHLLQVRV 166

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAI 183
           SG IY+  L      K L + F+ FG++   ++A + + G SR +GF+ F N+ DA  A 
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 184 EAVDGMLM 191
           E+++  L+
Sbjct: 150 ESMNNYLL 157

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 80/167 (47%), Gaps = 22/167 (13%)

Query: 257 KLRGFGFVNFEDHAAAAKAVDELNELEFKGQKL-------YVGRAQKKYERLQELKKQYE 309
           K +GF ++ F+ +    KAV EL+E    G+ +       Y GR  K  + L  + K   
Sbjct: 181 KNKGFCYMFFK-NVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDK--DDLVAMSKN-P 236

Query: 310 AARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGFVC 368
            +R+          LFV NL   + D+ L++ F   G I   ++   +++G  +GF F+ 
Sbjct: 237 PSRI----------LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFID 286

Query: 369 FSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQARN 415
           F   E +T  + +K+ + +AG+PL +   + +  R+ +   +  +RN
Sbjct: 287 FKNEEGSTNELKDKSCRKIAGRPLRMEYGEDRSKRQVRKKVENVSRN 333

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 37/76 (48%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L   V++ LL   F   G +  IR+     +    G+A+++F + E     ++  
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNELKDK 300

Query: 100 NYTLIKGKPCRIMWSQ 115
           +   I G+P R+ + +
Sbjct: 301 SCRKIAGRPLRMEYGE 316

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVAT-DENGVSRGFGFVHFENE 176
           +++ NL   + +  L + F   G+I+  ++AT +++G  +GF F+ F+NE
Sbjct: 241 LFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNE 290

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 34/58 (58%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAI 96
           S++VG L+    E  L+  F   GS+  +R+ RD  TN   G+AYV F++ ++  KA+
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL 286

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 10/86 (11%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITE 381
           ++FV NLD   D+E L + F   G+I   +++RD +T   +GF +V F+  +  +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-- 286

Query: 382 KNQQIVAGKPLYVAIAQRKEVRRNQL 407
               ++  KP+   I+Q + +++ +L
Sbjct: 287 ----LLNEKPM---ISQNEHLKKRKL 305

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVDE 278
           +V+V N+D E  +E   + FG  G I    + +D +  + +GF +V F +  + +KA+  
Sbjct: 229 SVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKAL-L 287

Query: 279 LNELEFKGQKLYVGRAQKKYERLQELKK 306
           LNE     Q  ++ + + +  R + ++K
Sbjct: 288 LNEKPMISQNEHLKKRKLRVTRCKNIRK 315

>Kwal_47.18572
          Length = 363

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 7/80 (8%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           LFV+     + D +L E F PFG +   K++        GF FV F   + A +AI E N
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN-------GFAFVEFEEADSAARAIEEVN 136

Query: 384 QQIVAGKPLYVAIAQRKEVR 403
            +  A +PL V  ++ +  R
Sbjct: 137 GKTFANQPLEVVYSKVQPPR 156

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T ++V+    +    E  E+FG +G +    +       L GF FV FE+  +AA+A++E
Sbjct: 82  TRLFVRPFPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEE 134

Query: 279 LNELEFKGQKLYV 291
           +N   F  Q L V
Sbjct: 135 VNGKTFANQPLEV 147

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 69/156 (44%), Gaps = 15/156 (9%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           E S   L+V      V ++ L +IF P G +  +++          G+A+V F + ++  
Sbjct: 78  ELSTTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKILN--------GFAFVEFEEADSAA 129

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
           +AIE++N      +P  +++S+  P   +     + ++NL   +  + L +      N L
Sbjct: 130 RAIEEVNGKTFANQPLEVVYSKVQPPRYR-----MILRNLPDGVAWQELKDLARE--NNL 182

Query: 154 SCKVATDENGVSRGFGFVHFENESDARDAIEAVDGM 189
               ++       G G + F +E    DA++ ++ +
Sbjct: 183 ETTFSSVNTREFDGTGALEFPSEEILEDALQKLNNI 218

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVD 187
           ++++     + +  L+E F  FG +   K+         GF FV FE    A  AIE V+
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKILN-------GFAFVEFEEADSAARAIEEVN 136

Query: 188 GMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS 247
           G    +Q + V          SK++  + +   + ++N+    + +E ++L  +   + +
Sbjct: 137 GKTFANQPLEVVY--------SKVQPPRYR---MILRNLPDGVAWQELKDL-ARENNLET 184

Query: 248 AVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
                ++  +  G G + F        A+ +LN +EF+G  +   R
Sbjct: 185 TFSSVNTR-EFDGTGALEFPSEEILEDALQKLNNIEFRGSVITAER 229

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 198 VALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEG 256
           V+  +SK+++ +   +++A   +++V NI  + + E+ E+ F   G+I    L  D + G
Sbjct: 45  VSQKLSKEEKHA--HQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTG 102

Query: 257 KLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
             +G+G++ FE  A   KA+ +LN  E KG+K+ V R
Sbjct: 103 TPKGYGYIEFESPAYREKAL-QLNGGELKGKKIAVSR 138

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 27  ESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86
           E    ++E    S++VG + P V+   + D F   G +  I +  D  T T  GY Y+ F
Sbjct: 53  EKHAHQLEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEF 112

Query: 87  HDHEAGPKAIEQLNYTLIKGK 107
                  KA+ QLN   +KGK
Sbjct: 113 ESPAYREKAL-QLNGGELKGK 132

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAI 379
           +FV N+   +  E++++ F   G I    ++ D  TG  +G+G++ F +P    KA+
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRGFGFVHFENESDARDAI 183
           S +I++ N+ P +  + + + F   G I    +  D N G  +G+G++ FE+ +    A+
Sbjct: 63  SRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKAL 122

Query: 184 EAVDGML 190
           +   G L
Sbjct: 123 QLNGGEL 129

>Scas_643.16
          Length = 448

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 7/101 (6%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA--I 96
           S++VG L+    E  L++ F   G +  +R+ RD  TN   G+AYV F + E+  KA  +
Sbjct: 276 SIFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLL 335

Query: 97  EQLNYTLIKG-----KPCRIMWSQRDPSLRKKGSGNIYIKN 132
            +   T IK      K  R +   R  ++RK  +    IKN
Sbjct: 336 NEKQMTKIKTDKDNKKKGRKLRVTRCKNMRKSNNTVSNIKN 376

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           +FV NLD   D+E L   F   G I   +++RD +T   +GF +V F   E   KA+   
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 383 NQQIV 387
            +Q+ 
Sbjct: 337 EKQMT 341

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 122/268 (45%), Gaps = 21/268 (7%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAIT-NTSLGYAYVNFHDHEAG 92
           E   +++++    PT  +  + +IF     + ++ V   ++  N++  +AYV+  + E+ 
Sbjct: 96  ELKDSTVWMTNYPPTFQQRDIRNIFKD-HKIVALNVRLPSLRFNSNRRFAYVDLPNMESL 154

Query: 93  PKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSG-------NIYIKNLHPAIDNK-SLHE 144
            KAI+ LN   I G   +++  + +P  R K S         I I+NL   +  K +L +
Sbjct: 155 DKAIQLLNGKDING--YKLVVKKSNPENRDKRSDAPVLERREIIIRNLPKTMLVKDTLLD 212

Query: 145 TFSTFGNILSCKVATDE----NGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVAL 200
            F  +G I   ++   +    + ++ G  FV + N  DA+ A+E ++  +++D ++ V L
Sbjct: 213 IFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALE-MNNHVIDDIKISVNL 271

Query: 201 HVSKK--DRQSKLEEVKAKFTNVY--VKNIDQETSQEEFEELFGKYGKITSAVLEKDSEG 256
             S    +R+     + +K T  Y  +  I  +TS+E+          +    L+     
Sbjct: 272 SDSHAYLERKEVNRIINSKHTEKYAAIYPISDKTSKEQIRNFINDKNAVLVEELKNIYLV 331

Query: 257 KLRGFGFVNFEDHAAAAKAVDELNELEF 284
                 F+ FE  + AAKA+ +LN   F
Sbjct: 332 TDYKAVFLKFERESTAAKAMLQLNNSTF 359

>KLLA0E00484g complement(45755..46483) similar to sp|P10080
           Saccharomyces cerevisiae YHL034c SBP1 single-strand
           nucleic acid binding protein singleton, start by
           similarity
          Length = 242

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 83/211 (39%), Gaps = 45/211 (21%)

Query: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT--DENGVSRGFGFVHFENESDARDAIE 184
           +I++ NL P    + L + F   G  +  ++ T   +    R F FV F+++ D  D   
Sbjct: 18  SIFVGNLSPETSPEDLQKVF---GESVKVEIPTLQSDRTYPRIFAFVTFDDKVDVEDLRS 74

Query: 185 AVDGMLMNDQEVYVALHVSKKDRQSK--------------------------LEEVKAKF 218
             D  ++ D+ +YV   ++ +++Q K                          LE+++   
Sbjct: 75  KFDKTVIKDKSIYVTKVLTPEEQQLKKQKRRANQRGKAVPAPPKKNKEAQVPLEQMERSK 134

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLE----KDSEGKL--------RGFGFVNF 266
             +YV NI   T++ E    FG   +  S +L     KD+  K         RG  FV+F
Sbjct: 135 DTLYVNNIPYHTTKAEIASFFGTTEE--SVILPMRRMKDTTTKRVFFSRKFNRGIAFVSF 192

Query: 267 EDHAAAAKAVDELNELEFKGQKLYVGRAQKK 297
            +         E N   F+ ++L V  A  K
Sbjct: 193 PEGTDIEAKAAEFNGKNFEDRELTVDVAANK 223

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDE 278
           T+++V N+  ETS E+ +++FG+  K+    L+ D     R F FV F+D         +
Sbjct: 17  TSIFVGNLSPETSPEDLQKVFGESVKVEIPTLQSD-RTYPRIFAFVTFDDKVDVEDLRSK 75

Query: 279 LNELEFKGQKLYVGRAQKKYERLQELKKQYEAA 311
            ++   K + +YV +     E  Q+LKKQ   A
Sbjct: 76  FDKTVIKDKSIYVTKVLTPEE--QQLKKQKRRA 106

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 1/79 (1%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAV 186
           +++  L+P      L   F+ FG++ S ++  D ++G S G+GFV F  ++    A   +
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 187 DGMLMNDQEVYVALHVSKK 205
           DG L++D+ V+V    S K
Sbjct: 292 DGALIDDRRVHVDFSQSLK 310

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+V +L P    A L  +F+  G V+S+ + RD  +  SLGY +V F    A   A  ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 100 NYTLIKGKPCRIMWSQ 115
           +  LI  +   + +SQ
Sbjct: 292 DGALIDDRRVHVDFSQ 307

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           LFV  L+       L   FA FG + S +++RD ++G S G+GFV F+T      A T+ 
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 383 NQQIVAGKPLYVAIAQ 398
           +  ++  + ++V  +Q
Sbjct: 292 DGALIDDRRVHVDFSQ 307

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA 95
           ++++G L   V+E  L   FS  G +  +RV RD  T+ S GYA++ F D E G +A
Sbjct: 58  TVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRD-ETGSRA 113

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 16/124 (12%)

Query: 296 KKYERLQELKKQYEAARLEKLAKYQGVN------------LFVKNLDDSIDDEKLKEEFA 343
           KKYE L+  K +      EK  ++   N            +F+  L   + + +L++ F+
Sbjct: 19  KKYEELESAKNEEMGKLHEKTLEWDPENDEHIKGTDPFRTVFIGRLPYEVTEVELQKHFS 78

Query: 344 PFGTITSAKVMRDE-TGNSRGFGFVCF---STPEEATKAITEKNQQIVAGKPLYVAIAQR 399
            FG I   +V+RD+ T  SRG+ F+ F   +    A K I       + G+ + V I + 
Sbjct: 79  RFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAACKEIGVHRGLDIQGRSVIVDIERG 138

