Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR117C79978439120.0
Kwal_56.2345382884820800.0
KLLA0C17710g82184820310.0
Scas_681.1986484518080.0
YER169W (RPH1)79681017990.0
CAGL0L11880g98095515570.0
YDR096W (GIS1)8945217571e-87
Scas_76.12282266544e-80
KLLA0D10758g8502503034e-28
Sklu_2303.67951602892e-26
CAGL0H00528g7402292821e-25
ABR167C7762582784e-25
Kwal_55.218555211602736e-25
YJR119C7281832741e-24
Scas_691.277351672741e-24
CAGL0G08107g625671882e-14
Scas_709.32822721812e-13
Kwal_47.17241403781603e-11
Scas_649.28730691624e-11
Sklu_2181.1410561604e-11
YKL062W (MSN4)630541605e-11
Scas_602.9547571597e-11
ACL057W520541571e-10
CAGL0K02145g317571512e-10
Kwal_26.8351698741553e-10
KLLA0C17072g474561533e-10
AER159C1191791535e-10
AGR031W140551406e-10
CAGL0E04884g1489571536e-10
CAGL0L06072g300561469e-10
ABR089C571561491e-09
YDR043C (NRG1)231701421e-09
CAGL0M13189g541541472e-09
AGR172W1057571473e-09
Scas_721.921152571464e-09
Scas_703.231341601464e-09
KLLA0F26961g694561445e-09
Sklu_2357.7157551345e-09
YJR127C (ZMS1)1380601446e-09
YER130C443571427e-09
KLLA0F13046g1379571438e-09
Kwal_47.166211178721421e-08
CAGL0M00594g1020571402e-08
Sklu_2443.22213591332e-08
KLLA0B04477g1332601402e-08
YMR037C (MSN2)704511392e-08
CAGL0F05995g597551392e-08
YML081W1251591392e-08
Sklu_2351.6548551382e-08
Kwal_56.2420615022191374e-08
Scas_718.44266521325e-08
YDR216W (ADR1)1323571356e-08
Kwal_27.10925264551306e-08
Scas_707.31289571318e-08
AFL127C15212031348e-08
Scas_569.2293551301e-07
KLLA0F18524g357791311e-07
CAGL0K12078g463521311e-07
CAGL0H04213g1321561331e-07
Scas_575.3455551302e-07
KLLA0E10989g474551302e-07
YOR113W (AZF1)914511302e-07
CAGL0L07480g314551264e-07
YGL035C (MIG1)504661257e-07
AFR471C389551247e-07
CAGL0K09372g396551239e-07
CAGL0A01628g424551241e-06
YPL038W (MET31)177501171e-06
AFR580C838511231e-06
Scas_712.42*290531192e-06
ACR264W769511222e-06
KLLA0B07909g922511222e-06
Kwal_14.2278463521203e-06
Scas_697.35839511213e-06
YGL209W (MIG2)382581193e-06
KLLA0F23782g782501204e-06
Kwal_47.17888786501204e-06
CAGL0K04631g1013531195e-06
Scas_719.681350591196e-06
YGR067C794511177e-06
Scas_683.25879511179e-06
YBR066C (NRG2)220501129e-06
AGL207W277501149e-06
Scas_378.1208571111e-05
Scas_693.31635571151e-05
Scas_717.17525561141e-05
AGL246W227991083e-05
YDR253C (MET32)191521073e-05
Kwal_26.8021507531114e-05
YPL230W391571095e-05
CAGL0L03916g642501105e-05
KLLA0B00605g239531066e-05
Scas_568.5199721057e-05
Kwal_47.19045266531051e-04
Sklu_1527.1205771031e-04
YDR146C (SWI5)709571071e-04
KLLA0B03454g472551061e-04
Kwal_27.11460531751062e-04
CAGL0H07557g476551052e-04
CAGL0C02519g318521042e-04
KLLA0D16456g854561052e-04
AEL174W661691052e-04
Scas_636.14d275761023e-04
CAGL0M01870g315661023e-04
KLLA0F20636g285701013e-04
Scas_687.33288531014e-04
Scas_627.17d275761014e-04
CAGL0J05060g713481034e-04
YJL056C (ZAP1)880481034e-04
Scas_720.33316531014e-04
CAGL0M06831g645481024e-04
YER028C394531024e-04
AGL197W844481034e-04
AGL071C396501015e-04
Kwal_56.23925745571025e-04
KLLA0E18645g431531015e-04
YMR176W (ECM5)14112141026e-04
CAGL0K03003g647641008e-04
YMR070W (MOT3)490761008e-04
Scas_720.3914551991000.001
CAGL0E06116g61343980.001
KLLA0F11682g37450970.001
AEL278W47676970.002
KLLA0C16005g33154960.002
YMR182C (RGM1)21144930.002
Sklu_2389.276752960.003
Scas_631.743370950.003
KLLA0E08679g59642950.003
Scas_695.257149940.004
CAGL0E01331g68957940.004
Kwal_23.540042944940.004
CAGL0M04323g70355940.005
Scas_717.60d16761890.005
Scas_711.5683241930.005
ADL198W54748930.006
CAGL0G10021g39453920.006
KLLA0C16203g1454196920.009
KLLA0F01463g78166910.010
AFL136W40943900.011
CAGL0B02651g18952870.013
YLR131C (ACE2)77059890.015
CAGL0I02838g65539890.015
CAGL0L12562g22369870.016
YPR186C (PZF1)42953880.018
Scas_721.5619951860.019
KLLA0A04609g42355880.020
Kwal_27.1046730250870.021
YNL027W (CRZ1)67858880.023
Scas_718.36d33069860.026
Kwal_14.254371169870.029
KLLA0E00726g51757860.036
Kwal_27.1182419953830.039
Kwal_47.1657788150860.040
Scas_718.6747383850.044
Scas_627.6120780860.047
Kwal_14.220625448820.064
Sklu_2126.544844820.088
CAGL0E04312g68881830.097
ADR308C27852810.099
Sklu_2436.951795820.11
KLLA0D11902g28954800.12
CAGL0K01727g49972800.18
CAGL0L00583g38839790.21
Scas_604.458535790.22
CAGL0E03762g58457790.25
Sklu_2289.129152780.26
Scas_660.1236764780.31
Sklu_2244.327151760.37
YHL027W (RIM101)62545770.45
KLLA0F10109g62389770.48
AFR461C54499760.52
CAGL0K02343g116287770.55
KLLA0A10373g20660740.60
YPR022C113351760.63
AFR190C43244750.64
Kwal_47.1833753695750.66
YDL020C (RPN4)53191750.70
YHR006W (STP2)54193750.78
ADL042W28162730.90
YGL254W (FZF1)29954731.1
Scas_713.1146557731.1
CAGL0I02816g29155721.2
YDR463W (STP1)51993721.7
CAGL0K04697g51582721.8
Scas_641.2453274712.2
ADL040W33051702.7
Kwal_27.1204467160702.8
Kwal_26.930030437692.9
Kwal_55.2063441945693.2
Sklu_2359.572265694.0
Scas_670.243570684.2
Kwal_33.1422755157694.3
Scas_712.232754684.6
YDR127W (ARO1)1588131694.8
KLLA0E13519g23073675.0
YPL242C (IQG1)149558685.8
Sklu_1991.379575676.7
YLR375W34356667.5
Scas_683.3047847669.3
ADL197C39034659.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR117C
         (784 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W (...  1511   0.0  
Kwal_56.23453                                                         805   0.0  
KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces...   786   0.0  
Scas_681.19                                                           701   0.0  
YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsiv...   697   0.0  
CAGL0L11880g 1272624..1275566 some similarities with sp|P39956 S...   604   0.0  
YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive...   296   1e-87
Scas_76.1                                                             256   4e-80
KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces c...   121   4e-28
Sklu_2303.6 YJR119C, Contig c2303 8969-11356                          115   2e-26
CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces cer...   113   1e-25
ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2...   111   4e-25
Kwal_55.21855                                                         109   6e-25
YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protei...   110   1e-24
Scas_691.27                                                           110   1e-24
CAGL0G08107g 768772..770649 weakly similar to tr|Q03833 Saccharo...    77   2e-14
Scas_709.32                                                            74   2e-13
Kwal_47.17241                                                          66   3e-11
Scas_649.28                                                            67   4e-11
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            66   4e-11
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    66   5e-11
Scas_602.9                                                             66   7e-11
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    65   1e-10
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    63   2e-10
Kwal_26.8351                                                           64   3e-10
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    64   3e-10
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    64   5e-10
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    59   6e-10
CAGL0E04884g complement(469295..473764) weakly similar to sp|P07...    64   6e-10
CAGL0L06072g complement(679924..680826) some similarities with s...    61   9e-10
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    62   1e-09
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    59   1e-09
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    61   2e-09
AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH] complement(...    61   3e-09
Scas_721.92                                                            61   4e-09
Scas_703.23                                                            61   4e-09
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    60   5e-09
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        56   5e-09
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    60   6e-09
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    59   7e-09
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    60   8e-09
Kwal_47.16621                                                          59   1e-08
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    59   2e-08
Sklu_2443.22 , Contig c2443 45390-46027                                56   2e-08
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    59   2e-08
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    58   2e-08
CAGL0F05995g complement(598819..600612) some similarities with s...    58   2e-08
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    58   2e-08
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       58   2e-08
Kwal_56.24206                                                          57   4e-08
Scas_718.44                                                            55   5e-08
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    57   6e-08
Kwal_27.10925                                                          55   6e-08
Scas_707.31                                                            55   8e-08
AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH] (193474..19...    56   8e-08
Scas_569.2                                                             55   1e-07
KLLA0F18524g complement(1701498..1702571) some similarities with...    55   1e-07
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    55   1e-07
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    56   1e-07
Scas_575.3                                                             55   2e-07
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    55   2e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    55   2e-07
CAGL0L07480g complement(822240..823184) some similarities with s...    53   4e-07
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    53   7e-07
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    52   7e-07
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    52   9e-07
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    52   1e-06
YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protei...    50   1e-06
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    52   1e-06
Scas_712.42*                                                           50   2e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    52   2e-06
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    52   2e-06
Kwal_14.2278                                                           51   3e-06
Scas_697.35                                                            51   3e-06
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    50   3e-06
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    51   4e-06
Kwal_47.17888                                                          51   4e-06
CAGL0K04631g complement(440721..443762) some similarities with s...    50   5e-06
Scas_719.68                                                            50   6e-06
YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein...    50   7e-06
Scas_683.25                                                            50   9e-06
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    48   9e-06
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    49   9e-06
Scas_378.1                                                             47   1e-05
Scas_693.31                                                            49   1e-05
Scas_717.17                                                            49   1e-05
AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W ...    46   3e-05
YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-fing...    46   3e-05
Kwal_26.8021                                                           47   4e-05
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    47   5e-05
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    47   5e-05
KLLA0B00605g complement(46736..47455) some similarities with sp|...    45   6e-05
Scas_568.5                                                             45   7e-05
Kwal_47.19045                                                          45   1e-04
Sklu_1527.1 YPL038W, Contig c1527 389-1006                             44   1e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    46   1e-04
KLLA0B03454g complement(314015..315433) some similarities with s...    45   1e-04
Kwal_27.11460                                                          45   2e-04
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    45   2e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    45   2e-04
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    45   2e-04
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    45   2e-04
Scas_636.14d                                                           44   3e-04
CAGL0M01870g complement(219813..220760) some similarities with t...    44   3e-04
KLLA0F20636g complement(1914452..1915309) some similarities with...    44   3e-04
Scas_687.33                                                            44   4e-04
Scas_627.17d                                                           44   4e-04
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    44   4e-04
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    44   4e-04
Scas_720.33                                                            44   4e-04
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    44   4e-04
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    44   4e-04
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    44   4e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    44   5e-04
Kwal_56.23925                                                          44   5e-04
KLLA0E18645g complement(1648263..1649558) some similarities with...    44   5e-04
YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in...    44   6e-04
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    43   8e-04
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    43   8e-04
Scas_720.39                                                            43   0.001
CAGL0E06116g complement(604708..606549) some similarities with t...    42   0.001
KLLA0F11682g complement(1068992..1070116) some similarities with...    42   0.001
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    42   0.002
KLLA0C16005g 1397274..1398269 some similarities with sgd|S000615...    42   0.002
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    40   0.002
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            42   0.003
Scas_631.7                                                             41   0.003
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    41   0.003
Scas_695.2                                                             41   0.004
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    41   0.004
Kwal_23.5400                                                           41   0.004
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    41   0.005
Scas_717.60d                                                           39   0.005
Scas_711.56                                                            40   0.005
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    40   0.006
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    40   0.006
KLLA0C16203g complement(1414169..1418533) weakly similar to sp|Q...    40   0.009
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    40   0.010
AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -...    39   0.011
CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12...    38   0.013
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    39   0.015
CAGL0I02838g complement(248704..250671) similar to sp|P41696 Sac...    39   0.015
CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041 S...    38   0.016
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    39   0.018
Scas_721.56                                                            38   0.019
KLLA0A04609g complement(411494..412765) some similarities with s...    39   0.020
Kwal_27.10467                                                          38   0.021
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    39   0.023
Scas_718.36d                                                           38   0.026
Kwal_14.2543                                                           38   0.029
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    38   0.036
Kwal_27.11824                                                          37   0.039
Kwal_47.16577                                                          38   0.040
Scas_718.67                                                            37   0.044
Scas_627.6                                                             38   0.047
Kwal_14.2206                                                           36   0.064
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            36   0.088
CAGL0E04312g 412563..414629 some similarities with sp|Q00947 Sac...    37   0.097
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    36   0.099
Sklu_2436.9 YDR463W, Contig c2436 18516-20069                          36   0.11 
KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041 S...    35   0.12 
CAGL0K01727g complement(152569..154068) similar to sp|Q03465 Sac...    35   0.18 
CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces cer...    35   0.21 
Scas_604.4                                                             35   0.22 
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    35   0.25 
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          35   0.26 
Scas_660.12                                                            35   0.31 
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                34   0.37 
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    34   0.45 
KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00...    34   0.48 
AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH] (1269565..1...    34   0.52 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    34   0.55 
KLLA0A10373g complement(907244..907864) some similarities with c...    33   0.60 
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    34   0.63 
AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH] (783110.....    33   0.64 
Kwal_47.18337                                                          33   0.66 
YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of ...    33   0.70 
YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor...    33   0.78 
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    33   0.90 
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    33   1.1  
Scas_713.11                                                            33   1.1  
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    32   1.2  
YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription fact...    32   1.7  
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    32   1.8  
Scas_641.24                                                            32   2.2  
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    32   2.7  
Kwal_27.12044                                                          32   2.8  
Kwal_26.9300                                                           31   2.9  
Kwal_55.20634                                                          31   3.2  
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          31   4.0  
Scas_670.2                                                             31   4.2  
Kwal_33.14227                                                          31   4.3  
Scas_712.2                                                             31   4.6  
YDR127W (ARO1) [974] chr4 (704478..709244) Arom pentafunctional ...    31   4.8  
KLLA0E13519g complement(1190615..1191307) some similarities with...    30   5.0  
YPL242C (IQG1) [5208] chr16 complement(90622..95109) Protein inv...    31   5.8  
Sklu_1991.3 YDR081C, Contig c1991 4090-6477                            30   6.7  
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    30   7.5  
Scas_683.30                                                            30   9.3  
ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165) [...    30   9.6  