Query: 400 KEVR 403
           + V+
Sbjct: 139 RTVK 142

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAV 276
           F  V++  +  E ++ E ++ F ++G+I    + +D S  K RG+ F+ F D   +  A 
Sbjct: 56  FRTVFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRDETGSRAAC 115

Query: 277 DEL---NELEFKGQKLYV----GRAQKKYE--RLQELKKQYEAARLEKLAKYQ 320
            E+     L+ +G+ + V    GR  K ++  RL          + EK+AK+Q
Sbjct: 116 KEIGVHRGLDIQGRSVIVDIERGRTVKYFKPRRLGGGLGGRGYTKREKMAKFQ 168

>Scas_316.1
          Length = 483

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 75/167 (44%), Gaps = 28/167 (16%)

Query: 166 RGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEE----VKAKFTNV 221
           RGFGFV F  E D ++A++      +    + V +   ++DR +K  E     K   T+ 
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDI-AKRRDRSNKPGEGDKPEKKTRTDT 63

Query: 222 YVKNIDQETSQE----------------------EFEELFGKYGKITSAVLEKDSEGKLR 259
             ++ ++E  +E                      + +++F ++G +  A + K  +GKL 
Sbjct: 64  IARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLC 123

Query: 260 GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKK 306
           GF FV  +  +    A++   +L+  G+ + V  A +K  R ++ KK
Sbjct: 124 GFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK-NRWEDYKK 169

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 69/159 (43%), Gaps = 15/159 (9%)

Query: 257 KLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK--YERLQELKKQYEAARLE 314
           K RGFGFV+F       +A+ +  + + KG  L V  A+++    +  E  K  +  R +
Sbjct: 3   KFRGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTD 62

Query: 315 KLAKYQG------------VNLFVKNLDDSIDD-EKLKEEFAPFGTITSAKVMRDETGNS 361
            +A+ +               L ++N+  S  D  +LK+ F+ FGT+  A + +   G  
Sbjct: 63  TIARDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKL 122

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400
            GF FV        T A+       + G+ + V  A +K
Sbjct: 123 CGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK 161

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 25/107 (23%)

Query: 102 TLIKGKPCRIM----WSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKV 157
           +L+KGKP  I+    WS RDP+                      L + FS FG ++   +
Sbjct: 76  SLLKGKPKLIIRNMPWSCRDPN---------------------QLKKIFSRFGTVVEASI 114

Query: 158 ATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSK 204
               +G   GF FV  +  S+   A+E    + ++ + V V   V K
Sbjct: 115 PKKRDGKLCGFAFVTMKKLSNCTIALENTKDLKIDGRSVAVDFAVQK 161

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKE 401
           RGFGFV F+  ++  +A+ +  +  + G  L V IA+R++
Sbjct: 5   RGFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRD 44

>Scas_701.3
          Length = 321

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++++G L    +E  L  +F   G +  IR+ RD +TN S GYA++ F D  +   A ++
Sbjct: 107 TIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

Query: 99  LNYTL---IKGKPC 109
           +       IKG+ C
Sbjct: 167 IGVHRGIDIKGRTC 180

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 41/78 (52%), Gaps = 4/78 (5%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAV 276
           +  +++  +  +T++ E ++LF K+G+I    + +D    K +G+ F+ F D  ++  A 
Sbjct: 105 YRTIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAF 164

Query: 277 DEL---NELEFKGQKLYV 291
            E+     ++ KG+   V
Sbjct: 165 KEIGVHRGIDIKGRTCIV 182

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITE 381
           +F+  L     + +L++ F  FG I   +++RD+ T  S+G+ F+ F  P  +  A  E
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKE 166

>Scas_621.16
          Length = 314

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 4/123 (3%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +Y+G +    +E  + D+ + +G V ++++  D  T  S GYA++ F D E    AI  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 100 NYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVAT 159
           N   +  +  +  +S  +  +    SGN++  N+   +DN   +E  S  G         
Sbjct: 106 NGYQLGSRFLKCGYSSNN-DISASSSGNVHEGNI---LDNDGSYENNSKMGTFSDLPSGV 161

Query: 160 DEN 162
           D N
Sbjct: 162 DVN 164

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           VY+ +I  + ++E+  +L    G + +  +  D + GK +G+ F+ F+D   +A A+  L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 280 NELEFKGQKLYVGRA 294
           N  +   + L  G +
Sbjct: 106 NGYQLGSRFLKCGYS 120

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 57/109 (52%), Gaps = 11/109 (10%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLE-------KDSEGKLRGFGFVNFEDHAAAA 273
           +Y+ N+   +S+E+  E    +   +S ++        + +E +  G  +V+F     A 
Sbjct: 6   IYIANVSYSSSEEDLREFLKDFN-FSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 274 KAVDELNELEFKGQKLYVGRAQKKYERLQELKKQY--EAARLEKLAKYQ 320
           +AV+ELN  EF G+ L V R    Y+  + +K+++  +  +L+K AKY+
Sbjct: 65  RAVEELNGKEFGGRVLRV-RTHNPYQPPKPIKERFGTKLQQLKKFAKYE 112

>Scas_565.8
          Length = 322

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 68/152 (44%), Gaps = 26/152 (17%)

Query: 215 KAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRG-------FGFVNFE 267
           K  FTNV        TS  E EEL   +GK+ S +   +S    RG       + +V FE
Sbjct: 18  KLVFTNVRFN-----TSDAELEELLKPFGKV-SVLTPTESLFGFRGTKVVSIGYAYVIFE 71

Query: 268 DHAAAAKAVDELNELEFKGQKLYV----------GRAQ-KKYERLQELKKQYEAARLEKL 316
               AA A +EL++ EFKG+ LY+           R + KK  R +E     +  + +K+
Sbjct: 72  TPQLAATAFNELHKTEFKGRTLYIKPYEEFIPFGWRTKWKKKVRNEEDAVDTQLIQPKKV 131

Query: 317 AKYQGVN--LFVKNLDDSIDDEKLKEEFAPFG 346
           +K +     L+   L   + DEK++  F  F 
Sbjct: 132 SKKETSTDILYCSKLPKDVTDEKIRALFREFN 163

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 5/93 (5%)

Query: 24  TTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRD-----AITNTS 78
           T  +S    +E +   L    +    S+A L ++  P G VS +               S
Sbjct: 3   TNGDSNVDPIEITTHKLVFTNVRFNTSDAELEELLKPFGKVSVLTPTESLFGFRGTKVVS 62

Query: 79  LGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRI 111
           +GYAYV F   +    A  +L+ T  KG+   I
Sbjct: 63  IGYAYVIFETPQLAATAFNELHKTEFKGRTLYI 95

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           ++   ++ E ++ +   +F ++G  T   L +D E G+ RGFGF+ +ED  +   AVD L
Sbjct: 36  IHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNL 95

Query: 280 NELEFKGQKLYV 291
           N +   G+ L V
Sbjct: 96  NGVNLCGRVLKV 107

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 342 FAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ FG  T  K++RD ETG SRGFGF+ +        A+   N   + G+ L V
Sbjct: 54  FSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVLKV 107

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 4/68 (5%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARD 181
           K    I+   L+  +    +   FS FG     K+  D E G SRGFGF+ +E   D R 
Sbjct: 31  KDQAYIHFSGLNVELTEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYE---DQRS 87

Query: 182 AIEAVDGM 189
            + AVD +
Sbjct: 88  TVLAVDNL 95

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 3/83 (3%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A +++G L   ++E  L  IFS  G    + + RD  T+ S G+A++ + D  +   A++
Sbjct: 34  AYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVD 93

Query: 98  QLNYTLIKGKPCR---IMWSQRD 117
            LN   + G+  +   I ++ RD
Sbjct: 94  NLNGITVAGRQIKVDHIFFTPRD 116

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEG-KLRGFGFVNFEDHAAAAKAVDEL 279
           +++  ++++ ++ +   +F +YG     +L +D E  + +GF F+ +ED  +   AVD L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 280 NELEFKGQKLYV 291
           N +   G+++ V
Sbjct: 96  NGITVAGRQIKV 107

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEK 382
           +F+  L+  + +  L   F+ +G      ++RD ET  S+GF F+ +        A+   
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 383 NQQIVAGKPLYV 394
           N   VAG+ + V
Sbjct: 96  NGITVAGRQIKV 107

 Score = 29.3 bits (64), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 123 KGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARD 181
           K    I+I  L+  +    L   FS +G  +   +  D E   S+GF F+ +E   D R 
Sbjct: 31  KDQAYIFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYE---DQRS 87

Query: 182 AIEAVDGM 189
            I AVD +
Sbjct: 88  TILAVDNL 95

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 8/113 (7%)

Query: 86  FHDHEAGPKAIEQ------LNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDN 139
           F D +A P   ++        +T++  +P R   +++  + R   SG IYI  L      
Sbjct: 33  FSDSDAEPSVTDEQPQPAAAGHTILPQQPARRSGAKKQ-AARTDLSGIIYISRLPHGFHE 91

Query: 140 KSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLM 191
           + L   F+ FG++   ++A + + G SR + F+ F N  DA  A E +   L+
Sbjct: 92  RELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLL 144

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEK 382
           +++  L     + +L   FA FG +   ++ R++ TGNSR + F+ F+ P++A  A    
Sbjct: 80  IYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETM 139

Query: 383 NQQIVAGKPLYVAI 396
           +  ++ G  L V++
Sbjct: 140 HNYLLMGHLLQVSV 153

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAI 96
           S++VG L+   SE  L+  F   G +  +R+ RD  TN   G+AYV F D  +  KA+
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKAL 317

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 9/109 (8%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKL-RGFGFVNFEDHAAAAKAVDE 278
           +V+V N+D E S+E   + F   G I    + +D +  + +GF +V F D  +  KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKAL-L 318

Query: 279 LNELEF---KGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNL 324
           LN+ +    KG+KL V R +     +Q++++Q   A L KL   Q   L
Sbjct: 319 LNDKKMAVGKGRKLRVTRCRN----MQKVQRQSNTAALPKLTDQQKTKL 363

 Score = 36.2 bits (82), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGN-SRGFGFVCFSTPEEATKAITE 381
           ++FV NLD    +E L + F   G I   +++RD   N  +GF +V F+      KA+  
Sbjct: 260 SVFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLL 319

Query: 382 KNQQIVAGK 390
            ++++  GK
Sbjct: 320 NDKKMAVGK 328

>Kwal_55.22147
          Length = 468

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 21/120 (17%)

Query: 221 VYVKNI--DQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVN--FEDHAAAAKAV 276
           V+V NI  D +TS  E    F ++GK TS   E  +      FG+VN  FE+ AA AK  
Sbjct: 7   VFVGNIYNDHDTSLTELYRRFQRFGKCTSDKFESHAH-----FGYVNMEFENEAAFAKLK 61

Query: 277 DELNELEFKGQKLYVGRA----QKKYERLQ--------ELKKQYEAARLEKLAKYQGVNL 324
              N ++FKG  L V  A    Q+++++ Q        E +KQ E ++ E   K + + +
Sbjct: 62  QSFNGVKFKGNILKVDVAKMGWQERWKKDQEEGQHIEEEKQKQMEKSQWEHYKKLENIKM 121

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 80/168 (47%), Gaps = 10/168 (5%)

Query: 250 LEKDSEGKLR--GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQ 307
           L K+   KLR  GF +++F+      +AV  L+E    G+ L +  A   YE   + K  
Sbjct: 160 LTKNDNKKLRNKGFAYIDFKTEKQM-EAVVGLSESALNGRNLLIKNAGS-YEGRPD-KND 216

Query: 308 YEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMR-DETGNSRGFGF 366
             AA     ++     LFV NL     ++ L++ F   G I   ++   ++TG  +GF F
Sbjct: 217 LVAASKNPPSRI----LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAF 272

Query: 367 VCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRKEVRRNQLAQQIQAR 414
           + F     AT A+ +K+ + +A +P+ +   + +  R+ +   ++ AR
Sbjct: 273 IDFKDETGATNALKDKSCRKIASRPIRMEYGEDRSKRQVRRRPELDAR 320

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           L+VG L    +E LL   F   G +  IR+     T    G+A+++F D      A++  
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNALKDK 288

Query: 100 NYTLIKGKPCRIMWSQ 115
           +   I  +P R+ + +
Sbjct: 289 SCRKIASRPIRMEYGE 304

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%)

Query: 323 NLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEA 375
            +FV  L    D+ +L++ FA +G I   +V+RD+   SRG+ FV F   + A
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 33/55 (60%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAA 272
           +  V+V  +  +T + + +++F KYG+I    + +D + K RG+ FV F++  +A
Sbjct: 114 YKTVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLFKETDSA 168

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAG 92
           +++VG L     E  L  +F+  G +  +RV RD   N S GYA+V F + ++ 
Sbjct: 116 TVFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRDK-QNKSRGYAFVLFKETDSA 168

>Scas_709.2*
          Length = 171

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           +Y+  +D+E ++ +   +F +YG     +L  D++ G+ +GF F+ +ED  +   A+D L
Sbjct: 36  IYIGGLDKELTEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNL 95

Query: 280 N 280
           N
Sbjct: 96  N 96

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 9   AEQLEQLKIEE-QTAPTTTESETPKVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSI 67
           A+ ++Q+   E Q+   TTE          A +Y+G L+  ++E  +  +FS  G    +
Sbjct: 4   AKSIQQINERELQSGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPVDL 63

Query: 68  RVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLN 100
            +  D  T  S G+A++ + D  +   AI+ LN
Sbjct: 64  LLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLN 96

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 51/106 (48%), Gaps = 4/106 (3%)

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNIL 153
           K+I+Q+N   ++     I+ +++    + K    IYI  L   +    +   FS +G  +
Sbjct: 5   KSIQQINERELQ---SGILTTEQSWHYQYKDQAYIYIGGLDKELTEGDIISVFSQYGVPV 61

Query: 154 SCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYV 198
              +  D + G S+GF F+ +E++     AI+ ++G+ +    + V
Sbjct: 62  DLLLVNDNQTGESKGFAFLKYEDQRSTVLAIDNLNGVKVGSNTIQV 107

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSIDDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
             L +  ++++ D+  L+EE   PF  I    V+R+ ETG SRG  FV FS+ E A +A+
Sbjct: 191 CTLKIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQAL 250

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +Y+G +    +E  + D+ S +G V S+++  D+ T  S GYA+V + D E+   A+  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 100 N 100
           N
Sbjct: 78  N 78

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           VY+ +I  + ++E+  +L    G + S  +  DS+ GK +G+ FV ++D  ++A AV  L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 280 NELEFKGQKLYVG 292
           N  +   + L  G
Sbjct: 78  NGYQLGSRLLKCG 90

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 335 DEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAITEKN 383
           +E++ +  +  G + S K+M D +TG S+G+ FV +   E +  A+   N
Sbjct: 29  EEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLN 78

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 68/307 (22%), Positives = 124/307 (40%), Gaps = 68/307 (22%)

Query: 33  VETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAG 92
           V +  ASL   +L  +V+EA     F   G +S ++V RD    ++  YA+V + +    
Sbjct: 165 VASLAASLTDDDLCVSVTEA-----FKKYGELSMVKVLRDP---SNRPYAFVQYTNDNDA 216

Query: 93  PKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLH-PAIDNKSLHETFSTFGN 151
            +A++Q   TL+ G+  R   ++ + +L       I  +N   P + +  + +  S+FG 
Sbjct: 217 KRALKQAQGTLLNGRTIRCEKAKVNRTLF------ISTRNRKAPEVTSDEIIQLCSSFGE 270

Query: 152 ILSCKVATDENGVSRGF--------GFVHFENESDA-RDAIEAVDGMLMNDQEVYVALHV 202
            L   VA+ E    + +         FV F    DA R  I    G    D  V  A ++
Sbjct: 271 -LEQLVASREYAFKKNYYPIDRSSAWFVQFAYRDDAIRAFINLKPGY---DWTVEWAQNI 326

Query: 203 SKKDRQSKLEEVKAKFT-------------------------------------NVYVKN 225
               R + L + K + T                                     +++V  
Sbjct: 327 EVPKRLNLLRKTKVRGTKSGNSESEEDEEEYEDEDEDEDDEDEDDSRDILIDKKSIFVSQ 386

Query: 226 IDQETSQEEFEELFGKYGKITSA-VLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284
           +D   ++E+  + F K+GK+    ++ KD+  K+  F F+ +E   A A A++  N   F
Sbjct: 387 LDPSVTKEKLTQRFSKHGKVEDVNLIFKDNNTKV--FAFIKYETEEATATALERENHASF 444

Query: 285 KGQKLYV 291
             + ++V
Sbjct: 445 LNRTMHV 451

 Score = 37.7 bits (86), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 54/105 (51%), Gaps = 14/105 (13%)

Query: 117 DP-SLRKKGSGNIYIKNLHPAIDNK----SLHETFSTFGNILSCKVATDENGVSRGFGFV 171
           DP + R + S  +++ +L  ++ +     S+ E F  +G +   KV  D +  +R + FV
Sbjct: 151 DPKTWRGRPSSCVFVASLAASLTDDDLCVSVTEAFKKYGELSMVKVLRDPS--NRPYAFV 208

Query: 172 HFENESDARDAIEAVDGMLMNDQEVYV-------ALHVSKKDRQS 209
            + N++DA+ A++   G L+N + +          L +S ++R++
Sbjct: 209 QYTNDNDAKRALKQAQGTLLNGRTIRCEKAKVNRTLFISTRNRKA 253

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 4/79 (5%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           +FV  LD S+  EKL + F+  G +    ++  +  N++ F F+ + T E    A+  +N
Sbjct: 382 IFVSQLDPSVTKEKLTQRFSKHGKVEDVNLIFKDN-NTKVFAFIKYETEEATATALEREN 440

Query: 384 QQIVAGKPLYVAIAQRKEV 402
                 + ++V   Q +EV
Sbjct: 441 HASFLNRTMHV---QYREV 456

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++Y+G +    +E  + D+   IG V+++++  D  T  S GYA++ F D      A+  
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 99  LN-YTL 103
           LN YTL
Sbjct: 69  LNGYTL 74

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDE 278
            VY+ +I  + ++++  +L    G +T+  +  D + GK +G+ F+ F+D A +A AV  
Sbjct: 9   TVYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRN 68

Query: 279 LNELEFKGQKLYVG 292
           LN      + L  G
Sbjct: 69  LNGYTLGSRSLKCG 82

>Scas_714.59
          Length = 233

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSIDDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
             L +  L+++ D+  L+EE   PF  I    V+R+ ETG S+G  FV FS+ + A KA+
Sbjct: 150 CTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKAL 209

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 33/75 (44%), Gaps = 3/75 (4%)

Query: 116 RDPSLRKKGSGNIYIKNLHPAIDNKSLHETFS-TFGNILSCKVATD-ENGVSRGFGFVHF 173
           RDP  R      + I  L+   D  +L E     F  I  C V  + E G S+G  FV F
Sbjct: 141 RDPRERDDLC-TLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTF 199

Query: 174 ENESDARDAIEAVDG 188
            +E  A  A+  +DG
Sbjct: 200 SSEQMAEKALHFLDG 214

 Score = 30.0 bits (66), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 39/99 (39%), Gaps = 1/99 (1%)

Query: 23  PTTTESETPKVETSGASLYVGELEPTVSEA-LLYDIFSPIGSVSSIRVCRDAITNTSLGY 81
           P++     P+      +L + +L     E  L  ++  P   +    V R+  T  S G 
Sbjct: 135 PSSDAYRDPRERDDLCTLKIMQLNENADENNLREELLFPFAPIQKCVVVRNRETGRSKGL 194

Query: 82  AYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMWSQRDPSL 120
           A+V F   +   KA+  L+         R+ WS+  P +
Sbjct: 195 AFVTFSSEQMAEKALHFLDGRGFMNLILRVEWSKPKPKV 233

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 229 ETSQEEFEELFGKYGKITSAVLEKD-SEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQ 287
           E ++ +   +F +YG      L +D + GK +GFGF+ +ED  +   AVD LN  +  G+
Sbjct: 44  ELTEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGR 103

Query: 288 KLYVGRAQKKYERLQELKKQYEAARLEKLAK 318
            + V  A   + R +  + +YE A  ++L K
Sbjct: 104 LIRVDHA---FYRPRSDEAEYEEAVRQELEK 131

 Score = 34.7 bits (78), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 4/82 (4%)

Query: 109 CRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDEN-GVSRG 167
           C I+  +       K    I    +H  +    +   FS +G  +  K+  D+  G S+G
Sbjct: 17  CGILKPESSWHHEYKDQAYINFGGMHLELTEADILTIFSQYGCPVDIKLVRDQTTGKSKG 76

Query: 168 FGFVHFENESDARDAIEAVDGM 189
           FGF+ +E   D R  I AVD +
Sbjct: 77  FGFLKYE---DQRSTILAVDNL 95

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 342 FAPFGTITSAKVMRDET-GNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           F+ +G     K++RD+T G S+GFGF+ +        A+   N   V G+ + V
Sbjct: 54  FSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRV 107

>Kwal_26.8458
          Length = 219

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAI 183
           SG IY+  L      + L + FS FG++   ++A + + G SR +GFV F N+ D+  A 
Sbjct: 89  SGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQ 148

Query: 184 EAVDGMLM 191
           E +   L+
Sbjct: 149 ETMHNYLL 156

 Score = 36.2 bits (82), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITEK 382
           ++V  L     + +L + F+ FG +   ++ R++ TGNSR +GFV F   E++  A    
Sbjct: 92  IYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVAQETM 151

Query: 383 NQQIVAGKPL-YVAIAQRKEVRR 404
           +  ++ G  L  VA+ + K++ +
Sbjct: 152 HNYLLMGHLLQVVALPKGKKIEK 174

>Kwal_26.7522
          Length = 262

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++Y+G +    +E  + D+ S +G V ++++  D  T  S GYA+V + D EA   A+  
Sbjct: 13  TVYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRN 72

Query: 99  LN 100
           LN
Sbjct: 73  LN 74

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +Y+G +    +E  + D+ S +G V+++++  D  T  S GYA+V + D EA   A+  L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 100 N 100
           N
Sbjct: 75  N 75

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 85/186 (45%), Gaps = 9/186 (4%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFG-NILSCKVATDENGVSRGFGFVHFENESDARDAIEAV 186
           +++ N  P  D + L   F   G   LS ++ +      R F +V   +   A  A   +
Sbjct: 110 LWVTNFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTL 169

Query: 187 DGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNID-QETSQEEFEELFGKYGKI 245
           +GM ++   + V L    + R  + +    +   V ++ +D  + + E+ + L   +G++
Sbjct: 170 NGMDLDGYNLVVKLS-DPESRAQRSDAGTIEKREVLIRGLDFIKVTIEKLQGLVEPFGEV 228

Query: 246 TSAVLEKDSEG----KLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKK-YER 300
              ++   S+       RGF FV ++D AAA  A+   N + F+ ++L V  A +K Y  
Sbjct: 229 EKLIMPPSSDSADGRHNRGFAFVTYKDAAAAEAALALHNTV-FEDRRLTVAMADRKPYLE 287

Query: 301 LQELKK 306
            Q++K+
Sbjct: 288 RQKVKQ 293

>Scas_582.10
          Length = 283

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKI-------TSAVLEKDSEGKLRGFGFVNFEDHAAAA 273
           +YV NI + TSQ +   LF KYGKI        +  + +D +G  +G   V +E   +  
Sbjct: 43  IYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPESVQ 102