>AGR117C [4428] [Homologous to ScYER169W (RPH1) - SH; ScYDR096W
           (GIS1) - SH] (964417..966816) [2400 bp, 799 aa]
          Length = 799

 Score = 1511 bits (3912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/784 (93%), Positives = 730/784 (93%)

Query: 1   MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV 60
           MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV
Sbjct: 1   MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV 60

Query: 61  EQLRRIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMXXXXXXXXX 120
           EQLRRIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDM         
Sbjct: 61  EQLRRIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMRGYGGSLSR 120

Query: 121 XXXXXXXXXXXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLN 180
                       NIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLN
Sbjct: 121 SAAAGGARPRPSNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLN 180

Query: 181 FTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLE 240
           FTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLE
Sbjct: 181 FTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLE 240

Query: 241 DQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVL 300
           DQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVL
Sbjct: 241 DQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVL 300

Query: 301 ERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVD 360
           ERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVD
Sbjct: 301 ERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVD 360

Query: 361 DSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFN 420
           DSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFN
Sbjct: 361 DSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFN 420

Query: 421 ELINHSAYELQAMEDNPNQRSIRSTTPNQYFSNXXXXXXXXXXXXXXXXXXNIVEPTLED 480
           ELINHSAYELQAMEDNPNQRSIRSTTPNQYFSN                  NIVEPTLED
Sbjct: 421 ELINHSAYELQAMEDNPNQRSIRSTTPNQYFSNPSISRMSSPLLSRMMDLSNIVEPTLED 480

Query: 481 PTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSG 540
           PTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSG
Sbjct: 481 PTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSG 540

Query: 541 NSSPRNALPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYSTQTTKSPMPLFKRINS 600
           NSSPRNALPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYSTQTTKSPMPLFKRINS
Sbjct: 541 NSSPRNALPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYSTQTTKSPMPLFKRINS 600

Query: 601 PNRVTLNISRESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIPSHRDR 660
           PNRVTLNISRESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIPSHRDR
Sbjct: 601 PNRVTLNISRESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIPSHRDR 660

Query: 661 SAKAYHGDKVNIHGVSSGKFVGHQIXXXXXXXXXXXXXXXVLPGAGRPERATSPTSKISA 720
           SAKAYHGDKVNIHGVSSGKFVGHQI               VLPGAGRPERATSPTSKISA
Sbjct: 661 SAKAYHGDKVNIHGVSSGKFVGHQINDSLALLNDDALTNSVLPGAGRPERATSPTSKISA 720

Query: 721 EEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           EEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL
Sbjct: 721 EEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780

Query: 781 NKKI 784
           NKKI
Sbjct: 781 NKKI 784

>Kwal_56.23453
          Length = 828

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/848 (52%), Positives = 538/848 (63%), Gaps = 134/848 (15%)

Query: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64
           P  +EGGVPVFRP++E F+DFY+YM  +D+YG KSG+VK+IPP+EW+++L   PGVE L+
Sbjct: 6   PSSWEGGVPVFRPNYERFKDFYEYMRAVDKYGKKSGIVKVIPPQEWLDQLEMPPGVETLQ 65

Query: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMXXXXXXXXXXXXX 124
           +I IR+PIQQH +GSKGVFVVQNVE+ KSYNIIQWKD++ DY+LPD              
Sbjct: 66  KIRIRTPIQQHFNGSKGVFVVQNVEKSKSYNIIQWKDISYDYRLPDGGGEASGSSEADAG 125

Query: 125 XXXXX-------XXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWK 177
                           I+ R+ +SFSD +F +F  HYN + L  + D S    LE+Y+WK
Sbjct: 126 DTLGARKSPSPLKSSKIKLRSPESFSDAEFEKFSAHYNHDNLGDFRDPSRREFLESYFWK 185

Query: 178 TLNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAW 237
           TL FT PMYGAD+LG+LF D L  WNVS+LPN+LDH+  KVPGVN SYLYAGLWKASF+W
Sbjct: 186 TLAFTPPMYGADSLGSLFQDKLDVWNVSKLPNILDHMNTKVPGVNGSYLYAGLWKASFSW 245

Query: 238 HLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSP 297
           HLEDQDLYSINY+HFGAPKQWYSIPQEDS KF+KFMQEQFPE +A+C EFLRHK F+VSP
Sbjct: 246 HLEDQDLYSINYIHFGAPKQWYSIPQEDSDKFYKFMQEQFPEHAAKCDEFLRHKTFLVSP 305

Query: 298 KVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCM 357
           K+LE+NGIRCN IVH Q EF++TYPYGYH+GFNYGYNLAESVNFALE+WL IG KAK+C+
Sbjct: 306 KILEKNGIRCNKIVHYQQEFIITYPYGYHAGFNYGYNLAESVNFALENWLDIGIKAKRCL 365

Query: 358 CVDDSVGIDIQKLKSAYFRSLQ----------------------------EDRAGSADPE 389
           C+DD+VGID++KL+  +  S Q                            +D A +  P 
Sbjct: 366 CIDDAVGIDVEKLRDDWLSSKQKAEKPKVKHEIQESQRGSNGVSKKAKFEKDSASTKQPS 425

Query: 390 PPRKR--LKQEPNTSSFVQAPILDTGDSL-------------KSFNELINHSAYELQAME 434
              K   +K + +  S ++      G SL             K FNEL++HS+YELQAME
Sbjct: 426 EGSKNADVKNDKSDKSNIEVVCPTPGRSLPFNRLTNKENPRMKGFNELLHHSSYELQAME 485

Query: 435 DNPNQRSIRSTTPN--QYFSNXXXXXXXXXX--XXXXXXXXNIVEPTLEDPTLKFKRKVV 490
           DNP Q +IRSTTPN  QY+S                     NIVEPTLEDPTLKFK+   
Sbjct: 486 DNPQQSAIRSTTPNPGQYYSGLSQSISRISSPLLSRMMDLSNIVEPTLEDPTLKFKK--- 542

Query: 491 AQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGNSSPRNALPP 550
              +SN    N  +             P +   +++++LALSLASMA SG SSPR  LPP
Sbjct: 543 ---SSNLSQQNSQT-------------PQVLEDNDDNMLALSLASMA-SGASSPRYPLPP 585

Query: 551 LNSAVGNSRPYTP--TGDAILAPRPSYDQNPLSYYSTQ---TTKSP---------MPLFK 596
           +       RPY+P   GD++LA  P Y+QNP SYYST    T  SP         +P  K
Sbjct: 586 I-----QPRPYSPAVAGDSMLASGPLYEQNPFSYYSTNFKSTMGSPQPSSPALSNLPFIK 640

Query: 597 RINSPNRVTLNISRESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIPS 656
           R+ SPNRVTLNISRESSRSPI   SE+ K PLS     N      ++L+Q +T+E + P 
Sbjct: 641 RLKSPNRVTLNISRESSRSPILLNSEF-KSPLSNNIAANGNTAVNSNLSQATTVEHSPP- 698

Query: 657 HRDRSAKAYHGDKVNIHGVSSGKFVGHQIXXXXXXXXXXXXXXXVLPGAGRPERATSPTS 716
                               S     + I                   A   +R  +P S
Sbjct: 699 -------------------VSPPIPNNSI-------------------ADFSKRPIAP-S 719

Query: 717 KISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 776
           KI++EEII+SDKGK YVCQEC+RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV
Sbjct: 720 KINSEEIIVSDKGKVYVCQECRRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 779

Query: 777 LQHLNKKI 784
           LQHLNKKI
Sbjct: 780 LQHLNKKI 787

>KLLA0C17710g 1569331..1571796 similar to sp|P39956 Saccharomyces
           cerevisiae YER169w RPH1, start by similarity
          Length = 821

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/848 (50%), Positives = 543/848 (64%), Gaps = 105/848 (12%)

Query: 1   MSGNPDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGV 60
           MS  PDH+EG VPVF+P +E F+DFYK+M  +++YGMKSG++KI+PP +WV+++   P  
Sbjct: 1   MSYEPDHYEGSVPVFKPDYETFRDFYKFMCEVNKYGMKSGIIKIVPPEQWVDKVAFPPSA 60

Query: 61  EQLRRIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMXXXXXXXXX 120
           E L++I I++PIQQH+SGSKGVFVVQNVE+ KSYN+IQWK L+ DY+LP+          
Sbjct: 61  ETLQKIKIKTPIQQHISGSKGVFVVQNVEKPKSYNVIQWKHLSHDYKLPE--GRHSAKNE 118

Query: 121 XXXXXXXXXXXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLN 180
                        +R++  DSF+ +DF +F+E++N + L Q+DDE  +  LE+YYWKTLN
Sbjct: 119 DSSGIEPHQQSNKVRSKCLDSFTLDDFEKFRENFNCDHLEQFDDEQRVEFLESYYWKTLN 178

Query: 181 FTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLE 240
           FTEPMYGAD+LG+LF DS+ +WN+S LP++L++L+EKVPGVN+SYLYAGLWKASFAWHLE
Sbjct: 179 FTEPMYGADSLGSLFEDSVKEWNISSLPSILEYLDEKVPGVNESYLYAGLWKASFAWHLE 238

Query: 241 DQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVL 300
           DQDLYSINY+HFGAPKQWYSIPQEDS KF+ FM+EQFPEES  C EFLRHKMF+VSPK+L
Sbjct: 239 DQDLYSINYIHFGAPKQWYSIPQEDSEKFYNFMKEQFPEESKNCSEFLRHKMFLVSPKLL 298

Query: 301 ERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVD 360
           + NGIRCN IVHRQ EF+VTYP+GYH+GFNYGYNLAESVNFAL SWL IG KAKKC+C+D
Sbjct: 299 QSNGIRCNHIVHRQQEFIVTYPFGYHAGFNYGYNLAESVNFALPSWLDIGAKAKKCLCID 358

Query: 361 DSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILD--------- 411
           D+VGI++QKL+S Y  S      G A  E  ++    +  +SS     +L+         
Sbjct: 359 DAVGINVQKLRSNYMHSPN----GGAQKETGKEVQNDKSISSSKTLEEVLEERPPLKKFK 414

Query: 412 TGDSLKSFNELINHSAYELQAMEDNPNQR------------SIRSTTPNQ---------- 449
            GDS +SF+ + +   + L+   D  +++            SIRSTTPN           
Sbjct: 415 MGDSDRSFDSVKSTPEFLLKTNSDLLDEKANLDNLNNNNNSSIRSTTPNSQKTGLYGFGI 474

Query: 450 -----YFSNXXXXXXXXXXXXXXXXXXNIVEPTLEDPTLKFKRKV-----VAQDTSNAMA 499
                + SN                  +IVEPTLEDPTLKFK+K      ++     A+ 
Sbjct: 475 KKEGAFNSNTSISRVSSPLLSRMMDLSHIVEPTLEDPTLKFKKKQSQFMPLSMAQQQAIF 534

Query: 500 PNPV-------SGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGNSSPRNALPPLN 552
           P P        SG  +P  +    P   ++ HE++++ALSLA MANS  S   N LPPLN
Sbjct: 535 PPPAQNPLPAPSGQMSPSENAFFSP---SHDHEDNMIALSLALMANS--SPAFNQLPPLN 589

Query: 553 SAVGNSRPYTPT-GDAILAPRPSYDQNPLSYYSTQTTKSP---------MPLFKRINSPN 602
             + N RPY+P   D+IL+PRPSY+ N LSY     TKSP         +P  KRI SPN
Sbjct: 590 --ISNPRPYSPILQDSILSPRPSYNSNVLSYGQAGNTKSPLGGFSSSTQLPFIKRIQSPN 647

Query: 603 RVTLNISRESSRSPISFGSEYGKPP---LSKPHPLNAGAVNLTSLNQVSTIERNIPSHRD 659
           RVTLNISRESSRSP+S    YG P    +  PHP  +     ++LNQVST ER+ P+   
Sbjct: 648 RVTLNISRESSRSPVSLSGMYGNPNAMMVPIPHPYQSSQT--STLNQVSTAERS-PAVTP 704

Query: 660 RSAKAYHGDKVNIHGVSSGKFVGHQIXXXXXXXXXXXXXXXVLPGAGRPERATSPT--SK 717
            ++ + +              +                          PE  TS    SK
Sbjct: 705 PTSPSKNKPARKKAPKQPKAKID-------------------------PESPTSALAQSK 739

Query: 718 ISAEEIIISDKG-KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 776
           I+ EEI+  D G K YVCQEC RQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV
Sbjct: 740 INDEEIMFLDDGSKVYVCQECARQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 799

Query: 777 LQHLNKKI 784
           LQHLNKKI
Sbjct: 800 LQHLNKKI 807

>Scas_681.19
          Length = 864

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/845 (45%), Positives = 513/845 (60%), Gaps = 101/845 (11%)

Query: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64
           P   E G+P+F+P+++EF+DFYK+M  I+++GM+SG+VK+IPP EW++ L   P VE L+
Sbjct: 9   PALIEDGIPIFKPTFQEFKDFYKFMEAINKFGMQSGIVKVIPPTEWLKLLDNPPSVEALQ 68

Query: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLP------DMXXXXXXX 118
            I I++PI+Q +SG+ G+F+  N+ER K+Y+IIQWK+L++DY LP      D        
Sbjct: 69  GIKIKNPIEQEISGTHGLFMSNNIERSKTYHIIQWKELSKDYTLPQDPHSRDKNKDPDTN 128

Query: 119 XXXXXXXXXXXXXXNIRTRTQDSFSDEDFREFQEHYNV--EGLAQYDDESFLRGLENYYW 176
                           R R Q SFS EDF+ FQ+++N   E L Q++D+  L  LENYYW
Sbjct: 129 NGKTIEMPSSTSSATHRKR-QHSFSKEDFKNFQKNFNESDEILKQFNDKERLNFLENYYW 187

Query: 177 KTLNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFA 236
           KTLNFT PMYGADT G++F ++L+ WNVS+LPNLLD+L++++PGVN S+LYAGLWKASF 
Sbjct: 188 KTLNFTMPMYGADTSGSIFNENLNVWNVSKLPNLLDYLDKEIPGVNDSFLYAGLWKASFP 247

Query: 237 WHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVS 296
           WHLEDQDLYSIN++HFGAPKQWYSIPQED   F+ FM+EQFPEE+ +C EFLRHK FM S
Sbjct: 248 WHLEDQDLYSINFIHFGAPKQWYSIPQEDHQLFYNFMREQFPEEAKKCPEFLRHKTFMAS 307