Query: 274 KAVDELNELEFKGQKLYVGRAQ 295
            A+D ++   F    + V RAQ
Sbjct: 103 LAIDMVDGTIFNKSTIKVERAQ 124

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNI-------LSCKVATDENGVSRGFGFVHFENES 177
           S  IY+ N+        L   FS +G I       L+CK+  DE G  +G   V +E   
Sbjct: 40  SSAIYVSNISKHTSQLDLITLFSKYGKIRRTREEALNCKMYQDEKGNFKGDALVVYEKPE 99

Query: 178 DARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKA 216
             + AI+ VDG + N   + V      +D + KL++V +
Sbjct: 100 SVQLAIDMVDGTIFNKSTIKVE-RAQFEDNKRKLDDVDS 137

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%)

Query: 40  LYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           +Y+G +    +E  + D+ S +G V ++++  D  T  S GYA++ F D E+   A+  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 100 N 100
           N
Sbjct: 80  N 80

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           VY+ +I  + ++E+  +L    G + +  +  D + G+ +G+ F+ F D  ++A AV  L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 280 NELEFKGQKLYVG 292
           N  +   + L  G
Sbjct: 80  NGYQLGSRFLKCG 92

>Kwal_26.9319
          Length = 273

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 17/116 (14%)

Query: 198 VALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQ------EEFEELFGKYGKITSAVLE 251
           V L++    RQ +++        V V N DQE  Q      EE E+ FGK G ++   ++
Sbjct: 103 VPLNLQGDARQERIKRT------VAVMNFDQENKQDRTELQEEIEQFFGKLGPVSQVRMK 156

Query: 252 KDSEGKLRGFGFVNFEDHAAAAKAVD----ELNELEFKGQKLYVGRAQKKYERLQE 303
           KD      G   V F +   A + +D    +   L F+G+KL    ++K+Y++ +E
Sbjct: 157 KDHRKNFNGTVIVEFAEEKDAQQFIDTYGPDKETLSFQGRKLN-AVSKKQYDQQRE 211

>Scas_530.4
          Length = 684

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 73/341 (21%), Positives = 123/341 (36%), Gaps = 65/341 (19%)

Query: 117 DPSLRKKGSGNIYI----KNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVH 172
           +P+ R + S  +++     NLH      S+ + F  FG I+  KV  D+   +R + FV 
Sbjct: 132 EPTFRGRPSSCVFVASLASNLHDDELCLSVTDYFKKFGEIIRVKVLRDQ--ANRPYAFVQ 189

Query: 173 FENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQ 232
           + N++DA  A++   G ++N              R+ + E  +   T     N   E   
Sbjct: 190 YTNDNDANVALKEAHGSILN-------------GRRLRCERARVNRTLFITHNSPIELF- 235

Query: 233 EEFEELFGKYGKITSAVLEKDSEGKLR-----------GFGFVNFEDHA--AAAKAVDEL 279
            E   +  K+G++   V ++D    +R            F    F D A  A A    + 
Sbjct: 236 -EVHAICRKFGELDQLVPKRDDNPFMRRCSYPISNSSSWFAQFTFRDDAIRAFANLKTDS 294

Query: 280 NELEFKGQKLYVGR--------AQKKYERLQELKKQYEAARLEKLAKYQGVN-------- 323
           N      Q + V +        +    E +     Q + A  +        N        
Sbjct: 295 NWAVQWAQNIRVPKFFNLLNKDSPMDKENITNFNSQEDGADTDPTHDNNLNNDNMQPVTI 354

Query: 324 ----LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
               +FV  L +   +E LK  F+  G I    ++         F F+ + T   A  A+
Sbjct: 355 DKKSIFVGQLPEETTEEVLKIHFSKHGKILDLNLIHKPKN---VFAFIQYETENAAAIAL 411

Query: 380 TEKNQQIVAGKPLYVAIAQRKEV-----RRNQLAQQIQARN 415
             +N  I   K ++V   Q KE+     RRN    Q  + N
Sbjct: 412 ETENHSIFISKTIHV---QYKEIGGIHGRRNSKRSQYFSDN 449

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 35/67 (52%)

Query: 36  SGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA 95
           + A++YVG L    SE  LY++FS  GS+  I +  D    T  G+ ++ +   +    A
Sbjct: 44  TSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAA 103

Query: 96  IEQLNYT 102
           ++ L+ T
Sbjct: 104 LKYLSKT 110

 Score = 36.2 bits (82), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 64/129 (49%), Gaps = 17/129 (13%)

Query: 201 HVSKKDRQSK--LEEVKAKFTN--VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-E 255
           ++ +K R++   LEE++   T+  +YV N+   TS+E+  ELF K G I   ++  D  +
Sbjct: 24  YLKRKARKTPGGLEELRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFK 83

Query: 256 GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV------------GRAQKKYERLQE 303
               GF F+ ++    A  A+  L++ +   +++ +            GR +   +   E
Sbjct: 84  FTPCGFCFIIYQTPQEALAALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDE 143

Query: 304 LKKQYEAAR 312
           L+ +++A+R
Sbjct: 144 LRFEFDASR 152

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 120 LRKK-GSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSR-GFGFVHFENES 177
           LRK   S  IY+ NL      + L+E FS  G+I    +  D    +  GF F+ ++   
Sbjct: 39  LRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQ 98

Query: 178 DARDAIEAVDGMLMNDQEVYVAL 200
           +A  A++ +    ++D+E+ + L
Sbjct: 99  EALAALKYLSKTKLDDREITIDL 121

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 12/88 (13%)

Query: 293 RAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAK 352
           +A+K    L+EL+K   +A            ++V NL     +E+L E F+  G+I    
Sbjct: 28  KARKTPGGLEELRKSMTSA-----------TIYVGNLSFYTSEEQLYELFSKCGSIEKII 76

Query: 353 VMRDETG-NSRGFGFVCFSTPEEATKAI 379
           +  D       GF F+ + TP+EA  A+
Sbjct: 77  MGLDRFKFTPCGFCFIIYQTPQEALAAL 104

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 10/91 (10%)

Query: 316 LAKYQGVN---------LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFG 365
           LAK +G N         ++V  L     + +L + F+ FG +   ++ R++ TGNSR + 
Sbjct: 77  LAKVEGGNESNKEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYA 136

Query: 366 FVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
           F+ F   ++A  A    N  ++ G  L V +
Sbjct: 137 FIEFVNKDDALVAQDTMNNYLILGHLLKVVV 167

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 122 KKGSGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDAR 180
           K+ S  IY+  L      + L + FS FG++   ++A + + G SR + F+ F N+ DA 
Sbjct: 88  KEQSSIIYVSRLPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDAL 147

Query: 181 DAIEAVDGMLM 191
            A + ++  L+
Sbjct: 148 VAQDTMNNYLI 158

>Kwal_55.20414
          Length = 284

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 209 SKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLE------KDSEGKLRGFG 262
           +++ E  ++   +YV N+D  T++EE  E   +Y  ++  +        ++S  +  G G
Sbjct: 7   TQVSEASSQIKRIYVSNLDFSTTEEELSEFLKEYNVVSVLIPSQTIRGFRNSTVRPLGIG 66

Query: 263 FVNFEDHAAAAKAVDELNELEFKGQKLYV 291
           + +F+    A  A   LN  + K +KL +
Sbjct: 67  YADFQSAQDAQNAAQNLNGKQLKDRKLKI 95

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 83/203 (40%), Gaps = 39/203 (19%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-----ENGVSR--GFGFVHFENESDAR 180
           IY+ NL  +   + L E    + N++S  + +       N   R  G G+  F++  DA+
Sbjct: 19  IYVSNLDFSTTEEELSEFLKEY-NVVSVLIPSQTIRGFRNSTVRPLGIGYADFQSAQDAQ 77

Query: 181 DAIEAVDGMLMNDQEVYVALHVS---------KKDRQSKLEEVKAKFT------------ 219
           +A + ++G  + D+++ + ++V          KK++ S  +E +   +            
Sbjct: 78  NAAQNLNGKQLKDRKLKIKIYVPYSPKPSGSRKKEQSSNTQETQPPISEAQAPESQQPAH 137

Query: 220 --------NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAA 271
                    VY   +  + +  E  + F +Y +     + + +  + R +    F     
Sbjct: 138 PNEPVSTDTVYCAYLPSKVTDVELRDFFAEY-QPQDIYVYRSNGSRHRIYLHRRFTAALV 196

Query: 272 AAKAVDELNE-LEFKGQKLYVGR 293
              A D+LNE +E  G + ++G+
Sbjct: 197 TLAAPDKLNEAIETLGSQKFMGK 219

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++Y+G +    +E  + D+ S +G V+ +++  D  T  S GYA++ F D      A+  
Sbjct: 12  TVYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRN 71

Query: 99  LN 100
           LN
Sbjct: 72  LN 73

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDEL 279
           VY+ +I  + ++++  +L    G +T   +  D + GK +G+ F+ F+D A ++ AV  L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 280 NELEFKGQKLYVG 292
           N      + L  G
Sbjct: 73  NGYALGNRTLKCG 85

>ADL126C [1615] [Homologous to ScYFR032C - SH] (469991..471391)
           [1401 bp, 466 aa]
          Length = 466

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 63/160 (39%), Gaps = 40/160 (25%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEG------KLRGFGFVNFEDHAAAAK 274
           VY+ N+ Q+ ++E   E    +  ++  +  +   G      +  G  +V F+D   AAK
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEFKDADTAAK 110

Query: 275 AVDELN-------------ELEFKGQKLYVGRAQKKY----ERLQELKK----------- 306
            + ELN              + FK +K  + R   K+     RL EL++           
Sbjct: 111 VILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRRNSDAGATVTT 170

Query: 307 ----QYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEF 342
               Q +AA + +  +   V ++V  L     D+ L+  F
Sbjct: 171 DNGPQVDAAAVPR--EMSKVTIYVGRLPGRTTDKDLRTYF 208

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 42/248 (16%), Positives = 90/248 (36%), Gaps = 53/248 (21%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSR------GFGFVHFENESDARD 181
           +YI NL      ++L E    F  +     +    G  +      G  +V F++   A  
Sbjct: 51  VYISNLSQDATEEALTEFLKDFHPVSVLIPSQSVRGFQKTSVRPLGIAYVEFKDADTAAK 110

Query: 182 AIEAVDGMLMNDQEVYVALHVSKKDRQSKL-------EEVKAKFTNVYVKN--------- 225
            I  ++G+   D+E+ +  H+  K  + KL        +++ + + +  +N         
Sbjct: 111 VILELNGVTFMDRELRLRYHIPFKSEKEKLARGPNKFRQIQRRLSELRRRNSDAGATVTT 170

Query: 226 -----IDQETSQEEFEELFGKYGKITSAVLEKD----------------SEGKLRGF--- 261
                +D      E  ++    G++     +KD                   + RG+   
Sbjct: 171 DNGPQVDAAAVPREMSKVTIYVGRLPGRTTDKDLRTYFHEYLPQEIIVFKHRQFRGWRIR 230

Query: 262 -----GFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKL 316
                  + F DH     A++ L+ L F G+ + +  A +  ++L E++ + +   +E+ 
Sbjct: 231 RHVTAAVITFPDHERQESALESLSNLPFNGRTVRMAPAFE--DKLAEIRAEVQRMAVEQQ 288

Query: 317 AKYQGVNL 324
                 NL
Sbjct: 289 LPQPASNL 296

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%)

Query: 36  SGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKA 95
           S A++YVG L    SE  +Y++FS  G++  I +  D    T  G+ +V ++  +    A
Sbjct: 44  SSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSA 103

Query: 96  IEQLNYT 102
           ++ L+ T
Sbjct: 104 VKYLSDT 110

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 55/117 (47%), Gaps = 15/117 (12%)

Query: 211 LEEVKAKFTN--VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFE 267
           LE+++   ++  +YV N+   TS+E+  ELF K G I   ++  D  +    GF FV + 
Sbjct: 36  LEDLRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYN 95

Query: 268 DHAAAAKAVDELNELEFKGQKLYV------------GRAQKKYERLQELKKQYEAAR 312
               A  AV  L++ +   + + +            GR +   +   EL+ +++A+R
Sbjct: 96  TPKEALSAVKYLSDTKLDDRHISIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
            ++YVG L    SE  +Y++FS  G++  I +  D    T  G+ ++ F   E    +I+
Sbjct: 47  CTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIK 106

Query: 98  QLNYT 102
            L  T
Sbjct: 107 YLGDT 111

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 62/135 (45%), Gaps = 15/135 (11%)

Query: 193 DQEVYVALHVSKKDRQSKLEEVK--AKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVL 250
           D+     +  +++D  S L++++   K   VYV N+   TS+E+  ELF K G I   ++
Sbjct: 19  DKPSRYLIRKARRDPDSGLQQLRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIM 78

Query: 251 EKDS-EGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV------------GRAQKK 297
             D  +    GF F+ F+    A  ++  L + +   + + +            GR +  
Sbjct: 79  GLDRFKFTPCGFCFIIFDKMEDALNSIKYLGDTKLDDRHITIDLDPGFEEGRQFGRGKNG 138

Query: 298 YERLQELKKQYEAAR 312
            +   E++ +++A+R
Sbjct: 139 GQVSDEMRFEFDASR 153

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 37.0 bits (84), Expect = 0.011,   Method: Composition-based stats.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 7/98 (7%)

Query: 7   KTAEQLEQLKIEEQTAPTTTESETPK-------VETSGASLYVGELEPTVSEALLYDIFS 59
           K +E  E L +      T + S   +       +E    S+Y+G +    +   + + F 
Sbjct: 7   KISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADACSIYIGNISLDTTPEEIDEHFK 66

Query: 60  PIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
             G +  I +  D  T  S+GYAYV F   ++  KA++
Sbjct: 67  SCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD 104

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAI 183
           SG +YI  L      + L + FS FG++   ++A + + G SR + F+ + N+ DA  A 
Sbjct: 182 SGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQ 241

Query: 184 EAVDGMLM 191
           E+++  L+
Sbjct: 242 ESMNNYLL 249

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 311 ARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCF 369
           A+ +K +   G+ L++  L     + +L + F+ FG +   ++ R++ TGNSR + F+ +
Sbjct: 173 AKEDKSSDLSGI-LYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEY 231

Query: 370 STPEEATKAITEKNQQIVAGKPLYVAI 396
              ++A  A    N  ++ G  L V +
Sbjct: 232 INKDDAVVAQESMNNYLLMGHLLKVKV 258

>Sklu_2060.3 YIR009W, Contig c2060 4599-4931
          Length = 110

 Score = 36.2 bits (82), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 324 LFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           L+V NL+D I    L+E     F+ +G +    +    T   RG  FV   T  EA  A+
Sbjct: 30  LYVNNLNDQIRPNTLRENLYLLFSTYGEVIQVSM----TSKERGQAFVLLRTMNEANLAM 85

Query: 380 TEKNQQIVAGKPLYVAIAQ 398
                +   GKPL +  ++
Sbjct: 86  ISLQDEPFFGKPLRIRFSR 104

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 35/86 (40%), Gaps = 9/86 (10%)

Query: 39  SLYVGEL----EPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPK 94
           +LYV  L     P      LY +FS  G V  +     ++T+   G A+V          
Sbjct: 29  TLYVNNLNDQIRPNTLRENLYLLFSTYGEVIQV-----SMTSKERGQAFVLLRTMNEANL 83

Query: 95  AIEQLNYTLIKGKPCRIMWSQRDPSL 120
           A+  L      GKP RI +S+ D  L
Sbjct: 84  AMISLQDEPFFGKPLRIRFSRTDSQL 109

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91
           ++E    S++VG +    +   L + F   G V  + +  + +T    GYAY+ F   ++
Sbjct: 97  QIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFESSDS 156

Query: 92  GPKAIE 97
            PKA+E
Sbjct: 157 IPKALE 162

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 2/90 (2%)

Query: 307 QYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFG 365
           Q  A RLEK  +    ++FV N+      E L+E F   G +    ++ ++ TG  +G+ 
Sbjct: 88  QSRAERLEKQIELDSRSIFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYA 147

Query: 366 FVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
           ++ F + +   KA+  K+ ++  G+ + VA
Sbjct: 148 YIEFESSDSIPKALELKDSEL-HGETINVA 176

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 324 LFVKNLDDSIDDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
           L +  L++  D+  +++E   PFG I    V+R+ ETG SRG  ++ F T E A  A+
Sbjct: 200 LKITQLNEHADESTIRQELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETAL 257

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 236 EELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRA 294
           +EL   +G+I   V+ +++E G+ RG  ++ FE    A  A++ L+   F    L+   +
Sbjct: 216 QELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNLILHAEWS 275

Query: 295 QKK 297
           + K
Sbjct: 276 KPK 278

 Score = 29.3 bits (64), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 143 HETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEAVDG 188
            E    FG I    V  + E G SRG  ++ FE E  A  A+  +DG
Sbjct: 216 QELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDG 262

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 46  EPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLN 100
           E T+ + LL+    P G +  + V R+  T  S G +Y+ F   E    A+  L+
Sbjct: 211 ESTIRQELLF----PFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLD 261

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 4/102 (3%)

Query: 193 DQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITS-AVLE 251
           D    V+  +SK  + +K  E+ ++  +V+V +I  E + E  EE F   G I+   +L 
Sbjct: 59  DSTTPVSQPLSKDRKHAKQVELDSR--SVFVSSITPEATAEMLEEHFKDVGVISRITILY 116

Query: 252 KDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGR 293
               G+ +G+ ++ FE  ++  KA+ +L+   F G  + V +
Sbjct: 117 NKKTGEPKGYAYIQFESISSVEKAL-QLDGSSFNGNTISVAK 157

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 14/107 (13%)

Query: 18  EEQTAPTTTESETP-------------KVETSGASLYVGELEPTVSEALLYDIFSPIGSV 64
           +EQ++  + +S TP             +VE    S++V  + P  +  +L + F  +G +
Sbjct: 50  DEQSSYNSLDSTTPVSQPLSKDRKHAKQVELDSRSVFVSSITPEATAEMLEEHFKDVGVI 109

Query: 65  SSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLNYTLIKGKPCRI 111
           S I +  +  T    GYAY+ F    +  KA+ QL+ +   G    +
Sbjct: 110 SRITILYNKKTGEPKGYAYIQFESISSVEKAL-QLDGSSFNGNTISV 155

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 21/145 (14%)

Query: 123 KGSGNIYIKNLHPAIDNK----SLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESD 178
           + S  I++ +L  A+ +     S+ E F  +G++   KV  D    +R + FV + N+ D
Sbjct: 90  RPSSCIFVASLAAALSDDELCLSVTENFKKYGDLARVKVLRD--NANRPYAFVQYNNDHD 147

Query: 179 ARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238
           A+ A+    G L+N              R+ + E  K   T +Y+KN  Q     E  ++
Sbjct: 148 AKHALIRAQGTLLN-------------GRRLRCEPAKVNRT-LYLKN-QQSIDFNEISQI 192

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGF 263
             K+G +   V ++      R + +
Sbjct: 193 CEKFGGLEQIVPDRTDNQYTRRYTY 217

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 6/73 (8%)

Query: 324 LFVKNLDDSIDDEKL----KEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           +FV +L  ++ D++L     E F  +G +   KV+RD    +R + FV ++   +A  A+
Sbjct: 95  IFVASLAAALSDDELCLSVTENFKKYGDLARVKVLRDNA--NRPYAFVQYNNDHDAKHAL 152

Query: 380 TEKNQQIVAGKPL 392
                 ++ G+ L
Sbjct: 153 IRAQGTLLNGRRL 165

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 206 DRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKI 245
           D + K  E+     +++V  +D+ET++EE    F  +GKI
Sbjct: 333 DDEDKDSEITIDKRSIFVGQLDKETTREELNRRFSTHGKI 372

>Scas_720.2
          Length = 245

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A++YVG L    SE  +Y++FS  G +  I +  D    T  G+ +V + + +    A++
Sbjct: 47  ATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALK 106

Query: 98  QLNYTLIKGKPCRI 111
            L+ T +  K   I
Sbjct: 107 YLSDTKLDDKHITI 120

 Score = 30.0 bits (66), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 211 LEEVKAKF--TNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFE 267
           LEE++       +YV N+   TS+E+  ELF K G I   ++  D  +    GF FV + 
Sbjct: 37  LEELRQSLQSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYS 96

Query: 268 DHAAAAKAVDELNELEFKGQKLYV 291
           +   A  A+  L++ +   + + +
Sbjct: 97  NAQEALNALKYLSDTKLDDKHITI 120

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 37.4 bits (85), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 39  SLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQ 98
           ++++G L   + E  L   F   G +  IR+ +D IT  S GYA++ F D  +   A ++
Sbjct: 108 TIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

Query: 99  L 99
           +
Sbjct: 168 I 168

 Score = 35.8 bits (81), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDE-TGNSRGFGFVCFSTPEEATKAITE 381
           +F+  L   +D+ +L++ F  FG I   ++++D+ T  S+G+ F+ F  P  +  A  E
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKE 167

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 218 FTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKAV 276
           +  +++  +  +  + E ++ F K+G+I    + KD    K +G+ F+ F+D  ++  A 
Sbjct: 106 YRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAF 165

Query: 277 DEL 279
            E+
Sbjct: 166 KEI 168

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 35.4 bits (80), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 8/84 (9%)

Query: 324 LFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           ++VKNL+D I  + ++E     FA +G +    +    T   RG  F+ F + +EA  A+
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGEVIKVSM----TPKQRGQAFITFKSVDEANLAL 89

Query: 380 TEKNQQIVAGKPLYVAIAQRKEVR 403
                ++   KPL +  +++   +
Sbjct: 90  LSLKDELFFNKPLVLQFSKQTTTK 113

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 15/64 (23%)

Query: 221 VYVKNIDQ----ETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAV 276
           VYVKN++     +T +E    LF  YG+    V++     K RG  F+ F       K+V
Sbjct: 34  VYVKNLNDQIKIQTVRESLYMLFATYGE----VIKVSMTPKQRGQAFITF-------KSV 82

Query: 277 DELN 280
           DE N
Sbjct: 83  DEAN 86

>Kwal_30.12890
          Length = 280

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 326 VKNLDDSIDDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
           +  L+++ D+  L+ E   PFG I    V+R+ ETG SRG  +V F T E A  A+
Sbjct: 201 IMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETAL 256

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%)

Query: 53  LLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLN 100
           L Y++  P G +  + V R+  T  S G AYV F   E    A+  LN
Sbjct: 213 LRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLN 260

 Score = 30.4 bits (67), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 225 NIDQETSQEEFEELFGKYGKITSAVLEKDSE-GKLRGFGFVNFEDHAAAAKAVDELNELE 283
           N D+ T +  +E LF  +G+I   V+ ++ E G+ RG  +V FE    A  A++ LN   
Sbjct: 207 NADENTLR--YELLF-PFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRG 263

Query: 284 F 284
           F
Sbjct: 264 F 264

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 2/63 (3%)

Query: 128 IYIKNLHPAIDNKSL-HETFSTFGNILSCKVATD-ENGVSRGFGFVHFENESDARDAIEA 185
           I I  L+   D  +L +E    FG I    V  + E G SRG  +V FE E  A  A+  
Sbjct: 199 IKIMQLNENADENTLRYELLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNF 258

Query: 186 VDG 188
           ++G
Sbjct: 259 LNG 261

>Scas_570.14
          Length = 113

 Score = 35.0 bits (79), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 324 LFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           L+V NLD+ I+ ++L+      F+ +G +    +        RG  F+   T +EA  A+
Sbjct: 32  LYVNNLDEKINTKRLRTNLFLLFSIYGEVLKVAI---SAKKQRGQAFITMRTVDEANLAL 88