Query: 297 PKVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKC 356
           PK+L  NGIRCN IVH Q+EFM+T+PYGYH+GFNYGYNLAESVNFALE WL IGE+A KC
Sbjct: 308 PKLLSENGIRCNKIVHYQNEFMITFPYGYHAGFNYGYNLAESVNFALEEWLEIGERANKC 367

Query: 357 MCVDDSVGIDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSL 416
           +CV+DSV ID++KL S ++                    K +PN  +       +T   +
Sbjct: 368 LCVNDSVEIDVRKLASNWY------------------IFKNKPNLKN-------ETDLRV 402

Query: 417 KSFNELINHSAYELQAMEDNPNQRSIR--------------STTPNQYFSNXXXXXXXXX 462
           +SF EL+NHS+ ELQ ++     + IR              S TP+Q+F+          
Sbjct: 403 RSFTELLNHSSQELQNIQKKQQVQPIRTFTESNKDVSLRSTSPTPSQFFTTNETNKPVIS 462

Query: 463 XXXX-----XXXXXNIVEPTLEDPTLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGP 517
                         NIVEPTLEDPTLKFKRK+ A   S      P+S             
Sbjct: 463 RVSSPFLSRMMDLSNIVEPTLEDPTLKFKRKLNAPSVSQNNTLPPIS------MPPLFQS 516

Query: 518 PALNNLHEESVLALSLASMANSGNSSPRNALPPLNSAVGNSRPYTPTGD----AILAPRP 573
           P L + +E++++ALSLA+MANSG SSPR  +P LNS++      +  G+    +ILAP+P
Sbjct: 517 PLLED-NEDNMIALSLANMANSGTSSPRLIIPALNSSIDPINSSSSNGNDRISSILAPKP 575

Query: 574 SY---------DQNPLSYYSTQTT----------------KSPMPLFKRINSPNRVTLNI 608
           S          + NP++Y ST +                 +S +   KRI SPN VTLNI
Sbjct: 576 SLSSSPYVTSNNNNPMTYNSTFSNHNNNIQNNVVPLSPGGRSNLSFIKRIKSPNIVTLNI 635

Query: 609 SRESSRSPISFGSEYGKPPLSKPHPLNAGAVNLTSLNQVSTIERNIP-SHRDRSAKAYHG 667
           SRE+SRSPI       +   +    L   A+  +SLNQ   +E N P  + D +      
Sbjct: 636 SRETSRSPILTSVPDFRSNNNNTGTLPYSAIPQSSLNQ---MELNNPLGNDDTNNNTVTN 692

Query: 668 DKVNI--------HGVSSGKFVGHQIXXXXXXXXXXXXXXXVLPGAGRPERATSPTSKIS 719
            +++I          +++G     +                    +       +   K +
Sbjct: 693 SELSILNQPPQKKQRLTNGTRSNQRKMELGVEQPSGDGVLIGNSSSNNNNNTNAQAPKFT 752

Query: 720 AEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           ++EII+S+ GK YVC EC+RQF+SGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH
Sbjct: 753 SDEIIMSETGKVYVCLECKRQFTSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 812

Query: 780 LNKKI 784
           LNKKI
Sbjct: 813 LNKKI 817

>YER169W (RPH1) [1597] chr5 (523364..525754) DNA damage-responsive
           repressor of PHR1, contains two C2H2-type zinc finger
           domains [2391 bp, 796 aa]
          Length = 796

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/810 (48%), Positives = 502/810 (61%), Gaps = 85/810 (10%)

Query: 5   PDHFEGGVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLR 64
           P    GGVPVF+P++E+F+DFY Y   I++YGMKSGVVK+IPP+EW ++L      E L+
Sbjct: 7   PSEIVGGVPVFKPTYEQFEDFYAYCKAINKYGMKSGVVKVIPPKEWKDKLDLPYSAETLQ 66

Query: 65  RIHIRSPIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMXXXXXXXXXXXXX 124
           +I I+SPIQQH+SG+KG+F+VQNVE+ K+YNIIQWKDL++DY  P+              
Sbjct: 67  KIKIKSPIQQHISGNKGLFMVQNVEKNKTYNIIQWKDLSKDYVPPEDPKARRNSRKGSVS 126

Query: 125 XXXXXXXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLNFTEP 184
                   N     + SF+ +DF +F+  Y ++ L+ + +   L+ LE YYWKTLNFT P
Sbjct: 127 KSTKLKLKNF----ESSFNIDDFEQFRTEYTID-LSDFQNTERLKFLEEYYWKTLNFTTP 181

Query: 185 MYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDL 244
           MYGADT G++FP+ L+ WNV++LPN+LDH+E KVPGVN SYLYAGLWKASF+WHLEDQDL
Sbjct: 182 MYGADTPGSIFPEGLNVWNVAKLPNILDHMETKVPGVNDSYLYAGLWKASFSWHLEDQDL 241

Query: 245 YSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERNG 304
           YSINY+HFGAPKQWYSIPQED  KF+KFMQEQFPEE+  C EFLRHKMF+ SPK+L+ NG
Sbjct: 242 YSINYIHFGAPKQWYSIPQEDRFKFYKFMQEQFPEEAKNCPEFLRHKMFLASPKLLQENG 301

Query: 305 IRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVDDSVG 364
           IRCN IVH + EFM+TYPYGYH+GFNYGYNLAESVNFALE WLPIG+KA KC C+ DSV 
Sbjct: 302 IRCNEIVHHEGEFMITYPYGYHAGFNYGYNLAESVNFALEEWLPIGKKAGKCHCISDSVE 361

Query: 365 IDIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFNELIN 424
           ID++KL  ++  + +E +       PP   L Q PN +     P+L              
Sbjct: 362 IDVKKLAKSWRDNNKESKGT-----PP---LNQLPNPA----MPLLHRPT---------- 399

Query: 425 HSAYELQAMEDNPNQRSIRSTTPN-QYFSNXXXXXXXXXX--XXXXXXXXNIVEPTLEDP 481
                L+ ME +    S+RST+P+  +FSN                    NIVEPTLEDP
Sbjct: 400 -----LKEMESS----SLRSTSPDVGHFSNFKSKSSGVSSPLLSRMKDYSNIVEPTLEDP 450

Query: 482 TLKFKRKVVAQDTSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGN 541
           TLK KR    Q+        P++ +    TS      A+   HE++++A+SL SMANS  
Sbjct: 451 TLKLKRISSFQE-------QPLNKLLKRETSQT----AMLTDHEDNIVAMSLTSMANSAA 499

Query: 542 SSPRNALPPLNSA--VGNSRPYTPTGDAILA-PRPS--YDQNPLSYYSTQTTK------- 589
           SSPR  L  LNS+  + N++P     +  LA PRP+     NPL Y S +          
Sbjct: 500 SSPRLPLSRLNSSNELSNAQPLLDMTNNTLAFPRPNGPSGLNPLLYISNKNISGISHSAP 559

Query: 590 -SP----MPLFKRINSPNRVTLNISRESSRSPISFGSEYGKP-----PLSKPHPLNAGAV 639
            SP    + L KR+ SPN VTLNISRESSRSPI+   E  +        S P  ++  + 
Sbjct: 560 HSPVNPNISLIKRVKSPNIVTLNISRESSRSPIALNYEARQQHSQQHSFSTPSTVSNLST 619

Query: 640 N----LTSLNQVSTIERNIPSHRDRSAKAYHGDKVNIHGVSSGKFVGHQIXXXXXXXXXX 695
           +    L+  N + T     P+H+  +        V     S    +  ++          
Sbjct: 620 SVLGPLSDTNDIKTPHPERPNHKTANRILKKESPVE---TSKSNLILSKVASTRQEDSFT 676

Query: 696 XXXXXVLPGAGRPERATSP-TSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSV 754
                +       E+ +SP  SK + EEI++S K K Y+C+ECQR+FSSGHHLTRHKKSV
Sbjct: 677 SRNDDL-----DKEQGSSPLNSKFAPEEIVLSGKNKIYICKECQRKFSSGHHLTRHKKSV 731

Query: 755 HSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           HSGEKPHSCPKCGK+FKRRDHVLQHLNKKI
Sbjct: 732 HSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 761

>CAGL0L11880g 1272624..1275566 some similarities with sp|P39956
           Saccharomyces cerevisiae YER169w, hypothetical start
          Length = 980

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/955 (38%), Positives = 493/955 (51%), Gaps = 187/955 (19%)

Query: 11  GVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLRRIHIRS 70
           GVPVFRP+WEEF+DF  YM  I  +GM SG+VK+IPPREW++R G  P  + LR + IR+
Sbjct: 6   GVPVFRPAWEEFKDFMGYMEKIRPHGMASGIVKVIPPREWLDRAGREPREDLLREVRIRN 65

Query: 71  PIQQHVSGSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPD-----MXXXXXXXXXXXXXX 125
           PIQQHVSGSKGV+++ NVE+ K+YN+IQWKDL+ D+++PD                    
Sbjct: 66  PIQQHVSGSKGVYMISNVEKNKTYNMIQWKDLSYDFRVPDDPSSLKNKSEESIQDNERSQ 125

Query: 126 XXXXXXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLNFTEPM 185
                   I+ +  DS ++EDF+ F + YN E +  +DDE  L+ LE+YYWKTLNFT P+
Sbjct: 126 QRRRSSSGIKLKNCDSATEEDFQNFMKEYNAENIRDFDDEERLKFLESYYWKTLNFTTPL 185

Query: 186 YGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLY 245
           YGAD+ G++FP  L +WNV++LPN+L H+++ +PGVNQ+YLYAGLWKASF WHLEDQDLY
Sbjct: 186 YGADSSGSIFPSDLEEWNVAKLPNVLSHIDQDIPGVNQAYLYAGLWKASFTWHLEDQDLY 245

Query: 246 SINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERNGI 305
           SINY+HFGAPKQWYSIPQED  KF++FM+E+FPEE+++C+EFLRHKMF+VSPKVL+ N I
Sbjct: 246 SINYIHFGAPKQWYSIPQEDHEKFYEFMKEKFPEEASKCKEFLRHKMFLVSPKVLKENNI 305

Query: 306 RCNSIVHRQHEFMVTYP--------YGYHSGFNYGYNLAE-------------------- 337
           +CN + H +HEF++TYP        YGY+   +  + L +                    
Sbjct: 306 KCNKVTHYEHEFIITYPYGYHAGFNYGYNLAESVNFALEDWLEIGKKAGKCRCISDSVEV 365

Query: 338 SVNFALESWLPIG--------------EKAKKCMCVDDSVGID----------------- 366
            V+   E+W                  +K +K   VD +  I                  
Sbjct: 366 DVDKLAENWSNFKKKREIEDPETEDSPQKKRKSSTVDSNETISNVSATKEDDEVKNEDND 425

Query: 367 -----IQKLKSAYFRSLQEDRAGSADPE------------PPRKRLKQEPNTSSFVQAPI 409
                I+ +K     S ++D   S D +             P   +K E N +  ++A +
Sbjct: 426 DNSKLIKDVKKEVTDSNEDDLNASVDVQRQSNDNTFGDNSNPATNIKMESNKTK-IEANV 484

Query: 410 LDTGDSLKSFNELINHSAYELQAME-----------DNPNQRSIRSTTP-NQYFSNXXXX 457
                 L+ F+EL+N S      ME           D+P    +RS +P    F N    
Sbjct: 485 PGVAKKLRGFDELLNRSPQNSPRMETSLKNDPFFARDSP----LRSNSPGTNLFFNQSIQ 540

Query: 458 XXXXXXXXXXXXXXNIVEPTLEDPTLKFKRK--VVAQDTSNAMAPNPV------------ 503
                         NIVEPTL+DPTLKFKRK  + +Q   N+   +P+            
Sbjct: 541 RMSSPILSKMIDLSNIVEPTLDDPTLKFKRKTNLPSQLIGNSNISSPLLQNIQDQQNQQQ 600

Query: 504 ----SGVGAPVTSVCVGP--------PALNNLHEESVLALSLASMANSGNSSPR------ 545
               S  G P++++  GP        P L + +++++LALSL SMANS  SSPR      
Sbjct: 601 QQQRSQNGTPLSNLSFGPMRSGLGSNPVLLDNNDDNMLALSLTSMANSRPSSPRLHHINI 660

Query: 546 ------NALPPLNSAVGNSRPYTPTGDAILAPRPSYDQNPLSYYSTQTTK---------- 589
                       N  V  +  +  +G  +          P+ YY  Q  +          
Sbjct: 661 PNEANSKMKSGSNDTVNAASNFVTSGSNVQQGMSVVSPKPVPYYGNQFERTFNSMPSPIP 720

Query: 590 -----SPMPLFKRINSPNRVTLNISRESSRSPISFGSEYGKP-----PLSKPHPLNAGAV 639
                S MP  KR+ SPN VTLNISRE S+SP+S  +E   P      LS P P      
Sbjct: 721 MSPGGSNMPFIKRLKSPNIVTLNISREGSKSPVSLQNEVRSPLGLNTTLSYPIPTEKQLS 780

Query: 640 NLTSLNQVSTIERNIP----------------SHRDRSAKAYHGDKVN-IHGVSSGKFVG 682
           NL  +N  S  +   P                S  D    A+     N +  +SS  +  
Sbjct: 781 NLNPVNN-SNYQAASPALMDDKNNINPNQNMNSLLDMGLSAFQNSPSNGLRQISSETYES 839

Query: 683 HQIXXXXXXXXXXXXXXXVLPGAGR------PERATSPTSKISAE-------EIIISDKG 729
             +                +    R       ++A S +  + A+       E+I+SD G
Sbjct: 840 SPLMSLAAAANKDIELTNSMMRPSRSKTKLPTDKARSKSKSVEAQGPKFEKGEVILSDSG 899

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           K YVCQEC+RQFSSGHHLTRHKKSVHSGEKPHSCPKCGK+FKRRDHVLQHLNKKI
Sbjct: 900 KIYVCQECKRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKRFKRRDHVLQHLNKKI 954

>YDR096W (GIS1) [946] chr4 (637133..639817) DNA damage-responsive
           repressor of PHR1, has two tandem C2H2-type zinc finger
           domains [2685 bp, 894 aa]
          Length = 894

 Score =  296 bits (757), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 180/521 (34%), Positives = 261/521 (50%), Gaps = 80/521 (15%)

Query: 11  GVPVFRPSWEEFQDFYKYMFLIDEYGMKSGVVKIIPPREWVERLGERPGVEQLRRIHIRS 70
           GVPVF+PS  EF +F  ++  I ++G+++G+VK+IPP+EW+E L   P  E L+ I + S
Sbjct: 11  GVPVFKPSMMEFANFQYFIDEITKFGIENGIVKVIPPKEWLELLEGSPPAESLKTIQLDS 70

Query: 71  PIQQHVS----GSKGVFVVQNVERQKSYNIIQWKDLAQDYQLPDMXXXXXXXXXXXXXXX 126
           PIQQ          GVF ++N    KSYN+ QWK+LA+                      
Sbjct: 71  PIQQQAKRWDKHENGVFSIENEYDNKSYNLTQWKNLAES--------------------- 109

Query: 127 XXXXXXNIRTR-TQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKTLNFTEPM 185
                  + +R +Q  F+D   +  +E+  V+      D + L+ LE+ +WKT+ F++P 
Sbjct: 110 -------LDSRISQGDFND---KTLKENCRVDSQQDCYDLAQLQILESDFWKTIAFSKPF 159

Query: 186 YGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLY 245
           Y  D   ++FP  L  WN++ LP+ ++    +        L  G  K  F WHL++Q+  
Sbjct: 160 YAVDENSSIFPYDLTLWNLNNLPDSINSSNRR--------LLTGQSKCIFPWHLDEQNKC 211

Query: 246 SINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERNGI 305
           SINYLHFGAPKQWYSIP  ++ +F K + ++       C  F+RH+  + SP  L +N I
Sbjct: 212 SINYLHFGAPKQWYSIPSANTDQFLKILSKEPSSNKENCPAFIRHQNIITSPDFLRKNNI 271

Query: 306 RCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVDDSVGI 365
           + N +V  QHEF++T+PY  +SGFNYGYN  ES+ F L+    + ++  KC C     G 
Sbjct: 272 KFNRVVQFQHEFIITFPYCMYSGFNYGYNFGESIEFILDQQAVVRKQPLKCGC-----GN 326

Query: 366 DIQKLKSAYFRSLQEDRAGSADPEPPRKRLKQEPNTSSFVQAPILDTGDSLKSFNELINH 425
             ++ KS  F +L  D   S      R  +    N          D    ++SF+EL+NH
Sbjct: 327 KKEERKSGPFSNLSYDSNESEQ----RGSITDNDN----------DLFQKVRSFDELLNH 372

Query: 426 SAYELQAMEDN------------PNQRSIRSTTPN--QYFSNXXXXXXXXXXX---XXXX 468
           S+ ELQ +EDN            P   S+RSTTPN    F N                  
Sbjct: 373 SSQELQNLEDNKNPLFSNINMNRPQSSSLRSTTPNGVNQFLNMNQTTISRISSPLLSRMM 432

Query: 469 XXXNIVEPTLEDPTLKFKRKVVAQDTSNAMAPNPVSGVGAP 509
              NIVEPTL+DP  KFKRKV+         P+  S  G P
Sbjct: 433 DLSNIVEPTLDDPGSKFKRKVLTPQLPQMNIPSNSSNFGTP 473

 Score =  132 bits (333), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%)

Query: 715 TSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 774
           +SK    E+I+SD GK Y+C+EC RQFSSGHHLTRHKKSVHSGEKPHSCP+CGK+FKRRD
Sbjct: 811 SSKFGENEVIMSDHGKIYICRECNRQFSSGHHLTRHKKSVHSGEKPHSCPRCGKRFKRRD 870

Query: 775 HVLQHLNKKI 784
           HVLQHLNKKI
Sbjct: 871 HVLQHLNKKI 880

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/173 (32%), Positives = 82/173 (47%), Gaps = 54/173 (31%)

Query: 511 TSVCVGPPALNNLHEESVLALSLASMANSGNSSPRNALPPLNSAVGNSRPYT-------- 562
           +S   G   L   +++++LALSLA++ANS  +SPR  LPPL+S + N   +T        
Sbjct: 548 SSTLNGTSGLGGDNDDNMLALSLATLANSATASPRLTLPPLSSPM-NPNGHTSYNGNMMN 606

Query: 563 ---------------------------PTGDAILAPRPSYDQNPLSYYSTQT-------- 587
                                      P   +I++P P+Y  NPLS Y T +        
Sbjct: 607 NNSGNGSNGSNSYSNGVTTAAATTTSAPHNLSIVSPNPTYSPNPLSLYLTNSKNPLNSGL 666

Query: 588 -----TKSPMPLFKRINSPNRVTLNISRESSRSPI-SFGSEYGKPPLSKPHPL 634
                + S +P  KR    N VTLNISRE+S+SPI SF ++Y + PL   +PL
Sbjct: 667 APLSPSTSNIPFLKR---NNVVTLNISREASKSPISSFVNDY-RSPLGVSNPL 715

>Scas_76.1
          Length = 228

 Score =  256 bits (654), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 126/226 (55%), Positives = 149/226 (65%), Gaps = 26/226 (11%)

Query: 85  VQNVERQKSYNIIQWKDLAQDYQLPDMXXXX--------------------------XXX 118
           VQNVE+ K YNIIQWKDL+ DY+ P+                                  
Sbjct: 1   VQNVEKNKIYNIIQWKDLSHDYKPPEGSSSTDPSTKGMNTRSRNASVGEEDAEHETNSEH 60

Query: 119 XXXXXXXXXXXXXXNIRTRTQDSFSDEDFREFQEHYNVEGLAQYDDESFLRGLENYYWKT 178
                          I+ R  ++F+ EDF EF   YN E L+Q  + S L  LE+YYW+T
Sbjct: 61  VTQKKKSQSPMKSSKIKLRNHENFTLEDFEEFLPSYNCENLSQLTEPSRLEFLESYYWRT 120

Query: 179 LNFTEPMYGADTLGTLFPDSLHQWNVSRLPNLLDHLEEKVPGVNQSYLYAGLWKASFAWH 238
           LNFT PMYGADTLG+LF D L  WNVSRLPNLLDH++ ++PGVN SYLYAGLWKASFAWH
Sbjct: 121 LNFTTPMYGADTLGSLFNDKLDTWNVSRLPNLLDHMDRRLPGVNDSYLYAGLWKASFAWH 180

Query: 239 LEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQC 284
           LEDQDLYSINYLHFGAPKQWYSIPQ+DSHKF+KFMQ+QFPE++A+ 
Sbjct: 181 LEDQDLYSINYLHFGAPKQWYSIPQQDSHKFYKFMQDQFPEDAAKL 226

>KLLA0D10758g 917125..919677 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, start by similarity
          Length = 850

 Score =  121 bits (303), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/250 (32%), Positives = 116/250 (46%), Gaps = 51/250 (20%)

Query: 147 FREFQEHYNVEGLAQYDDESF-------LRGLENYYWKTLNFTEP-----MYGAD----- 189
            + F+EH      A +DD+ F       +  LE  +W+ +    P      YGAD     
Sbjct: 360 LKSFKEH-----CANFDDQQFAGNKPNDIETLEKLFWEHVQEMVPNPITVKYGADIHRNK 414

Query: 190 --------TLGTLFP---------------DSLHQWNVSRLP----NLLDHLEEKVPGVN 222
                   T+G + P                S H WN+  LP    +LL  +  K+ G+ 
Sbjct: 415 PGQTTGFPTMGYVPPFITDKESDEFKQFLKVSSHPWNLINLPRARGSLLSIINRKISGMT 474

Query: 223 QSYLYAGLWKASFAWHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESA 282
             ++Y G   ++F WHLEDQ   S NY H G+ K WYSIP+  +  F + M+   P+   
Sbjct: 475 IPWIYVGSTFSTFCWHLEDQYTLSANYQHIGSQKIWYSIPERSTSAFDEMMKNISPDLFE 534

Query: 283 QCREFLRHKMFMVSP--KVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVN 340
           +  + L   + +VSP  K     GI C   +    E++VTYP  YH+GFN G+N  E+VN
Sbjct: 535 RQPDLLHQLITLVSPYSKRFVEAGIDCYKAIQNPGEYIVTYPKCYHAGFNSGFNFNEAVN 594

Query: 341 FALESWLPIG 350
           F L+ WLP G
Sbjct: 595 FTLDLWLPYG 604

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 12 VPVFRPSWEEFQDFYKYMFL--IDEYGMKSGVVKIIPPREW 50
          +P  RPS E+F D   ++    + + GMK G++K+IPP  +
Sbjct: 4  IPTLRPSEEQFLDPIGFLSSNEVKKLGMKYGMIKLIPPESF 44

>Sklu_2303.6 YJR119C, Contig c2303 8969-11356
          Length = 795

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 92/160 (57%), Gaps = 6/160 (3%)

Query: 200 HQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAP 255
           H  N+  LP    +LL    +K+ G+   ++Y G   ++F WHLEDQ   S NY H G P
Sbjct: 408 HPMNLLNLPQAKGSLLPVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANYQHEGDP 467

Query: 256 KQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSP--KVLERNGIRCNSIVHR 313
           K WYSIP+    KF + M++  P+   +  + L   + ++SP  K  ++  I C   + +
Sbjct: 468 KVWYSIPEHSCDKFNRLMKDIAPDLFEKQPDLLHQLITLISPYDKRFQQAKISCYKALQK 527

Query: 314 QHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKA 353
             E+++T+P  YH+GFN GYN  E+VNF L++WLP G +A
Sbjct: 528 PGEYIITFPKCYHAGFNTGYNFNEAVNFTLDTWLPYGIEA 567

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 2/41 (4%)

Query: 12 VPVFRPSWEEFQDFYKYMFL--IDEYGMKSGVVKIIPPREW 50
          VPV  P+ +EF+D   Y+    +   G   G++K++PPRE+
Sbjct: 7  VPVLYPTLQEFEDPISYLSQPQVQRQGHICGMIKLVPPREF 47

>CAGL0H00528g 52511..54733 similar to sp|P47156 Saccharomyces
           cerevisiae YJR119c, hypothetical start
          Length = 740

 Score =  113 bits (282), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 114/229 (49%), Gaps = 29/229 (12%)

Query: 147 FREFQEHYNVEGLAQYDDESFLRGLENYYW-----KTLNFTEPMYGADTLG------TLF 195
            +EF++ Y        D+   +  LE  +W     + +  T P YGAD         T F
Sbjct: 325 LKEFEQKYGT------DESPDVDKLEKEFWDLVGNQDVKTTVP-YGADIHSEDPAELTGF 377

Query: 196 PD-----SLHQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYS 246
           P      S H  N+  LP    +LL  L   + G+   ++Y G   ++F WHLEDQ   S
Sbjct: 378 PTNDKTYSTHPMNLLNLPQASSSLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLS 437

Query: 247 INYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPK--VLERNG 304
            NY H G+PK WYSIP      F K + +  P+   +  + L   + ++SP   + ++  
Sbjct: 438 ANYQHEGSPKVWYSIPDNSCDNFHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYN 497

Query: 305 IRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKA 353
           ++    V   +E++VT+P  YH+GFN GYN+ E+VNF  ESWLP G +A
Sbjct: 498 VKWYKAVQHPNEYIVTFPKCYHAGFNTGYNINEAVNFTSESWLPYGLEA 546

>ABR167C [760] [Homologous to ScYJR119C - SH] (714425..716755) [2331
           bp, 776 aa]
          Length = 776

 Score =  111 bits (278), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 121/258 (46%), Gaps = 49/258 (18%)

Query: 147 FREFQEHYN-VE---GLAQYDDESFLRG--------LENYYWKTLNFTE----PMYGADT 190
           F+E +  YN VE     A+YD + F  G        LE+ +W  ++  E      YGAD 
Sbjct: 295 FKEEEHLYNRVEFKSQCAEYDAKHFPEGKPLDNIGLLEDMFWDLVHDVENRATVKYGADI 354

Query: 191 ------LGTLFP----------------DSLHQW-----NVSRLP----NLLDHLEEKVP 219
                 + T FP                D+  Q+     N+  LP    +LL      + 
Sbjct: 355 HNEGPGVVTAFPTLEWVPPHITKGTPEYDAFLQYVEHPMNLLNLPMARGSLLPVFGRSIS 414

Query: 220 GVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPE 279
           G+   +LY G   ++F WHLEDQ   S NY H G PK WYSIP++ +  F K M+   P+
Sbjct: 415 GMTVPWLYIGSTFSTFCWHLEDQYTLSANYQHEGDPKVWYSIPEQSATAFNKLMKNIAPD 474

Query: 280 ESAQCREFLRHKMFMVSP--KVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLAE 337
              +  + +   + ++SP  +  E   I C   V    E+++TYP  YH+GFN GYN  E
Sbjct: 475 LFEKQPDLMHQLVTLISPYDEKFEAANIACYKAVQYPGEYIITYPKCYHAGFNTGYNFNE 534

Query: 338 SVNFALESWLPIGEKAKK 355
           +VNF L+ W+P G  A +
Sbjct: 535 AVNFTLDLWVPYGLSASE 552

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 11/63 (17%)

Query: 12 VPVFRPSWEEFQDFYKYM--FLIDEYGMKSGVVKIIPPREWVERLGERPGV---EQLRRI 66
          VPV  P+ +EF+D   Y+    +   G   G+VK++PPR      G +P +   + + R 
Sbjct: 9  VPVLHPTEDEFRDPIGYLSKAAVQRLGHVYGMVKLVPPR------GFQPPMTVNDDIFRF 62

Query: 67 HIR 69
          H+R
Sbjct: 63 HVR 65

>Kwal_55.21855
          Length = 521

 Score =  109 bits (273), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 86/160 (53%), Gaps = 6/160 (3%)

Query: 200 HQWNVSRLPN----LLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAP 255
           H  N+  LP+    LL    +K+ G+   ++Y G   ++F WHLEDQ   S N+ H G P
Sbjct: 137 HPMNLVNLPSAKGSLLSVFGKKISGMTVPWIYIGSTFSTFCWHLEDQYTLSANFQHEGDP 196

Query: 256 KQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSP--KVLERNGIRCNSIVHR 313
           K WYSIP     KF   M++  P+   +  + L   + +++P     +   I C   +  
Sbjct: 197 KVWYSIPGSSCDKFNTLMRQMAPDLFQKQPDLLHQLVTLIAPYDSAFKDAKISCYKAIQY 256

Query: 314 QHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKA 353
             E+++T+P  YHSGFN GYN  E+VNF L+ WLP G +A
Sbjct: 257 PGEYIITFPKCYHSGFNTGYNFNEAVNFTLDLWLPYGIEA 296

>YJR119C (YJR119C) [3011] chr10 complement(644219..646405) Protein
           containing a PHD-finger and jumonji (jmjN) and jumonji
           (jmjC) domains, has low similarity to a region of
           selected mouse cDNA on the Y homolog (human SMCY), which
           is a male-specific protein that elicits transplant
           rejection in female recipients [2187 bp, 728 aa]
          Length = 728

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 96/183 (52%), Gaps = 12/183 (6%)

Query: 200 HQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAP 255
           H  N++ LP    +LL   +  + G+   ++Y G   ++F WH+EDQ   S NY H G P
Sbjct: 385 HPMNLTNLPMAHNSLLPLFKRNISGMTIPWIYIGSLFSTFCWHMEDQYTLSANYQHEGDP 444

Query: 256 KQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKV--LERNGIRCNSIVHR 313
           K WYSIP+    KF   + +  P+   +  + L   + ++SP     +++GI     V +
Sbjct: 445 KVWYSIPESGCTKFNDLLNDMSPDLFIKQPDLLHQLVTLISPYDPNFKKSGIPVYKAVQK 504