Query: 380 TEKNQQIVAGKPLYVAIAQ 398
              N +    KPL++  ++
Sbjct: 89  ISLNNEPFFDKPLHIQFSK 107

>Kwal_55.21039
          Length = 119

 Score = 35.0 bits (79), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 39/80 (48%), Gaps = 8/80 (10%)

Query: 324 LFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           L+V NL+D +  + L+E     F+ +G +       D +   RG  F+   T +EA  A+
Sbjct: 37  LYVHNLNDRVKIQTLRENLFLLFSTYGEVLQI----DMSKRIRGQAFIVLKTVDEANIAL 92

Query: 380 TEKNQQIVAGKPLYVAIAQR 399
              N +   GK L++  +++
Sbjct: 93  ISLNNEPFFGKDLHIQFSKK 112

>KLLA0E01936g 183638..185092 similar to sp|Q08287 Saccharomyces
           cerevisiae YOL144w NOP8 nucleolar protein required for
           60S ribosome biogenesis singleton, start by similarity
          Length = 484

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 18/118 (15%)

Query: 221 VYVKNIDQETSQEE--FEELFGKYGKITSAVLEKDSEGKLRGFGFVN--FEDHAAAAKAV 276
           VYV ++   TS ++  F EL+ ++ K    V E  S  +   FG++N  FED +   K  
Sbjct: 6   VYVGSV---TSNQDDCFAELYARFLKFGKVVDESKSFEQHDAFGYLNMEFEDASQFEKMK 62

Query: 277 DELNELEFKGQKLYVGRAQKKY-----------ERLQELKKQYEAARLEKLAKYQGVN 323
              N ++FKG  L V  A+  +           ER  + +KQ      E   K + +N
Sbjct: 63  SSFNRVKFKGNTLRVAEAKPDWKTRWEIDHKDEEREHKKRKQMAKQEWEHYKKLENIN 120

>Kwal_27.11096
          Length = 201

 Score = 36.2 bits (82), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           A++YVG L    SE  +Y++FS  G +  I +  D    T  G+ +V ++  E    A++
Sbjct: 46  ATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVK 105

Query: 98  QLNYT 102
            L+ T
Sbjct: 106 YLSDT 110

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 61/129 (47%), Gaps = 17/129 (13%)

Query: 201 HVSKKDRQSK--LEEVK--AKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-E 255
           ++ KK R++   LE+++   +   +YV N+   TS+E+  ELF K G I   ++  D  +
Sbjct: 24  YLMKKARRNPDGLEDLRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFK 83

Query: 256 GKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV------------GRAQKKYERLQE 303
               GF FV +     A  AV  L++ +   + + +            GR +   +   E
Sbjct: 84  FTPCGFCFVIYNTPEEALNAVKYLSDTKLDDRNISLDLDPGFEDGRQFGRGKSGGQVSDE 143

Query: 304 LKKQYEAAR 312
           L+ +++A+R
Sbjct: 144 LRFEFDASR 152

 Score = 31.2 bits (69), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 21/113 (18%)

Query: 268 DHAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLFVK 327
           DH+A        N L+     L + +A++  + L++L++   +A            ++V 
Sbjct: 12  DHSA--------NRLDVPSNYL-MKKARRNPDGLEDLRRSMRSA-----------TIYVG 51

Query: 328 NLDDSIDDEKLKEEFAPFGTITSAKVMRDETG-NSRGFGFVCFSTPEEATKAI 379
           NL     +E++ E F+  G I    +  D       GF FV ++TPEEA  A+
Sbjct: 52  NLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAV 104

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 36.2 bits (82), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 334 DDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
           D+E LK E   PFG I    V+++ ETG SRG  +V F T E A +A+
Sbjct: 196 DEEVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQAL 243

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 51  EALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQL 99
           E L  ++  P G +  + V ++  T  S G AYV F   E   +A++ L
Sbjct: 198 EVLKRELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLL 246

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 53/142 (37%), Gaps = 29/142 (20%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSR-------------GFGFVHFE 174
           +YI NL      + LH   + +G   +  V      V R             G  F  F 
Sbjct: 20  VYISNLPFTASERDLHAFLNNYG---ASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFA 76

Query: 175 NESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQSKLEEVKAKFT-------------NV 221
           N + A  AI+ ++G +  +Q++++ LHV  +   +   +VK                  V
Sbjct: 77  NNTLALKAIQDLNGTVFQNQKLFLKLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTV 136

Query: 222 YVKNIDQETSQEEFEELFGKYG 243
           Y  ++  + +  E  ELF  Y 
Sbjct: 137 YCHDLPDDITDSEIRELFQLYS 158

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 60/138 (43%), Gaps = 19/138 (13%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVL------------EKDSEGKLRGFGFVNFED 268
           VY+ N+    S+ +       YG   S+VL               +  K  G  F  F +
Sbjct: 20  VYISNLPFTASERDLHAFLNNYG--ASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFAN 77

Query: 269 HAAAAKAVDELNELEFKGQKLYVGRAQKKYERLQ----ELKKQYEAARLEKLAKYQGVNL 324
           +  A KA+ +LN   F+ QKL++ +    YE       ++KK  E  +++K  +     +
Sbjct: 78  NTLALKAIQDLNGTVFQNQKLFL-KLHVPYEADSTPDTDVKKPKEKNKVKKTPETAADTV 136

Query: 325 FVKNLDDSIDDEKLKEEF 342
           +  +L D I D +++E F
Sbjct: 137 YCHDLPDDITDSEIRELF 154

>YPL190C (NAB3) [5257] chr16 complement(185316..187724) Nuclear
           polyadenylated RNA-binding protein with one RNA
           recognition (RRM) domain [2409 bp, 802 aa]
          Length = 802

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 11/60 (18%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           GN+ +KN    +  + L   FS +G+I+   +          FGF+ F+N    RDAIE 
Sbjct: 335 GNLPLKN----VSKEDLFRIFSPYGHIMQINIKN-------AFGFIQFDNPQSVRDAIEC 383

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           +++YVG L    SE  +Y++FS  G +  I +  D    T  G+ ++ ++  +    A++
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVK 105

Query: 98  QLNYTLIKGKPCRI 111
            L  T +  K   I
Sbjct: 106 YLGDTKLDDKSITI 119

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 13/109 (11%)

Query: 217 KFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFEDHAAAAKA 275
           K + +YV N+   TS+E+  ELF K G I   ++  D  +    GF F+ +     A  A
Sbjct: 44  KSSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNA 103

Query: 276 VDELNELEFKGQKLYV------------GRAQKKYERLQELKKQYEAAR 312
           V  L + +   + + +            GR +   +   EL+ +++A+R
Sbjct: 104 VKYLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASR 152

>CAGL0I05082g complement(473462..475276) some similarities with
           sp|P34217 Saccharomyces cerevisiae YBL051c, hypothetical
           start
          Length = 604

 Score = 36.2 bits (82), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 19/37 (51%)

Query: 255 EGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291
            G  RG  F N+      AK V+ELNE E  G+ L V
Sbjct: 103 NGTFRGLAFANYNSEVDTAKVVNELNEKEVGGRNLRV 139

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 322 VNLFVKNLDDSIDDEKLKEEF-APFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKAI 379
           + L +  L+++ D+  +K++  +PF  +    V+R+ ETG SRG  +V F++ ++A  A+
Sbjct: 188 MTLKIMQLNENADEMTIKQKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETAL 247

>KLLA0B14432g 1267356..1267877 weakly similar to sp|P36036
           Saccharomyces cerevisiae YKL214c singleton, start by
           similarity
          Length = 173

 Score = 34.7 bits (78), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 215 KAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAK 274
           + + T + ++NI  ETS  E E+   + G++ S  +    E ++     V F+D      
Sbjct: 47  RKRITLLRIRNIPLETSDYEIEDWINEIGEVESIRINDRKENRV---ATVGFKDVQLLGT 103

Query: 275 AVDELNELEFKGQKLYV 291
           AV++LN  E  G +L V
Sbjct: 104 AVEKLNGKEVHGSQLEV 120

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 35.8 bits (81), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 362 RGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV 394
           RG  F  F+TPEE T+ IT  N + ++G+ L V
Sbjct: 126 RGLAFANFTTPEETTQVITSLNGKEISGRKLKV 158

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 321 GVNLFVKNLDDSIDDEKLKEEFA-PFGTITSAKVMRD-ETGNSRGFGFVCFSTPEEATKA 378
              L +  L+++ D+  L+ E   PF  I    V+R+ ETG SRG  FV F   + A KA
Sbjct: 188 SCTLKILQLNENADENTLRNELLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKA 247

Query: 379 I 379
           +
Sbjct: 248 L 248

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%)

Query: 157 VATDENGVSRGFGFVHFENESDARDAIEAVDG 188
           V   E G SRG  FV F NE  A  A+  +DG
Sbjct: 222 VRNKETGRSRGLAFVTFINEDMAEKALHFLDG 253

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 37/74 (50%)

Query: 38  ASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIE 97
           +++YVG L    SE  +Y++FS  G++  I +  D    T  G+ ++ +   +    A++
Sbjct: 46  STIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALK 105

Query: 98  QLNYTLIKGKPCRI 111
            L+ T +  K   I
Sbjct: 106 YLSDTKLDEKTITI 119

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 54/117 (46%), Gaps = 15/117 (12%)

Query: 211 LEEVK--AKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDS-EGKLRGFGFVNFE 267
           L+E++   K + +YV N+   TS+E+  ELF K G I   ++  D  +    GF F+ + 
Sbjct: 36  LQELRESMKSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYS 95

Query: 268 DHAAAAKAVDELNELEFKGQKLYV------------GRAQKKYERLQELKKQYEAAR 312
               A  A+  L++ +   + + +            GR +   +   EL+  ++A+R
Sbjct: 96  CPDEALNALKYLSDTKLDEKTITIDLDPGFEDGRQFGRGKSGGQVSDELRFDFDASR 152

>AFL061C [3132] [Homologous to ScYPL184C - SH] (317447..319018)
           [1572 bp, 523 aa]
          Length = 523

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 50/127 (39%), Gaps = 24/127 (18%)

Query: 82  AYVNFHDHEAGPK--AIEQLNYTLIKGKPCRIMWSQRDPSL--------RKKGSGNIYIK 131
            +V F D  A  +  A+  L+   I  K C+I W +    L         +  S NIY+ 
Sbjct: 379 CFVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLG 438

Query: 132 NLHPAIDNKSLHETFS---------TFGNILSCKVATDENGVSRGFGFVHFENESDARDA 182
           N+  A D KS H  F+          FG +       + N       F++F N S A  A
Sbjct: 439 NIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYERNCC-----FINFANISSAILA 493

Query: 183 IEAVDGM 189
           I+ +  +
Sbjct: 494 IDKIKSI 500

>Scas_710.31*
          Length = 162

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 280 NELEFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLF-VKNLDDS 332
           N  E  G +  +G+  KK E   +L +    ARLE L K +G+++F  K LD S
Sbjct: 42  NLAEVNGPESLIGQGAKKGEVPTDLDQATGLARLELLGKLEGIDIFDTKPLDSS 95

>YNL286W (CUS2) [4325] chr14 (95221..96078) Suppressor of U2 snRNA
           mutations and homolog of human Tat-SF1 protein, contains
           two RNA recognition motif (RRM) domains [858 bp, 285 aa]
          Length = 285

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 8/88 (9%)

Query: 216 AKFTNVYVKNI-DQETSQEEFEELFGKYGKITS-------AVLEKDSEGKLRGFGFVNFE 267
           +K T++Y+  +   +T++E   E F KYG I +         L  + +G  +G   + + 
Sbjct: 42  SKNTSIYISGLPTDKTTKEGLTEQFCKYGMIRTNRDGEPLCKLYVNDKGAFKGDALITYS 101