Query: 314 QHEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIG------EKAKKCMCVDDSVGIDI 367
            +E+++T+P  YH+GFN GYN  E+VNF ++ WLP G       K  +  CV D   + I
Sbjct: 505 PNEYIITFPKCYHAGFNTGYNFNEAVNFTIDFWLPYGFGAITDYKLTQKACVFDMFDLMI 564

Query: 368 QKL 370
             L
Sbjct: 565 NVL 567

>Scas_691.27
          Length = 735

 Score =  110 bits (274), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/167 (36%), Positives = 88/167 (52%), Gaps = 11/167 (6%)

Query: 200 HQWNVSRLPNLLDHL-----EEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGA 254
           H  N+  LPN L  L      + + G+   ++Y G   ++F WH+EDQ   S NY H GA
Sbjct: 387 HPMNLVNLPNALGSLLPLLSNKTISGMTIPWIYVGSTFSTFCWHMEDQYTLSANYQHEGA 446

Query: 255 PKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVSPKVLERNGIRCNSIVHRQ 314
            K WYSIP      F K +    P+   + ++ +   + +VSP  L +  I C   +   
Sbjct: 447 SKIWYSIPASSCEPFQKLLHSMTPDLFIKQQDLIHQLVSLVSPYDLPK-SINCYKAIQNP 505

Query: 315 HEFMVTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCMCVDD 361
           +E+++T+P  +HSGFN GYNL E+VNF    WLP G +A     VDD
Sbjct: 506 NEYIITFPKCFHSGFNTGYNLNEAVNFTTPFWLPFGVEA-----VDD 547

>CAGL0G08107g 768772..770649 weakly similar to tr|Q03833
           Saccharomyces cerevisiae YDR096w GIS1 DNA
           damage-responsive repressor of PHR1, hypothetical start
          Length = 625

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (65%)

Query: 717 KISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHV 776
           +I   +I  SD  K + C+ C   F S +HL RH+ SVHS EKP++CP C K FKR+DHV
Sbjct: 547 QIFNSKIRYSDGFKYFYCEICDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHV 606

Query: 777 LQHLNKK 783
            QHL KK
Sbjct: 607 SQHLKKK 613

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%)

Query: 237 WHLEDQDLYSINYLHFGAPKQWYSIPQEDSHKFFKFMQEQFPEESAQCREFLRHKMFMVS 296
           W ++  + Y + +  FG P QWY +   +      ++++  P+ S  C  F  HK +   
Sbjct: 194 WRIDTVNQYHLIFNLFGTPIQWYIVEGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFG 253

Query: 297 PKVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNYGYNLA 336
           P  LER  I   ++V    +  ++ P      F+YGY++ 
Sbjct: 254 PDFLERANIPYKTMVQESGKLFISKPGTCFFVFHYGYSIV 293

>Scas_709.32
          Length = 822

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 1/72 (1%)

Query: 709 ERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 768
           ++AT+ T+K S      SD+ K + C+ C + F    HL RH +SVHS E+P +CP C K
Sbjct: 743 QKATTTTAKRSVS-YNFSDENKTFKCETCGKAFRRSEHLKRHIRSVHSSERPFACPTCDK 801

Query: 769 KFKRRDHVLQHL 780
           KF R D++ QH+
Sbjct: 802 KFSRSDNLAQHI 813

>Kwal_47.17241
          Length = 403

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 1/78 (1%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHS 762
           PG  + +R   P ++      I+ D  K + C  C R+F    HL RH +S+H GEKP  
Sbjct: 318 PGVVKKKRLGFPKTRGRKPSPIL-DASKQFACDFCDRRFKRQEHLKRHVRSLHMGEKPFD 376

Query: 763 CPKCGKKFKRRDHVLQHL 780
           C  CGKKF R D++ QH+
Sbjct: 377 CHICGKKFSRSDNLNQHI 394

>Scas_649.28
          Length = 730

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (57%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 771
           TS  + +S     + DK K + C EC + F    HL RH +SVHS E+P +C  C KKF 
Sbjct: 653 TSRRASVSVTPGSLDDKNKPFKCSECIKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFS 712

Query: 772 RRDHVLQHL 780
           R D++ QHL
Sbjct: 713 RSDNLSQHL 721

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           I D  K + C+ C R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 347 ILDASKQFGCEFCDRRFKRQEHLKRHVRSLHMGEKPYGCEICGKKFSRSDNLNQHI 402

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           DK K + C++C++ F    HL RH +SVHS E+P +C  C KKF R D++ QHL
Sbjct: 568 DKNKPFKCKDCEKAFRRSEHLKRHIRSVHSTERPFACMFCEKKFSRSDNLSQHL 621

>Scas_602.9
          Length = 547

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           ++ D  K + C  C+R+F    HL RH +S+H GEKP++C  C K F R D++ QH+
Sbjct: 487 LLPDATKQFACDYCERRFKRQEHLKRHVRSLHIGEKPYACHICNKNFSRSDNLTQHI 543

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           D  K + C+ C+R+F    HL RH +S+H GEKP+ C  CGKKF R D++ QH+
Sbjct: 455 DATKPFGCEYCERRFKRQEHLKRHIRSLHMGEKPYGCDICGKKFSRSDNLNQHI 508

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 36/57 (63%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           ++ D  K + C+ C R+F    HL RH +S+H GEKP+ C  C KKF R D++ QH+
Sbjct: 256 LVPDLSKQFGCEFCDRRFKRQEHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHI 312

>Kwal_26.8351
          Length = 698

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 707 RPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKC 766
           +P R +  +S +  EE       K + CQEC + F    HL RH +SVHS E+P  C  C
Sbjct: 623 KPPRNSKSSSPVEEEE-------KPFKCQECTKAFRRSEHLKRHIRSVHSSERPFHCSYC 675

Query: 767 GKKFKRRDHVLQHL 780
            KKF R D++ QHL
Sbjct: 676 DKKFSRSDNLSQHL 689

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (62%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           I D  K + C+ C R+F    HL RH +S+H  EKP+ C  CGKKF R D++ QHL
Sbjct: 411 ILDASKPFGCEYCDRRFKRQEHLKRHIRSLHICEKPYGCHLCGKKFSRSDNLSQHL 466

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 44/79 (55%), Gaps = 3/79 (3%)

Query: 704 GAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC 763
           G GR +    P  K S    I +DK + ++C  C R F+   HL RH++S H+ EKP  C
Sbjct: 54  GGGREDDGIVPIPKKS--RTIKTDKPRPFLCPVCTRGFARQEHLKRHQRS-HTNEKPFLC 110

Query: 764 PKCGKKFKRRDHVLQHLNK 782
             CG+ F RRD VL+H  K
Sbjct: 111 AFCGRCFARRDLVLRHQQK 129

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 58.5 bits (140), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 38/55 (69%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           +K + ++CQ C + F++  HL RH + +H+GEK H+C  P CG++F R D+ LQH
Sbjct: 75  EKRRKHLCQTCGKGFTTSGHLARHNR-IHTGEKNHACHFPGCGQRFSRHDNCLQH 128

>CAGL0E04884g complement(469295..473764) weakly similar to sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1489

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           S K + +VCQ C R F+   HLTRH++S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 24  SGKPRLFVCQTCTRAFARQEHLTRHERS-HTKEKPYCCGICDRRFTRRDLLLRHAHK 79

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 7/46 (15%)

Query: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRR 773
           K K Y C  C R+F+    L RH   VH G        CG+   R+
Sbjct: 54  KEKPYCCGICDRRFTRRDLLLRHAHKVHGG-------NCGESLLRK 92

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           ++ D  K + C  C+R+F    HL RH  S+H GE+P+SC  C K F R D++ QH
Sbjct: 210 LLFDDAKIFKCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQH 265

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           + ++ K + CQEC + F    HL RH +SVHS ++P  C  C KKF R D++ QHL
Sbjct: 497 LEEEEKPFKCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTYCDKKFSRSDNLSQHL 552

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 5/70 (7%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKK 769
           T P + +S EE +  ++ + Y+C+ C R F++  HL RH + +H+GEK H CP   C ++
Sbjct: 156 TDPRNTLSDEEDL--EQRRKYICKICARGFTTSGHLARHNR-IHTGEKNHCCPYKGCTQR 212

Query: 770 FKRRDHVLQH 779
           F R D+ LQH
Sbjct: 213 FSRHDNCLQH 222

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 32/54 (59%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           D  K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 479 DGAKPFQCADCDKAFRRSEHLKRHVRSVHSTERPFPCMFCEKKFSRSDNLSQHL 532

>AGR172W [4483] [Homologous to ScYDR216W (ADR1) - SH]
           complement(1071491..1074664) [3174 bp, 1057 aa]
          Length = 1057

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           S K + +VC  C R F+   HL RHK+S H+ EKP+ C  C ++F RRD +L+H +K
Sbjct: 43  SGKPRLFVCHTCTRAFARQEHLIRHKRS-HTNEKPYICGICDRRFSRRDLLLRHAHK 98

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRR 773
           K Y+C  C R+FS    L RH   +H G    +  K G   ++R
Sbjct: 75  KPYICGICDRRFSRRDLLLRHAHKLHGGSCGDALLKKGSPPRQR 118

>Scas_721.92
          Length = 1152

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           S K + +VC  C R F+   HL RH +S H+ EKP+ C  C KKF RRD +L+H  K
Sbjct: 72  SGKPRLFVCDVCSRAFARQEHLDRHARS-HTNEKPYQCGICTKKFTRRDLLLRHAQK 127

>Scas_703.23
          Length = 1341

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 723 IIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           +I +DK + ++C  C R F    HL RH++S H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 63  VIKTDKPRPFLCPTCTRGFVRQEHLKRHQRS-HTNEKPFLCVFCGRCFARRDLVLRHQHK 121

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           + ++ K + C +C + F    HL RH +SVHS E+P  C  C KKF R D++ QHL
Sbjct: 614 MDEEEKPFKCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQFCDKKFSRSDNLSQHL 669

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/55 (43%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779
           ++ + YVC+ C R F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 95  EQRRRYVCKICSRGFTTSGHLARHNR-IHTGEKNHVCPFEGCGQRFSRHDNCVQH 148

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 723 IIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           II +DK + ++C  C R F    HL RH+ S H+ EKP+ C  CG+ F RRD VL+H  K
Sbjct: 142 IIKTDKPRPFLCPTCTRGFVRQEHLKRHQHS-HTREKPYLCIFCGRCFARRDLVLRHQQK 200

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +I D  K + C+ C R+F    HL RH +S+H  EKP +C  C K F R D++ QH+
Sbjct: 381 LIPDASKQFGCEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHV 437

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           S K + +VC+ C R F+   HLTRH++S H+ EKP+ C  C ++F RRD +++H  K
Sbjct: 119 SGKPRLFVCKVCTRAFARQEHLTRHERS-HTKEKPYVCGICERRFTRRDLLIRHCQK 174

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           K K YVC  C+R+F+    L RH + +H G        CG   +R    ++  +KK
Sbjct: 149 KEKPYVCGICERRFTRRDLLIRHCQKLHGG-------NCGDYIRRTSRKVRRDSKK 197

>Kwal_47.16621
          Length = 1178

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 3/72 (4%)

Query: 711 ATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 770
           AT P  K S    I +D+ + ++C  C R F+   HL RH+++ H+ EKP  C  CG+ F
Sbjct: 59  ATMPIPKKS--RTIKTDRPRPFLCSICTRGFARQEHLKRHQRA-HTNEKPFLCAFCGRCF 115

Query: 771 KRRDHVLQHLNK 782
            RRD VL+H  K
Sbjct: 116 ARRDLVLRHQQK 127

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           +DK + ++C  C R F    HL RH+ S H+ EKP  C  CGK F R+D VL+HL K
Sbjct: 21  TDKPRPFLCPICSRGFVRQEHLKRHQNS-HTHEKPFLCLICGKCFARKDLVLRHLQK 76

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           I +DK + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 40  IKTDKPRPFLCPICTRGFARQEHLKRHQRS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 97

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 38/60 (63%), Gaps = 1/60 (1%)

Query: 723 IIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           +I +D+ + ++C  C R F+   HL RH++S H+ EKP  C  CG+ F RRD VL+H  K
Sbjct: 74  LIKTDRPRPFLCPICTRGFARQEHLRRHERS-HTNEKPFLCAFCGRCFARRDLVLRHQQK 132

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (60%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K + C  C + F    HL RH +SVHS E+P +C  C KKF R D++ QH+
Sbjct: 645 KPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHI 695

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +D  K + C  C + F    HL RH +SVHS ++P SC  C KKF R D++ QH+
Sbjct: 529 NDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHLCEKKFSRSDNLSQHI 583

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           I +DK + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H +K
Sbjct: 53  IKTDKPRPFLCHICTRGFVRQEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRHQHK 110

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           D  + YVC  C R F    H TRH ++ H+GEKPH+C  P CGK+F R D + +H
Sbjct: 29  DSPRPYVCPICSRAFHRLEHQTRHIRT-HTGEKPHACEFPGCGKRFSRSDELTRH 82

>Kwal_56.24206
          Length = 1502

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 89/219 (40%), Gaps = 54/219 (24%)

Query: 192 GTLFPDSLHQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSI 247
           G   P +L  WN++ +     ++L +L+        + L  G+  +   W +ED  L SI
Sbjct: 499 GDSLPGALSPWNLNNVATSENSMLRYLDADFGNHLDTKLDIGMLFSVKGWSIEDNFLASI 558

Query: 248 NYLHFGAPKQWYSIPQEDSHKFFKFMQ-------------------EQFPEESAQCREFL 288
           +Y H G+ K WY IP +D  KF + ++                   +QF E+S   + FL
Sbjct: 559 HYHHVGSSKLWYVIPPQDMEKFERLIEFYESQPQDVESSYPNGVETKQF-EKSEFYQSFL 617

Query: 289 R-------------------HKMFMVS-----------PKVLERNGIRCNSIVHRQHEFM 318
                               +K F  S           P+ L+ +GI    +V     F+
Sbjct: 618 DTTPSRPTSMRPHRVNTHTLNKNFQSSNSTLANDWNFHPETLKDHGITVYKVVQDPRSFI 677

Query: 319 VTYPYGYHSGFNYGYNLAESVNFALESWLPIGEKAKKCM 357
             +P  Y S  + G++++E   FA  SWL I  + +K +
Sbjct: 678 FRFPKSYSSNISSGFSVSEFALFAPTSWLGIAIEGEKWL 716

>Scas_718.44
          Length = 266

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779
           + +VC+ C   F++  HL+RH + +H+GEK HSCP   C +KF R D+ LQH
Sbjct: 208 RKHVCKICSTGFTTSGHLSRHNR-IHTGEKNHSCPFEGCNQKFSRHDNCLQH 258