Query: 268 DHAAAAKAVDELNELEFKGQKLYVGRAQ 295
              +   A++ +NE  F G+++ V RAQ
Sbjct: 102 KEESVTLAIEMMNESIFLGKQIRVERAQ 129

>AFL070C [3123] [Homologous to ScYPL190C (NAB3) - SH]
           (303268..305541) [2274 bp, 757 aa]
          Length = 757

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 11/65 (16%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           GN+ +KN    +  + L   FS +G+I    +          FGF+ ++N    +DAIE 
Sbjct: 294 GNLPLKN----VTKEDLFRIFSPYGHIFQINIKN-------AFGFIQYDNAQSVKDAIEC 342

Query: 186 VDGML 190
             G +
Sbjct: 343 ESGTM 347

>AER349C [2850] [Homologous to NOHBY] (1278446..1279102) [657 bp,
           218 aa]
          Length = 218

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 27/65 (41%)

Query: 220 NVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL 279
            V+V     ET   +    F   GKI    +      + R F FV FE H    +AV+EL
Sbjct: 6   TVHVSGFPAETRARDMAPDFEAVGKIVRIDIPPMRPFQDRPFAFVKFETHEECVRAVEEL 65

Query: 280 NELEF 284
           +   F
Sbjct: 66  DGRPF 70

>Sklu_1192.1 YNL286W, Contig c1192 480-1322 reverse complement
          Length = 280

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 59/137 (43%), Gaps = 21/137 (15%)

Query: 294 AQKKYERLQELKKQYEAARLEKLAKYQGVNLFVKNLDDSIDDEKLKE---EFAPFGTIT- 349
            ++K ER + L KQ    R +  A      +FV NL  S+++ K  E   EF  FG I  
Sbjct: 21  VKRKKEREERLSKQLTMKRKQNSA------IFVSNL--SVENTKRDELISEFNKFGMIRR 72

Query: 350 -------SAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYV--AIAQRK 400
                    K+  D TGN +G   + +  PE    AI   +   + G+ + V  A+  +K
Sbjct: 73  DLSTNDYKCKLYFDSTGNFKGEALIVYVRPESVGMAINMMDGFELNGEKITVQEAVFSKK 132

Query: 401 EVRRNQLAQQIQARNQM 417
             + ++L      R ++
Sbjct: 133 NSKEDELGMPTTKRRKL 149

>Scas_611.5*
          Length = 787

 Score = 34.3 bits (77), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 11/59 (18%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE 184
           GN+ +KN    +  + L   FS +G+IL   +          FGF+ + N    +DAIE
Sbjct: 318 GNLPLKN----VSKEDLFRIFSPYGHILQINIKN-------AFGFIQYNNPQSVKDAIE 365

>Kwal_55.20903
          Length = 147

 Score = 32.7 bits (73), Expect = 0.29,   Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 34  ETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGP 93
           ET   S+++ ++   +S   L D F  +GS+  I +       +  GYAYV F    +  
Sbjct: 55  ETDSRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQ-RKSGTGYAYVEFATKASAE 113

Query: 94  KAIEQLNYTLIKGKPCRIMWSQRD-PSLRKK 123
           +A+E L+ ++++G   R+   + + P +R K
Sbjct: 114 RALE-LDGSILRGHKLRVARKRTNVPRMRVK 143

 Score = 31.6 bits (70), Expect = 0.74,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 125 SGNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE 184
           S +I+++++   I   SL + F   G+I    + + +     G+ +V F  ++ A  A+E
Sbjct: 58  SRSIFLRDIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERALE 117

Query: 185 AVDGMLMNDQEVYVA 199
            +DG ++   ++ VA
Sbjct: 118 -LDGSILRGHKLRVA 131

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 55/116 (47%), Gaps = 12/116 (10%)

Query: 291 VGRAQKKYERLQE---LKKQYEAARLEKLAKYQGVN--------LFVKNLDDSIDDEKLK 339
           +G+  KK  +++    LK    ++  E  AK + ++        +F++++   I    L+
Sbjct: 17  LGKWSKKPVKIRHSPALKSSNRSSHQESAAKGENIDQSETDSRSIFLRDIPSDISLPSLE 76

Query: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVA 395
           + F   G+I    ++  +  +  G+ +V F+T   A +A+ E +  I+ G  L VA
Sbjct: 77  DHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSILRGHKLRVA 131

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           GN+ +KN    +  + L   FS FG+IL          +   FGF+ ++N    R AIE 
Sbjct: 335 GNLPLKN----VSKQDLFRLFSPFGHILQI-------NIKNAFGFIQYDNPKSVRAAIEC 383

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 324 LFVKNLD-DSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEK 382
           LF+ NL   ++  + L   F+PFG I    +          FGF+ +  P+    AI  +
Sbjct: 332 LFIGNLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECE 384

Query: 383 NQQIVAGKPLYVAIA 397
           +Q+I  GK L + ++
Sbjct: 385 SQEINFGKKLILEVS 399

>CAGL0G05511g complement(522026..524050) similar to sp|P34761
           Saccharomyces cerevisiae YNL197c WHI3 involved in
           regulation of cell size, start by similarity
          Length = 674

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 221 VYVKNIDQETSQEEFEELFG-KYGKITSAVLEKDSEGKLRGFG---FVNFEDHAAAAKAV 276
           +YV N+  +TS++E  +LF  + G    +   K++ G   G G   FV FED + A +A+
Sbjct: 560 LYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRAL 619

Query: 277 DEL 279
            EL
Sbjct: 620 AEL 622

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFG-TITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEK 382
           + +KN+  +I  E+L +     G  +  A     + G  RG  F  FSTPE+ ++ I++ 
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 383 NQQIVAGKPLYV 394
           N + + G+ L V
Sbjct: 118 NGKEINGRKLKV 129

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 1/72 (1%)

Query: 221 VYVKNIDQETSQEEFEELFGKYG-KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL 279
           + +KNI     +E+  ++  + G  +  A       G  RG  F NF      ++ + +L
Sbjct: 58  IVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDL 117

Query: 280 NELEFKGQKLYV 291
           N  E  G+KL V
Sbjct: 118 NGKEINGRKLKV 129

>KLLA0D16049g complement(1352380..1353657) some similarities with
           sp|P43607 Saccharomyces cerevisiae YFR032c singleton,
           hypothetical start
          Length = 425

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 128 IYIKNLHPAIDNKSLHETFSTFGNILSCKVATD-----ENGVSRGFG--FVHFENESDAR 180
           +YI NL        L+E    + N++S  + +      +N   R FG  +  F NE DA 
Sbjct: 7   VYISNLSFEASENQLYEYLQDY-NVISVLIPSQTVRGLKNKAVRPFGIAYAEFSNEEDAN 65

Query: 181 DAIEAVDGMLMNDQEVYVALHV 202
             I+ ++G L  ++ + + +H+
Sbjct: 66  KVIQELNGKLFMERHLNLRMHI 87

>AAR022W [208] [Homologous to ScYIR009W (MSL1) - SH]
           complement(381754..382098) [345 bp, 114 aa]
          Length = 114

 Score = 31.6 bits (70), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%)

Query: 323 NLFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKA 378
            L++ NL+D +    L+      F+ FG +    +    +   RG  FV  ST +EA  A
Sbjct: 33  TLYISNLNDQVKISTLRTNLYLLFSTFGEVLRIAM----SPKLRGQAFVVLSTVDEANLA 88

Query: 379 ITEKNQQIVAGKPLYVAIAQ 398
           +     +   GKPL +  ++
Sbjct: 89  MISLKDESFFGKPLRIQFSK 108

>CAGL0H07975g 778377..779204 similar to sp|P33399 Saccharomyces
           cerevisiae YDL051w YLA1, hypothetical start
          Length = 275

 Score = 33.1 bits (74), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 11/71 (15%)

Query: 232 QEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNE---------- 281
           Q E EE F K  ++    L +D +   RG  FV F+++    K  DE +           
Sbjct: 150 QVEIEEFFRKLAQVNQVRLRRDHKKNFRGTVFVEFKNYDECKKFEDEYSAGSKDDKEGGE 209

Query: 282 -LEFKGQKLYV 291
            L FKG++L +
Sbjct: 210 ILSFKGKRLNI 220

>Sklu_2391.1 YPL190C, Contig c2391 194-2479 reverse complement
          Length = 761

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 96  IEQLNYT-LIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNILS 154
           IE+  YT  ++G+  RI   Q  P   +   GN+ +KN    +  + L   FS +G+I  
Sbjct: 316 IERQRYTEYLRGE-NRITEIQHFPPKSRLFIGNLPLKN----VTKEDLFRIFSPYGHIFQ 370

Query: 155 CKVATDENGVSRGFGFVHFENESDARDAIEA 185
             +          FGF+ +++    +DAIE 
Sbjct: 371 INIKN-------AFGFIQYDDPQSVKDAIEC 394

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 26/55 (47%)

Query: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNF 86
           ++E    S++VG + P+ +   L   F   G +  + +  +  T    GYAY+ F
Sbjct: 77  QIELDSRSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF 131

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 9/79 (11%)

Query: 167 GFGFVHFENESDARDAIEAVDGMLMNDQEV----YVALH---VSKKDRQSKLEEVKAKFT 219
           G  +  FE+   A++AIEA++G + N++ +    YVA     VS+K  ++  EE  ++F+
Sbjct: 69  GIAYADFESADKAKEAIEALNGKVFNNRTLRLKPYVAYSPAVVSRKPSKANKEE--SRFS 126

Query: 220 NVYVKNIDQETSQEEFEEL 238
            + VK     +   E +EL
Sbjct: 127 KLKVKKSTSVSPVSEEQEL 145

>KLLA0E19327g 1713099..1715318 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 739

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 126 GNIYIKNLHPAIDNKSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEA 185
           GN+ +KN    +  + L   FS +G+I    +          FGF+ ++N+    DAIE 
Sbjct: 279 GNLPLKN----VTKEDLFRIFSPYGHIFQINI-------KNAFGFIQYDNQRSVLDAIEC 327

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           +FV  LD S   E L + F+  G I +  V+   T     F F+ + T + A  A+ ++N
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNIDVVSKPT---TVFAFIEYETEQAAAAALDKEN 434

Query: 384 QQIVAGKPLYVAIAQRKEV 402
             I+  K ++V   Q KE+
Sbjct: 435 HSILLSKTMHV---QYKEI 450

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSA-VLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL 279
           ++V  +D  T++E   + F  +GKI +  V+ K +      F F+ +E   AAA A+D+ 
Sbjct: 378 IFVGQLDLSTTKEILVKRFSTHGKIRNIDVVSKPTTV----FAFIEYETEQAAAAALDKE 433

Query: 280 NELEFKGQKLYV 291
           N      + ++V
Sbjct: 434 NHSILLSKTMHV 445

>Kwal_23.3650
          Length = 299

 Score = 32.3 bits (72), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 164 VSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKDRQ 208
           ++RG  FV FEN  D    ++   G  +ND+E+ V +   K  R+
Sbjct: 229 MNRGIAFVTFENCQDITQKVQEFQGKSLNDRELAVDVAALKPPRE 273

>Kwal_55.20718
          Length = 594

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 324 LFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAITEKN 383
           +FV  LD    +EKL + F+  G+IT   ++   T  +  F F+ F+T E A  A+  +N
Sbjct: 202 IFVGQLDPMATEEKLLKRFSRHGSITDINLI---TKPNNVFAFIKFTTEEAAAAALEMEN 258

Query: 384 QQIVAGKPLYVAIAQRKEVRRNQLAQQ 410
             I   K ++V   +   ++R +   Q
Sbjct: 259 HAIFLSKTMHVQYREIGGIKRFRRGNQ 285

>KLLA0E19943g 1766853..1768631 weakly similar to sp|P34217
           Saccharomyces cerevisiae YBL051c singleton, hypothetical
           start
          Length = 592