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 726 SDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           S K +++VC+ C R F+   HL RH +S H+ EKP+ C  C + F RRD +++H  K
Sbjct: 98  SGKLRSFVCEVCTRAFARQEHLKRHYRS-HTNEKPYPCGLCNRCFTRRDLLIRHAQK 153

>Kwal_27.10925
          Length = 264

 Score = 54.7 bits (130), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 37/55 (67%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 779
           ++ + YVC+ C + F++  HL RH + +H+GEK H CP   CG++F R D+ +QH
Sbjct: 196 EQRRRYVCKICVKGFTTSGHLARHNR-IHTGEKNHVCPHEGCGQRFSRHDNCVQH 249

>Scas_707.31
          Length = 289

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           I+ D  K Y C  C+++F    HL RH +++H   +P  C  C K+F R D++ QH+
Sbjct: 215 ILPDDSKQYFCHLCKKRFKRHEHLKRHFRTIHLRVRPFECSVCHKRFSRNDNLNQHV 271

>AFL127C [3068] [Homologous to ScYMR176W (ECM5) - SH]
           (193474..198039) [4566 bp, 1521 aa]
          Length = 1521

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 79/203 (38%), Gaps = 54/203 (26%)

Query: 199 LHQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGA 254
           L  WN++ +P    +LL +L+     + +  ++ G+  ++  W L DQ L +I Y H G 
Sbjct: 541 LDPWNINNVPLAANSLLSYLDIDYGCLTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHLGC 600

Query: 255 PKQWYSIPQEDSHKFFKFMQE--------------------------QFPEESAQCREFL 288
              WY I  E    F K ++E                           + E + + R   
Sbjct: 601 SLLWYFIAPESQEAFEKLVEEINLGKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRLND 660

Query: 289 RHKM------------------------FMVSPKVLERNGIRCNSIVHRQHEFMVTYPYG 324
            HK+                          + P+ L++ GI+  + +     F++ YP  
Sbjct: 661 THKLRSKNGSHMFGQAARGPKSYLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYPRA 720

Query: 325 YHSGFNYGYNLAESVNFALESWL 347
           Y++    G++++ES   A ESWL
Sbjct: 721 YNTSIAAGFHVSESCYLAPESWL 743

>Scas_569.2
          Length = 293

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           +K + Y+C+ C + F++  HL RH + +H+GEK H C  P C  KF R D+ +QH
Sbjct: 223 EKRRKYICKVCSKGFTTSGHLARHNR-IHTGEKKHHCSYPGCYLKFSRHDNCVQH 276

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 49/79 (62%), Gaps = 4/79 (5%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHS 762
           P A +  + ++   + + +++ ++++ K Y+C+ C R F++  HL RH + +H+GEK H 
Sbjct: 256 PKASQQHKISNTGKQSNTKDLPLAERRK-YICKICSRGFTTSGHLARHNR-IHTGEKRHQ 313

Query: 763 C--PKCGKKFKRRDHVLQH 779
           C  P C ++F R D+ +QH
Sbjct: 314 CQFPGCNQRFSRHDNYIQH 332

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 3/52 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779
           + Y+C+ C + F++  HL RH + +H+GEK H CP   CG++F R D+ LQH
Sbjct: 400 RKYLCKVCGKGFTTSGHLARHNR-IHTGEKRHVCPYEGCGQRFNRHDNCLQH 450

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           I +DK + ++C  C R F    HL RH+++ H+ EKP  C  CG+ F RRD VL+H
Sbjct: 25  IKTDKPRPHLCPICTRGFVRLEHLKRHQRA-HTNEKPFLCVFCGRCFARRDLVLRH 79

>Scas_575.3
          Length = 455

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           D  + +VC  CQR F    H TRH ++ H+GEKPH C  P C KKF R D + +H
Sbjct: 63  DAPRPHVCPICQRAFHRLEHQTRHMRT-HTGEKPHECDFPGCVKKFSRSDELTRH 116

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 32/79 (40%), Gaps = 6/79 (7%)

Query: 703 PGAGRPERATSPTSKISAEEI-IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPH 761
           P  G P   T P    + E   IIS+ G     QE Q         +R  K      +PH
Sbjct: 14  PSRGLPRNTTRPPMDTTTETSNIISNGG----MQEPQTTVKKPRPRSRANKD-GDAPRPH 68

Query: 762 SCPKCGKKFKRRDHVLQHL 780
            CP C + F R +H  +H+
Sbjct: 69  VCPICQRAFHRLEHQTRHM 87

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           D  + YVC  CQR F    H TRH ++ H+GE+PH+C  P C K+F R D + +H
Sbjct: 21  DGPRPYVCPICQRGFHRLEHQTRHIRT-HTGERPHACDFPGCSKRFSRSDELTRH 74

 Score = 30.4 bits (67), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 750 HKKSVHS----GEKPHSCPKCGKKFKRRDHVLQHL 780
           HKKS++     G +P+ CP C + F R +H  +H+
Sbjct: 11  HKKSINDHDKDGPRPYVCPICQRGFHRLEHQTRHI 45

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K +VC  C ++F+ G +L  H++ +H+GEKP+SC  C KKF R+ ++  HL
Sbjct: 619 KPFVCDYCGKRFTQGGNLRTHER-LHTGEKPYSCDICDKKFSRKGNLAAHL 668

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + C  C R FS   HL  H +S H G KP  C  CGK+F +  ++  H
Sbjct: 591 KKHECPYCHRLFSQATHLEVHVRS-HIGYKPFVCDYCGKRFTQGGNLRTH 639

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 779
           ++ + ++CQ C   F++  HL+RH K +H+GEK H CP   C + F R D+ LQH
Sbjct: 247 EQRRKHICQICLTGFTTSGHLSRHAK-IHTGEKSHVCPHEGCNQSFSRHDNCLQH 300

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 716 SKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRR 773
           SK++A+    S+  + + C  C R F    H TRH + +H+GEKPH+C  P C K+F R 
Sbjct: 26  SKVAAK----SEAPRPHACPICHRAFHRLEHQTRHMR-IHTGEKPHACDFPGCVKRFSRS 80

Query: 774 DHVLQH 779
           D + +H
Sbjct: 81  DELTRH 86

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (61%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           D  + YVC  C R F    H TRH ++ H+GEKPH+C    CGK+F R+D + +H
Sbjct: 17  DAPRPYVCPICARAFHRLEHQTRHIRT-HTGEKPHACDFAGCGKRFSRQDELTRH 70

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           +K + + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H
Sbjct: 12  NKERPFKCEHCSRGFHRLEHKKRHMRT-HTGEKPHGCSFPGCGKSFSRSDELKRH 65

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           D  + +VC  C R F    H TRH ++ H+GEKPH+C  P C K+F R D + +H
Sbjct: 38  DAPRPHVCPICGRAFHRLEHQTRHMRT-HTGEKPHACDFPGCVKRFSRSDELTRH 91

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 15/22 (68%)

Query: 759 KPHSCPKCGKKFKRRDHVLQHL 780
           +PH CP CG+ F R +H  +H+
Sbjct: 41  RPHVCPICGRAFHRLEHQTRHM 62

>YPL038W (MET31) [5401] chr16 (480530..481063) Zinc-finger protein
           involved in transcriptional regulation of methionine
           metabolism, has two tandem C2H2-type zinc fingers [534
           bp, 177 aa]
          Length = 177

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
           Y C +CQ +FS    L RH+K VHS   PH C  CGK F R+D + +H N
Sbjct: 95  YSCAKCQLKFSRSSDLRRHEK-VHSLVLPHICSNCGKGFARKDALKRHSN 143

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           + Y+C  C + FS   H TRH++S H+G KP SC  C   F RRD + +H+
Sbjct: 6   RKYICSFCAQAFSRSEHKTRHERS-HTGVKPFSCKVCNHSFVRRDLLQRHI 55

>Scas_712.42*
          Length = 290

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 780
           + + C+ C R F    H  RH ++ H+GEKPH C  P CGK F R D + +HL
Sbjct: 16  RPFRCETCARGFHRLEHKKRHMRT-HTGEKPHHCAFPGCGKGFSRSDELKRHL 67

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K + C+ C ++F+ G +L  H + +H+GE+P+ C KCGK+F R+ ++  H+
Sbjct: 513 KPFQCEYCGKRFTQGGNLRTHVR-LHTGERPYECDKCGKRFSRKGNLAAHM 562

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 783
           K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  ++
Sbjct: 485 KQHKCPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGER 541

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           + Y+C  C + FS   H  RH++S H+G KP SC  C   F RRD + +H+
Sbjct: 6   RKYICSFCAKPFSRSEHKARHERS-HTGSKPFSCSICSHSFVRRDLLQRHI 55

>Kwal_14.2278
          Length = 463

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           + Y+C  C R F    H TRH ++ H+GEKPH+C    C K+F R D + +H
Sbjct: 21  RPYICPICSRAFHRLEHQTRHIRT-HTGEKPHACDFAGCTKRFSRSDELTRH 71

>Scas_697.35
          Length = 839

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y C  C ++F+ G +L  H++ +H+GEKP+ C  C KKF R+ ++  HL
Sbjct: 541 KPYQCGYCGKRFTQGGNLRTHQR-LHTGEKPYECELCDKKFSRKGNLAAHL 590

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 729 GKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
            K + C  C R F+   HL  H +S H G KP+ C  CGK+F +  ++  H
Sbjct: 512 SKQHKCPYCHRLFAQSTHLEVHIRS-HLGYKPYQCGYCGKRFTQGGNLRTH 561

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 17/29 (58%)

Query: 752 KSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K++H G K H CP C + F +  H+  H+
Sbjct: 506 KTLHEGSKQHKCPYCHRLFAQSTHLEVHI 534

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 3/58 (5%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 780
           + ++ + + C  C R F    H  RH ++ H+GEKPH C  P CGK F R D + +H+
Sbjct: 10  VDNENRPFRCDTCHRGFHRLEHKKRHLRT-HTGEKPHHCAFPGCGKSFSRSDELKRHM 66

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + C+ C ++F+ G +L  H + +H+GEKP+ C +CG+KF R+ ++  H
Sbjct: 549 KPFSCEFCGKRFTQGGNLRTHIR-LHTGEKPYECERCGRKFSRKGNLAAH 597

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 5/58 (8%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 783
           K + C  C + F+   HL  H +S H G KP SC  CGK+F +    R H+  H  +K
Sbjct: 521 KQFQCPYCHKYFTQSTHLEVHVRS-HIGYKPFSCEFCGKRFTQGGNLRTHIRLHTGEK 577

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 782
           K Y C+ C R+FS   +L  HK + H   KP  C    C K F +  ++  H N+
Sbjct: 577 KPYECERCGRKFSRKGNLAAHKLT-HDNLKPFECKLDDCNKNFTQLGNMKAHQNR 630

>Kwal_47.17888
          Length = 786

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + C+ C ++F+ G +L  H + +H+GEKP+ C KCG++F R+ ++  H
Sbjct: 529 KPFQCEYCGKRFTQGGNLRTHVR-LHTGEKPYECEKCGRRFSRKGNLAAH 577

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHLNKK 783
           K + C  C + F+   HL  H +S H G KP  C  CGK+F +    R HV  H  +K
Sbjct: 501 KQHECPYCHKCFTQSTHLEVHVRS-HIGYKPFQCEYCGKRFTQGGNLRTHVRLHTGEK 557

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 782
           K Y C++C R+FS   +L  H+ + H   KP  C    C K F +  ++  H N+
Sbjct: 557 KPYECEKCGRRFSRKGNLAAHRLT-HENLKPFHCKLDGCNKSFTQLGNMKAHQNR 610

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K K + C  C + FS   H TRH++S H+G KP  C  C   F RRD + +H+
Sbjct: 8   KTKRHFCSFCNKAFSRSEHKTRHERS-HAGVKPFECQVCSHSFVRRDLLQRHI 59

>Scas_719.68
          Length = 1350

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 724 IISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           I +DK + ++C  C R      HL RH++S H+ EKP  C  CG+ F RRD VL++  K
Sbjct: 33  IKTDKPRPFLCPICTR----TEHLKRHQRS-HTREKPFVCVFCGRCFARRDLVLRYQTK 86

>YGR067C (YGR067C) [2029] chr7 complement(622404..624788) Protein
           with two tandem zinc finger domains [2385 bp, 794 aa]
          Length = 794

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y+C  C + FS   H  RH++S H+G KP  C  C   F RRD + +H+
Sbjct: 6   KKYICSFCLKPFSRSEHKIRHERS-HAGVKPFQCQVCKHSFVRRDLLQRHI 55

>Scas_683.25
          Length = 879

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K ++C  C + FS   H  RH++S H+G KP+ C  C   F R D  L+H+
Sbjct: 13  KRFICSFCAKGFSRAEHKIRHERS-HTGLKPYKCKVCTHCFVRSDLALRHI 62

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 779
           + C+ C   F++  HL+RH + +H+GEK H CP   CG++F R D+  QH
Sbjct: 153 HFCKICSTGFTTSGHLSRHNR-IHTGEKNHICPHEGCGQRFSRHDNCNQH 201

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 48.5 bits (114), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%), Gaps = 3/50 (6%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779
           YVC EC + F+    L  H+ ++H+G++P +CP   CGK F  R ++L+H
Sbjct: 183 YVCTECGKGFARASSLRTHR-NIHTGDRPFTCPFKNCGKSFNARSNMLRH 231

>Scas_378.1
          Length = 208

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 727 DKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           D    Y C  C + F     L RH  + HS ++ +SCPKC  K KR+D++LQHL  K
Sbjct: 79  DTPSVYQCHMCVKSFRRHSWLKRHLLA-HSSQRHYSCPKCVSKHKRKDNLLQHLKLK 134

>Scas_693.31
          Length = 635

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 730 KAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           + Y C    C + F   H L RHKK VHS EK ++CP CGKKF R D ++ H ++ I
Sbjct: 517 RPYACDFPNCDKAFVRNHDLVRHKK-VHS-EKSYACP-CGKKFNREDALIVHRSRMI 570

>Scas_717.17
          Length = 525

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 728 KGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           +   Y+C  C + F     L RH  S HS E+ + CP C  + KRRD++LQH+  K
Sbjct: 384 ENAVYICHICSKNFKRRSWLKRHLLS-HSSERHYFCPWCLSRHKRRDNLLQHMKLK 438

>AGL246W [4066] [Homologous to ScYDR253C (MET32) - SH; ScYPL038W
           (MET31) - SH] complement(240857..241540) [684 bp, 227
           aa]
          Length = 227

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 22/99 (22%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDK---------------------GKAYVCQECQRQF 741
           PG  RPERA   +    +E+ +++ K                     GK + C +C+  F
Sbjct: 97  PGVARPERAREASLAYLSEDELLTKKRKTSPGAALEVSGGPEETVNDGKRFHCTKCELVF 156

Query: 742 SSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
                L RH+K VH    P+ C  CGK F R+D + +H 
Sbjct: 157 RRSGDLRRHEK-VHLPILPNICSLCGKGFARKDALKRHF 194