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 29/74 (39%), Gaps = 1/74 (1%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYG-KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           T + +KNI     +E+  E+  K    +  A       G  RG  F NF         V 
Sbjct: 37  TAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETTTVVQ 96

Query: 278 ELNELEFKGQKLYV 291
            LN  E  G+KL V
Sbjct: 97  SLNGKEIGGRKLRV 110

>Kwal_47.17214
          Length = 155

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 283 EFKGQKLYVGRAQKKYERLQELKKQYEAARLEKLAKYQGVNLF-VKNLDDS 332
           E  G    VG   K+ E   EL +    ARLE L K +G+++F  K LD S
Sbjct: 38  EVDGNATLVGPGAKEGEVPTELDQATGLARLELLGKLEGIDVFDTKPLDSS 88

>Kwal_56.23945
          Length = 806

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 13/91 (14%)

Query: 94  KAIEQLNYT-LIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNKSLHETFSTFGNI 152
            AIE+  Y   ++G+  RI   Q  P   +   GN+ +KN+  A D+  L   FS +G+I
Sbjct: 335 NAIERKRYNEYLRGE-NRITEIQNIPPKSRLFIGNLPLKNV--AKDD--LFRIFSPYGHI 389

Query: 153 LSCKVATDENGVSRGFGFVHFENESDARDAI 183
               +          FGF+ ++N    R AI
Sbjct: 390 YQINI-------KNAFGFIQYDNPQSVRAAI 413

>KLLA0B08976g complement(786122..787039) weakly similar to sp|P32605
           Saccharomyces cerevisiae YBR119w MUD1 U1 snRNP-specific
           A protein singleton, start by similarity
          Length = 305

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 221 VYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDEL- 279
           + V+N+ ++ +Q+E E+LF   G       ++     +R   FV ++  A A K V+ L 
Sbjct: 235 LLVQNLPKDVTQQELEKLFVSDG------FKEVRLVSVRNLCFVEYDSTANATKVVETLG 288

Query: 280 NELEFKGQKLYVGRAQK 296
           ++  FK   + +G A+K
Sbjct: 289 HDHPFKNVTIKIGYAKK 305

>KLLA0F20834g complement(1942016..1943866) weakly similar to
           sp|P34761 Saccharomyces cerevisiae YNL197c WHI3 involved
           in regulation of cell size, start by similarity
          Length = 616

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 221 VYVKNIDQETSQEEFEELF-GKYGKITSAVLEKDSEGKLRG-FGFVNFEDHAAAAKAVDE 278
           +YV N+  + +++E  +LF G+ G    +   K++     G   FV FED A A +A+ E
Sbjct: 451 LYVGNLPPDATEQELRQLFGGQKGFKRLSFRNKNNNNSGHGPMCFVEFEDVAHATRALAE 510

Query: 279 L 279
           L
Sbjct: 511 L 511

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYG-KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           T + +KNI     +E+  E+  K    +  A       G  RG  F NF       + V 
Sbjct: 49  TAIVIKNIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETMQVVQ 108

Query: 278 ELNELEFKGQKLYV 291
            LN  E  G++L V
Sbjct: 109 HLNGKEIGGRRLRV 122

>YOR361C (PRT1) [5138] chr15 complement(1015357..1017648)
           Translation initiation factor eIF3 beta subunit (p90),
           has an RNA recognition (RRM) domain [2292 bp, 763 aa]
          Length = 763

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 24/109 (22%)

Query: 84  VNFHDHEAGPKAIEQLN---YTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNLHPAIDNK 140
           ++F D E   K  E+ N   Y ++ G P  ++ S + P L+K                  
Sbjct: 58  IDFSDLEEQYKVTEEFNFDQYIVVNGAP--VIPSAKVPVLKK------------------ 97

Query: 141 SLHETFSTFGNILSCKVATDE-NGVSRGFGFVHFENESDARDAIEAVDG 188
           +L   FS  G +++ +   DE  G ++GF FV   + +DA+  I++  G
Sbjct: 98  ALTSLFSKAGKVVNMEFPIDEATGKTKGFLFVECGSMNDAKKIIKSFHG 146

>Kwal_33.14810
          Length = 574

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYG-KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           T + +KNI     +E+  ++  K    +  A       G  RG  F NF       + V 
Sbjct: 31  TAIVIKNIPFAIKKEQLLDVIAKMNLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVH 90

Query: 278 ELNELEFKGQKLYV 291
            LN  E  G+KL V
Sbjct: 91  MLNGKEIGGRKLRV 104

>YOL144W (NOP8) [4680] chr15 (53096..54550) Nucleolar protein
           required for 60S ribosome biogenesis [1455 bp, 484 aa]
          Length = 484

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 9/83 (10%)

Query: 221 VYVKNI--DQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVN--FEDHAAAAKAV 276
           ++V NI  + +    E  + FGK+G       EK +      F F++  F D A   K  
Sbjct: 9   IFVGNIFHNADDCYSELLDRFGKFGDCQDFQFEKHNH-----FAFIDIRFNDEADFNKLR 63

Query: 277 DELNELEFKGQKLYVGRAQKKYE 299
              N ++FKG  L V  A+  +E
Sbjct: 64  KSFNNVKFKGNILKVDEAKPNWE 86

>KLLA0E19118g 1694566..1696524 some similarities with sp|Q08925
           Saccharomyces cerevisiae YPL184c, hypothetical start
          Length = 652

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 333 IDDEKLKEEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           +  EKL ++ + FG I S K++ D     RG  FV F++   A KA+
Sbjct: 350 VTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAV 391

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 230 TSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELE--FKGQ 287
            ++E+  +   ++G+I S  L +D     RG  FV+F    AA KAV  +  ++  +  +
Sbjct: 350 VTKEKLYDDLSQFGEIESIKLVED-----RGIAFVHFTSIFAAIKAVANIGSIDPYYSNK 404

Query: 288 KLYVGR 293
           K++ G+
Sbjct: 405 KVFYGK 410

>YIR009W (MSL1) [2674] chr9 (374522..374857) U2 snRNA-associated
           protein with similarity to U2B" protein, has one RNA
           recognition (RRM) domain [336 bp, 111 aa]
          Length = 111

 Score = 29.3 bits (64), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 7/79 (8%)

Query: 324 LFVKNLDDSIDDEKLKEE----FAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379
           L+V  L++ I+ ++L+      FA FG +    +        RG  F+   T ++A+ A 
Sbjct: 30  LYVSQLNEKINMQRLRVNLFLLFATFGEVLKVSM---NFKKQRGQAFITMRTIDQASLAQ 86

Query: 380 TEKNQQIVAGKPLYVAIAQ 398
              N +   GKPL V  ++
Sbjct: 87  ISLNGERFFGKPLKVEFSK 105

>YER156C (YER156C) [1585] chr5 complement(483320..484336) Member of
           the UPF0160 uncharacterized protein family, which may
           bind metal, has high similarity to uncharacterized C.
           albicans Orf6.6678p [1017 bp, 338 aa]
          Length = 338

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 225 NIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEF 284
           N +++TS E F+  F +  +    V        +RG+G       A  A+A+DE  +++ 
Sbjct: 175 NWNEDTSDESFDRCFARASEFIGGVFVT----LVRGYGQSWLPAKALVAQAIDERMDVDK 230

Query: 285 KGQKLYVGRAQKKYERLQELKKQ 307
            G+ + + +     E L EL+++
Sbjct: 231 SGKIIVLPQFCPWKEHLYELERE 253

>Scas_500.6
          Length = 621

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 1/74 (1%)

Query: 219 TNVYVKNIDQETSQEEFEELFGKYG-KITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVD 277
           T + +KNI     +E+  ++  K    +  A       G  RG  F NF       + ++
Sbjct: 53  TAIVIKNIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIE 112

Query: 278 ELNELEFKGQKLYV 291
            LN  E  G+KL V
Sbjct: 113 CLNGKEIGGRKLRV 126

>Kwal_33.13522
          Length = 572

 Score = 30.0 bits (66), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 39/93 (41%), Gaps = 10/93 (10%)

Query: 23  PTTTESETPK--VETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLG 80
           P + +   P   ++    +L+VG + P++ E  +  +  P G V S+      I N+S  
Sbjct: 308 PVSVDPTVPPDHIKVFSRTLFVGGVPPSMKEYDIAHVLRPYGEVQSV------ILNSSRK 361

Query: 81  YAYVNFHDHEAGPKAIEQLNYTLIKGKPCRIMW 113
           +A+V  +  +     +   N+      P R  W
Sbjct: 362 HAFVKVYSRQEAENVLN--NFNKDGSSPLRTRW 392

>CAGL0K09966g complement(974102..976261) highly similar to sp|P06103
           Saccharomyces cerevisiae YOR361c PRT1, hypothetical
           start
          Length = 719

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 140 KSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDG 188
           K+L   FS  G ++  +   D++  S+GF FV   ++ DA+  I+A  G
Sbjct: 55  KALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHG 103

>Sklu_2434.14 YOR361C, Contig c2434 32150-34360
          Length = 736

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 53  LLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEAGPKAIEQLN 100
           +L  +FS  G+V  + +  D    T+ GY +V F    A  KAI  LN
Sbjct: 59  VLTKLFSQAGTVVDMNLPLDEEKKTTKGYLFVEFDSAVAAKKAIALLN 106

>CAGL0J05852g complement(554403..555434) weakly similar to sp|P40580
           Saccharomyces cerevisiae YIR036, hypothetical start
          Length = 343

 Score = 29.6 bits (65), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 11/54 (20%)

Query: 350 SAKVMRDETGNSRG-------FGFVCFSTPEEATKAITEKNQQIVAGKPLYVAI 396
           +A+ ++ E GNS+G         F+ F+T  +A K I    Q+I+AGKPL + I
Sbjct: 81  AAESIKQEIGNSKGSISVVSGCDFLDFTTVPQAGKRI----QEILAGKPLNIII 130

>ADR399C [2139] [Homologous to ScYOR361C (PRT1) - SH]
           (1420640..1422850) [2211 bp, 736 aa]
          Length = 736

 Score = 30.0 bits (66), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 140 KSLHETFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDG 188
           K L + FS  G+++   V  +E G ++G  F+ FE+   AR AI+  +G
Sbjct: 57  KVLTKLFSQAGSVVDMDVPVEE-GRTKGHLFIEFEDAGAARRAIKMFNG 104

>Scas_683.32
          Length = 272

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%)

Query: 232 QEEFEELFGKYGKITSAVLEKDSEGKLRGFGFVNFE 267
           QE+ E  F K GK+    L +D + K  G   V FE
Sbjct: 140 QEQIESFFDKLGKVNQVRLRRDHKKKFNGNVLVEFE 175

>CAGL0B01397g 127374..128918 similar to sp|Q08287 Saccharomyces
           cerevisiae YOL144w NOP8 nucleolar protein required for
           60S ribosome biogenesis, hypothetical start
          Length = 514

 Score = 29.6 bits (65), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 239 FGKYGKITSAVLEKDSEGKLRGFGFVN--FEDHAAAAKAVDELNELEFKGQKLYVGRAQK 296
           FG+Y      V E+ +     GF FV   FED  A  +     ++++FKG +L V  A+ 
Sbjct: 29  FGEYVGSGQDVFERHN-----GFAFVTMRFEDAEALQRLKSRFHKVKFKGNQLIVDYARP 83

Query: 297 KYERLQELKKQYEAARLEKLAKYQGVN 323
            + + +E +++ E  +   L K Q  N
Sbjct: 84  AWSQERESQQREEQKQSRVLEKRQRKN 110

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,496,029
Number of extensions: 752019
Number of successful extensions: 3773
Number of sequences better than 10.0: 272
Number of HSP's gapped: 3235
Number of HSP's successfully gapped: 714
Length of query: 574
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 467
Effective length of database: 12,891,983
Effective search space: 6020556061
Effective search space used: 6020556061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)