>YDR253C (MET32) [1086] chr4 complement(963982..964557) Zinc-finger
           protein involved in transcriptional regulation of
           methionine metabolism, has two tandem C2H2-type zinc
           fingers [576 bp, 191 aa]
          Length = 191

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
           K + C +C  +FS    L RH+K+ H    P+ CP+CGK F R+D + +H +
Sbjct: 96  KRFKCAKCSLEFSRSSDLRRHEKT-HFAILPNICPQCGKGFARKDALKRHYD 146

>Kwal_26.8021
          Length = 507

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           AY C  C + F       RH  S HS  KP+SCP C  + KRRD++ QH+  K
Sbjct: 388 AYRCSMCDKSFKRRSWHKRHLLS-HSSFKPYSCPWCQSRHKRRDNLFQHMKTK 439

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 726 SDKGKAYVC---QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           S + K + C     C   F+   HL RH +  H+GEKP  CP C K F R D++ QH
Sbjct: 35  SARRKTFKCTGYDGCTMSFTRAEHLARHIRK-HTGEKPFQCPACLKFFSRVDNLKQH 90

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + C+ C ++F+   +L  H++ +H+GE+P  C KC K F RR ++  H
Sbjct: 506 KPFECEFCGKRFTQAGNLRTHRR-LHTGERPFKCDKCDKTFARRGNLTAH 554

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           Y C  C + FS   HL  H K+ H G KP  C  CGK+F +  ++  H
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKA-HMGYKPFECEFCGKRFTQAGNLRTH 526

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 3/55 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNK 782
           + + C +C + F+   +LT H +  H   KP+ C    C K+F +  ++  H NK
Sbjct: 534 RPFKCDKCDKTFARRGNLTAH-EFTHESIKPYICRLDNCFKRFSQLGNMKSHQNK 587

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 3/53 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 780
           + Y+C+ C  +F    H TRH ++ H+GEKP +C  P C K+F R D + +H+
Sbjct: 10  RPYLCEICGNRFHRLEHKTRHIRT-HTGEKPFACTVPGCPKRFSRNDELKRHI 61

>Scas_568.5
          Length = 199

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 771
           T  ++K++      S   K Y C +C+  F     L RH+K+ H    PH C +CGK F 
Sbjct: 98  TDKSNKVAKRVRKDSYDNKRYPCSKCELIFLRSSDLRRHEKA-HLLVLPHICSQCGKGFA 156

Query: 772 RRDHVLQHLNKK 783
           R+D + +H N +
Sbjct: 157 RKDALKRHFNTQ 168

>Kwal_47.19045
          Length = 266

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 3/53 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 780
           + + C  C + F    H  RH ++ H+GEKPHSC  P C K+F R D + +H+
Sbjct: 12  RPFKCDMCGKGFHRLEHKRRHIRT-HTGEKPHSCNFPGCVKRFSRSDELKRHV 63

>Sklu_1527.1 YPL038W, Contig c1527 389-1006
          Length = 205

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHS 762
           P   R +  +S T   S E++   ++ K Y C +C+  F     L RH+++ H    P+ 
Sbjct: 96  PRKKRHKSTSSSTEADSVEDVQQLNEDKKYQCDKCELVFRRSSDLRRHERA-HLPILPNI 154

Query: 763 CPKCGKKFKRRDHVLQH 779
           C  CGK F R+D + +H
Sbjct: 155 CSLCGKGFARKDALKRH 171

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 730 KAYVCQE--CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           + Y C    C + F   H L RHKKS    EK ++CP CGKKF R D ++ H ++ I
Sbjct: 578 RPYSCDHPGCDKAFVRNHDLIRHKKSHQ--EKAYACP-CGKKFNREDALVVHRSRMI 631

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 728 KGKAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           + K Y C  Q C + F+    LT H+ +VH G KP  C  CGK+F ++ H+ +H+
Sbjct: 102 RSKVYFCDYQGCNKSFTRPSLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHM 156

 Score = 37.7 bits (86), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 716 SKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 775
           S ++  ++ +    K + C  C ++F+   HL RH  S H+ +KP +C  CGK    R  
Sbjct: 121 SLLTEHQLTVHHGIKPFKCDTCGKEFAKKSHLNRHMFS-HTDDKPFTCSICGKGVTTRQQ 179

Query: 776 VLQH 779
           + +H
Sbjct: 180 LKRH 183

>Kwal_27.11460
          Length = 531

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 709 ERATSPTSKISAEEII----ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP 764
           E A   TS ++A  II    +      Y C+ C ++F+  ++L  H ++ H+ E+P SC 
Sbjct: 386 ESADEGTSPLNATGIIRRKSLQKNASVYACELCDKKFTRPYNLKSHLRT-HTDERPFSCA 444

Query: 765 KCGKKFKRRDHVLQH 779
            CGK F R+    +H
Sbjct: 445 ICGKAFARQHDRKRH 459

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 10/60 (16%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 780
           + + C  C + F+  H   RH+  +H+G+K ++C           CGKKF R D + +H 
Sbjct: 439 RPFSCAICGKAFARQHDRKRHE-DLHTGQKRYTCHGKLKDGTEWGCGKKFARSDALGRHF 497

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 5/55 (9%)

Query: 729 GKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           G+ YVCQ   C+R+FS    L +H+ + H+ E+P+ C  P CGK+F R  H+  H
Sbjct: 54  GRKYVCQIDGCKREFSVPSLLAQHRNA-HTDERPYVCDEPNCGKRFLRPCHLRVH 107

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           + + C+ C R F    H  RH ++ H+GEKPH C  P C K F R D + +H
Sbjct: 18  RPFRCEICSRGFHRLEHKKRHFRT-HTGEKPHKCKFPSCPKSFSRADELKRH 68

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 31/56 (55%), Gaps = 4/56 (7%)

Query: 730 KAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           + Y C    CQ+ F   H L RHKKS    EK +SC  CGKKF   D +++H  +K
Sbjct: 721 RPYKCDFPGCQKAFVRNHDLLRHKKS--HLEKGYSCAGCGKKFHSEDSLVKHQERK 774

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 771
           T  T  I A+ I      + + C  C++QFS+   L  H ++ H+GEKP SC  CGK+F 
Sbjct: 552 TFSTDDILAQHIRTHSGERPFHCHYCRKQFSTSSSLRVHIRT-HTGEKPLSCTVCGKRFN 610

Query: 772 RRDHVLQHL 780
              ++ +H+
Sbjct: 611 ESSNLSKHM 619

>Scas_636.14d
          Length = 275

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 704 GAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC 763
           G+  P +A  PT  +             + C  CQ+ + +     +H K VH  E+ H C
Sbjct: 195 GSTEPTQAAQPTEALRI--------NPEFPCPHCQKTYRTEAQQKKHLKDVHV-ERKHMC 245

Query: 764 PKCGKKFKRRDHVLQH 779
             C + FKR+DH+++H
Sbjct: 246 LFCSRWFKRKDHMIKH 261

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 717 KISAE-EIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRR 773
           K SA+ EI  + +   ++C+ C ++F     L+ H  ++H+GEKP+ CP   C K F  +
Sbjct: 157 KFSAQAEINKTSEDTKFICKVCLKKFKRPSSLSTHM-NIHTGEKPYPCPFDNCTKSFNAK 215

Query: 774 DHVLQH 779
            ++L+H
Sbjct: 216 SNMLRH 221

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 8/70 (11%)

Query: 713 SPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKF 770
           SPT+ +  +       GKA +C +C +QF+    L  H   VHSG+KP  C    C KKF
Sbjct: 218 SPTTVVKGKA-----NGKADICAQCGKQFTRPSALRTHML-VHSGDKPFECTWEGCNKKF 271

Query: 771 KRRDHVLQHL 780
             + ++++HL
Sbjct: 272 NVKSNLIRHL 281

>Scas_687.33
          Length = 288

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHL 780
           + + C  C R F    H  RH ++ H+GEKPH C    CGK F R D + +H+
Sbjct: 15  RPFRCPICSRGFHRLEHKKRHVRT-HTGEKPHPCTFAHCGKSFSRGDELKRHI 66

>Scas_627.17d
          Length = 275

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 704 GAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC 763
           G+  P +A  PT  +             + C  CQ+ + +     +H K VH  E+ H C
Sbjct: 195 GSTEPTQAAQPTEALKI--------NPGFPCPHCQKTYLTEAQQKKHLKDVHV-ERKHMC 245

Query: 764 PKCGKKFKRRDHVLQH 779
             C + FKR+DH+++H
Sbjct: 246 LFCSRWFKRKDHMIKH 261

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%)

Query: 723 IIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 770
           + +  K K Y C +CQ+ FS+   L +HK+ VHSGEKP+ C  C K+F
Sbjct: 588 LKVHSKYKPYQCPQCQKCFSTEDTLNQHKR-VHSGEKPYECHICHKRF 634

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 721 EEIIISDKGKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 778
           EE+ ++     Y C+   C + FS    L RH K VHS  KP+ CP+C K F   D + Q
Sbjct: 556 EEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLK-VHSKYKPYQCPQCQKCFSTEDTLNQ 614

Query: 779 H 779
           H
Sbjct: 615 H 615

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y C  C ++F+  + L  H ++ H+GEKP  C  CG+ F    ++ +H+
Sbjct: 623 KPYECHICHKRFAISNSLKIHIRT-HTGEKPLKCKVCGRCFNESSNLSKHM 672

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 723 IIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 770
           + +  K K Y C+ C+R FSS   L +H ++ HSGEKP+ C  C KKF
Sbjct: 759 LKVHSKYKPYKCKTCKRCFSSEETLVQHTRT-HSGEKPYKCHICNKKF 805

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 707 RPERATSPTSKISAEEIIISDK-----GKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPH 761
           +P +  +     S+EE ++         K Y C  C ++F+    L  H ++ H+GEKP 
Sbjct: 766 KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRT-HTGEKPL 824

Query: 762 SCPKCGKKFKRRDHVLQHL 780
            C  CGK+F    ++ +H+
Sbjct: 825 QCKICGKRFNESSNLSKHI 843

>Scas_720.33
          Length = 316

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 730 KAYVCQ---ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + CQ   +C   F+   HL RH +  H+GEKP  C  C + F R D++ QH
Sbjct: 13  KTFACQGYKDCHMTFTREEHLARHIRK-HTGEKPFQCYICFRFFSRMDNLKQH 64

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           YVC+ C + FS  ++L  H ++ H+ EKP+ C  CGK F R+    +H
Sbjct: 521 YVCEVCGKVFSRPYNLKSHLRT-HTDEKPYQCSICGKAFARQHDKKRH 567

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 780
           K Y C  C + F+  H   RH + +H+G+K + C           CGKKF R D + +H 
Sbjct: 547 KPYQCSICGKAFARQHDKKRH-EDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHF 605

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHL 780
           + + C+ C R F    H  RH ++ H+GEKPH C    C K F R D + +HL
Sbjct: 15  RPFRCEICSRGFHRLEHKKRHGRT-HTGEKPHKCTVQGCPKSFSRSDELKRHL 66

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           C + F   H L RHKK+    EK  +CP CGKKF R D +L H  + I
Sbjct: 711 CTKAFVRNHDLIRHKKT--HAEKTFTCP-CGKKFSREDALLTHRTRMI 755

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 734 CQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           C  C++ F     L RH  S HS  KP+SCP C  + KR+D++ QHL  K
Sbjct: 187 CHFCEKAFKRKSWLKRHLLS-HSTMKPYSCPWCHSRHKRKDNLSQHLKLK 235

>Kwal_56.23925
          Length = 745

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 5/57 (8%)

Query: 730 KAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           + Y C  + C + F   H L RHKK+    EK + CP CGKKF R D +L H ++ I
Sbjct: 613 RPYFCDFEGCHKAFVRNHDLIRHKKT--HAEKCYVCP-CGKKFVREDALLVHRSRMI 666

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           +Y C  C++QF     L RH  S HS  K   CP C    KR+D++LQHL  K
Sbjct: 305 SYQCHLCEKQFRRKSWLKRHLLS-HSNVKKFHCPWCSSTHKRKDNLLQHLKLK 356

>YMR176W (ECM5) [4131] chr13 (611739..615974) Protein involved in
           cell wall structure or biosynthesis [4236 bp, 1411 aa]
          Length = 1411

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 77/214 (35%), Gaps = 57/214 (26%)

Query: 199 LHQWNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGA 254
           L QWN+  +P    +LL HL+  +    ++    G+  +   W + D  L SI++ H G+
Sbjct: 479 LDQWNLDNIPLNELSLLQHLDLDMANFTRTTYDIGMLFSCQGWSVSDHFLPSIDFNHLGS 538

Query: 255 PKQWYSIPQEDSHKFFKFMQE------------QFPEESAQCREFLR---HKMFMVSPK- 298
            K  YSI  +D  KF   +              ++     + + F+    +K F+ + + 
Sbjct: 539 TKLVYSIAPKDMEKFEALIARGKSEWDTIQSRPRYSTSDDELKSFIETDFYKSFLDAEQS 598

Query: 299 --------------------------------VLERNGIRCNSI-----VHRQHEFMVTY 321
                                           + E N I  N I        Q  ++  +
Sbjct: 599 ADYSNTGDNSKNSFPEDKIAGNTLHDGSQSDFIFEPNFILANGIKLYKTTQEQGSYIFKF 658

Query: 322 PYGYHSGFNYGYNLAESVNFALESWLPIGEKAKK 355
           P  +      G+ L+++  FA  SWL    +A K
Sbjct: 659 PKAFTCSIGSGFYLSQNAKFAPSSWLRFSSEAAK 692

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 720 AEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
            E+I +S     + C  C + F     L RH  S HS ++   CP C  + KRRD++LQH
Sbjct: 522 GEKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLS-HSQQRHFLCPWCNSRHKRRDNLLQH 580

Query: 780 LNKK 783
           +  K
Sbjct: 581 MKLK 584

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 711 ATSPTSKISAEEII---ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCG 767
           A  P+S   A  ++    SD    + CQ C++ F     L RH  S HS ++   CP C 
Sbjct: 322 APVPSSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSWLKRHLLS-HSQQRHFLCPWCL 380

Query: 768 KKFKRRDHVLQHLNKK 783
            + KR+D++LQH+  K
Sbjct: 381 SRQKRKDNLLQHMKLK 396

>Scas_720.39
          Length = 1455

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 74/199 (37%), Gaps = 53/199 (26%)

Query: 202 WNVSRLP----NLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAPKQ 257
           W +  +P    +LL +L+  +    ++    G++ +   W + D  L SI+Y H G+ K 
Sbjct: 499 WRLENIPLSEDSLLRYLDLDLGCNTRTKFDIGMFLSVAGWSVTDNFLPSIDYHHMGSSKL 558

Query: 258 WYSIPQEDSHKFFKFMQ--------------------EQFPEE----------------- 280
           WY +  +D  K    M+                    + F E                  
Sbjct: 559 WYVVSPKDLEKLEALMKNVDTEIEKTQTQMLASISLNDNFKESEFFIAYDMTKQTNFSIQ 618

Query: 281 -SAQCREFL---RHKMF--------MVSPKVLERNGIRCNSIVHRQHEFMVTYPYGYHSG 328
            SA  R+ L   +   F        + +   L++NGI   ++      ++ TYP  Y S 
Sbjct: 619 TSADFRKDLSLTKENNFEQPSKPASLFTTAFLKKNGIEVRTVSQDSGSYIFTYPKTYTSY 678

Query: 329 FNYGYNLAESVNFALESWL 347
              G  L++   FA +SWL
Sbjct: 679 IGAGVYLSQHATFAPKSWL 697

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           C+  FS   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 33  CEMSFSRAEHLARHIRR-HTGEKPFKCDICLKYFSRIDNLKQH 74

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           Y C EC + F+    L+ H  ++H+G+KP+ C  P C K+F  + ++L+H
Sbjct: 304 YRCAECGKAFARPSSLSTH-MNIHTGDKPYKCLYPNCYKQFNAKSNMLRH 352

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 707 RPERATSPTSKISAEEIIISDKGKAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCP 764
           R   A S  S  S E    S + K + C  + C + F+    LT H+++ H G + + C 
Sbjct: 94  RTTSAGSTVSLSSVESTASSTRRKTHYCDYEGCYKAFTRPSLLTEHQQTAHQGIRAYQCE 153

Query: 765 KCGKKFKRRDHVLQHL 780
           +CG+ F ++ H+ +HL
Sbjct: 154 QCGRGFTKKSHLERHL 169

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           +AY C++C R F+   HL RH  S HS  KP SC  CGK    R  + +H
Sbjct: 148 RAYQCEQCGRGFTKKSHLERHLFS-HSETKPFSCTVCGKGVTTRQQLRRH 196

>KLLA0C16005g 1397274..1398269 some similarities with sgd|S0006151
           Saccharomyces cerevisiae YPL230w USV1, hypothetical
           start
          Length = 331

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 4/54 (7%)

Query: 730 KAYVCQ---ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K++ CQ   +C+ +F+   HL RH +  H+GE+P  C  C + F R D++ QH+
Sbjct: 18  KSFKCQGFGDCRMEFTRQEHLARHIRK-HTGEQPFQCHLCLRFFSRLDNLKQHV 70

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 736 ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           +C   F+   HL RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 26  DCNMSFNRTEHLARHIRK-HTGEKPFQCNICLKFFSRIDNLRQH 68

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 731 AYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +Y C    C + F+    L RH K VHSG KP  CP C KKF   D + QH+
Sbjct: 627 SYQCSWDTCSKSFTQRQKLLRHLK-VHSGYKPFKCPHCTKKFSTEDILQQHI 677

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 707 RPERATSPTSKISAEEI----IISDKG-KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPH 761
           +P +    T K S E+I    I +  G + + C  C +QF++   L  H ++ H+GEKP 
Sbjct: 656 KPFKCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRT-HTGEKPL 714

Query: 762 SCPKCGKKFKRRDHVLQHL 780
            C  CGK+F    ++ +H+
Sbjct: 715 KCKICGKRFNESSNLSKHM 733

>Scas_631.7
          Length = 433

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 710 RATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 769
           +A +  S +S  ++      K + C++C +QFS   HL RH  S HS  KP  C  CGK 
Sbjct: 66  KAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHLIS-HSDSKPFCCLHCGKG 124

Query: 770 FKRRDHVLQH 779
              R  + +H
Sbjct: 125 VTTRQQLKRH 134

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 730 KAYVCQE--CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y C    C + F+    L+ H+ + H G KP  C +C K+F R+ H+ +HL
Sbjct: 55  KNYFCDYSGCTKAFTRPSLLSEHQLTFHQGIKPFKCEQCDKQFSRKTHLERHL 107

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR 772
            Y C  C ++F+  ++L  H +S H+ E+P+ C  CGK F R
Sbjct: 468 VYACDICDKKFTRPYNLKSHLRS-HTDERPYVCSVCGKAFAR 508

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 780
           + YVC  C + F+  H   RH+  +H+G++ + C           CGKKF R D + +H 
Sbjct: 495 RPYVCSVCGKAFARMHDKNRHED-LHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHF 553

Query: 781 NKKI 784
             ++
Sbjct: 554 KTEL 557

>Scas_695.2
          Length = 571

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           AY C+ C + F+  ++L  H ++ H+ E P  C  CGK F R+    +H
Sbjct: 451 AYACELCDKTFTRPYNLKSHLRT-HTNEXPFVCNICGKAFARQHDRKRH 498

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 10/58 (17%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP---------KCGKKFKRRDHVLQHL 780
           +VC  C + F+  H   RH + +H+G+K + C           C KKF R D + +H 
Sbjct: 480 FVCNICGKAFARQHDRKRH-EDLHTGKKRYVCGGVLKNGTPWGCHKKFARSDALGRHF 536

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 730 KAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           + Y C    C + F   H L RHKK+    EK ++CP CGK F R D +  H ++ I
Sbjct: 584 RPYRCDYDGCDKAFVRNHDLVRHKKTHQ--EKSYACP-CGKMFNREDALAVHRSRMI 637

>Kwal_23.5400
          Length = 429

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 26/44 (59%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           C + FS    LT H++ VH G KP  C  C ++F R+ H+ +H+
Sbjct: 57  CSKAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHM 100

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 710 RATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKK 769
           +A S  S+++  + ++    K + C  C RQFS   HL RH  S HS +KP  C  CGK 
Sbjct: 59  KAFSRPSQLTEHQEVVHQGIKPFQCTVCARQFSRKTHLERHMFS-HSEDKPFKCSYCGKG 117

Query: 770 FKRRDHVLQH 779
              +  + +H
Sbjct: 118 VTTKQQLRRH 127

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 6/55 (10%)

Query: 730 KAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           K Y C  + C + F   H L RHKK   + +K  SCP CGKKF     +++H N+
Sbjct: 551 KPYKCDFEGCTKAFVRNHDLARHKK---THDKHFSCP-CGKKFSSEQSMMKHKNR 601

>Scas_717.60d
          Length = 167

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 719 SAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQ 778
           S+ EI+ S++   + C+EC + F +   L +H K  HS         CGK FKR+D    
Sbjct: 88  SSCEILTSNE--LFNCKECSKAFVTSQKLKKHTKDAHSKRMFPCEYNCGKAFKRKDQRKS 145

Query: 779 H 779
           H
Sbjct: 146 H 146

>Scas_711.56
          Length = 832

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 770
           K + C  C++ FS+   L +H+++ HSGEKP  C  CGK+F
Sbjct: 724 KPFQCSICKKHFSNEETLKQHERT-HSGEKPFKCDICGKRF 763

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 728 KGKA-YVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           KG++ Y C    C + FS    L RH + VHSG KP  C  C K F   + + QH
Sbjct: 691 KGQSQYECHWANCHKIFSQRQRLVRHMR-VHSGYKPFQCSICKKHFSNEETLKQH 744

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K + C  C ++F+    L  H ++ H+GEKP  C  CGK F    ++ +H+
Sbjct: 752 KPFKCDICGKRFAISSSLKIHIRT-HTGEKPLHCKICGKAFNESSNLSKHM 801

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           Y C  C ++F+  ++L  H ++ H+ E+P SC  CGK F R+    +H
Sbjct: 426 YSCNLCDKKFTRPYNLKSHLRT-HTDERPFSCSVCGKAFARQHDRKRH 472

 Score = 36.6 bits (83), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 10/60 (16%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 780
           + + C  C + F+  H   RH+  +HSG+K + C           CGKKF R D + +H 
Sbjct: 452 RPFSCSVCGKAFARQHDRKRHED-LHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHF 510

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 730 KAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y+C+   C + F+    LT H+ +VH G KP  C +C   F ++ H+ +HL
Sbjct: 34  KTYLCEYDNCDKAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHL 86

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           K + C +C+  F+   HL RH  + H+ E+P  C  CGK    R  + +H
Sbjct: 65  KPWKCNQCESSFTKKIHLERHLYT-HTDERPFYCSFCGKGLITRQQLKRH 113

>KLLA0C16203g complement(1414169..1418533) weakly similar to
           sp|Q03214 Saccharomyces cerevisiae YMR176w ECM5 involved
           in cell wall biogenesis and architecture singleton,
           start by similarity
          Length = 1454

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/196 (18%), Positives = 76/196 (38%), Gaps = 50/196 (25%)

Query: 202 WNVSRL----PNLLDHLEEKVPGVNQSYLYAGLWKASFAWHLEDQDLYSINYLHFGAPKQ 257
           WN++ +     +LL + +     +    +  G+  ++  W LED+ L  +++ + G+ K 
Sbjct: 538 WNLNTINLSEKSLLQYQDLDFGNLAGGKIDVGMMLSTSGWALEDEFLPLLDFSYLGSSKV 597

Query: 258 WYSIPQE-----------------------------DSHKFFKFMQEQFPEESAQCRE-- 286
           WY +P +                             +S  F  F +  F ++    R+  
Sbjct: 598 WYFVPPQYRNSLEALFDDIRNKKEVKSSDQFEADFTESDFFQSFQETNFLDQHKTSRKRS 657

Query: 287 ----FLRHKM-----------FMVSPKVLERNGIRCNSIVHRQHEFMVTYPYGYHSGFNY 331
               FL++ +           F +S   L  + IR   ++     F++ YP  Y +  + 
Sbjct: 658 INHMFLKNLVQDKHNSYTPNDFQISTSELSASHIRYFKVIQDPKTFIMKYPQVYSTSISS 717

Query: 332 GYNLAESVNFALESWL 347
           G+ ++E   FA E W+
Sbjct: 718 GFQISEKSLFAPEEWV 733

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%)

Query: 715 TSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 774
           T  I  + + +    + + C  C + +S+   L  H ++ H+GEKP SCP C K+F    
Sbjct: 703 TQDILTQHLRVHSGERPFKCHLCPKSYSTSSSLRIHIRT-HTGEKPLSCPICNKRFNESS 761

Query: 775 HVLQHL 780
           ++ +H+
Sbjct: 762 NLAKHI 767

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 731 AYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +Y C+   C + F     L RH K VHS  KP  C +CGK F  +D + QHL
Sbjct: 661 SYKCEWEGCNKVFVQKQKLIRHLK-VHSKYKPFRCAECGKCFNTQDILTQHL 711

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKR----RDHVLQHL 780
           +  K K + C EC + F++   LT+H + VHSGE+P  C  C K +      R H+  H 
Sbjct: 685 VHSKYKPFRCAECGKCFNTQDILTQHLR-VHSGERPFKCHLCPKSYSTSSSLRIHIRTHT 743

Query: 781 NKK 783
            +K
Sbjct: 744 GEK 746

>AFL136W [3059] [Homologous to ScYPL230W - SH; ScYMR182C (RGM1) -
           SH] complement(178780..180009) [1230 bp, 409 aa]
          Length = 409

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           C R F+   HL RH +   +GEKP  C  C + F R D++ QH
Sbjct: 28  CDRSFTRAEHLARHIRK-QTGEKPSQCEVCNRFFSRIDNLKQH 69

>CAGL0B02651g complement(253495..254064) weakly similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 189

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
           K Y C  C   +     L +H+++ H  ++ + C  CGKKF R+D + +H +
Sbjct: 118 KIYPCNICGISYDKLTDLRKHERASHEPKQENVCMNCGKKFARKDALKRHFD 169

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 728 KGKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKKI 784
           + + Y C    C + F   H L RHK S H+ +K + CP CGK+F R D ++ H ++ I
Sbjct: 629 QDRPYSCDFPGCTKAFVRNHDLIRHKIS-HNAKK-YICP-CGKRFNREDALMVHRSRMI 684

>CAGL0I02838g complement(248704..250671) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 655

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 768
           K + CQ C R F+   HL  H +S H G+KP+ C  CGK
Sbjct: 612 KQFECQYCHRCFAQVTHLDVHIRS-HLGKKPYQCEYCGK 649

>CAGL0L12562g complement(1350878..1351549) similar to sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 or tr|Q03081
           Saccharomyces cerevisiae YPL038w MET31, hypothetical
           start
          Length = 223

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 6/69 (8%)

Query: 711 ATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKF 770
           +T P  K  +EE  +      + C +C  +F+    L RH+++ H    P+ C +CGK F
Sbjct: 126 STKPKDKSKSEEDTV-----YHYCSQCSLKFNRSSDLRRHERA-HLLVLPYICTQCGKGF 179

Query: 771 KRRDHVLQH 779
            R+D + +H
Sbjct: 180 ARKDALKRH 188

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 730 KAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           K Y C    C + F+    LT H+ SVH G +   C KC K F ++ H+ +HL
Sbjct: 47  KTYFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHL 99

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 709 ERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGK 768
           ++A +  S ++  ++ +    +A+ C +C + F    HL RH  + HS  KP  C  CGK
Sbjct: 57  DKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYT-HSDTKPFQCSYCGK 115

Query: 769 KFKRRDHVLQH 779
               R  + +H
Sbjct: 116 GVTTRQQLKRH 126

>Scas_721.56
          Length = 199

 Score = 37.7 bits (86), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 726 SDKGK--AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRD 774
           SD+G    + C +C+  F     L RH+K+ H    P+ C +CGK F R+D
Sbjct: 107 SDEGSRTGFQCNKCELYFIRSSDLRRHEKT-HLSILPNICSQCGKGFARKD 156

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 8/55 (14%)

Query: 728 KGKAYVC-QECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQH 779
           K + ++C + C R  +   HL     S+H+G+KP+ CPK  C K+F  + ++L+H
Sbjct: 340 KNQCHICGRICSRPSTLQTHL-----SIHTGDKPYKCPKRNCHKRFNVKSNMLRH 389

>Kwal_27.10467
          Length = 302

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQH 779
           Y C +C + F+    L  H  + H+G+KP+ CP   C K+F  R ++ +H
Sbjct: 198 YTCTKCGKVFNRPSSLATHNNT-HTGDKPYCCPFDNCDKQFNARSNMTRH 246

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 10/58 (17%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK---------CGKKFKRRDHVLQHL 780
           ++C  C + F+  H   RH+  +H+G+K + C           CGKKF R D + +H 
Sbjct: 597 FICSICGKAFARQHDRKRHE-DLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

 Score = 37.7 bits (86), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           + C  C ++F+  ++L  H ++ H+ E+P  C  CGK F R+    +H
Sbjct: 569 FACDVCGKKFTRPYNLKSHLRT-HTNERPFICSICGKAFARQHDRKRH 615

>Scas_718.36d
          Length = 330

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 713 SPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKF 770
           SP  K+  E     +K   Y C  C + F     L  H  ++ SG +P+ CP   C K F
Sbjct: 221 SPGHKVEVETSAFDEK-LGYFCDVCGKGFRRPSSLRTHS-NIRSGNRPYKCPYSNCTKSF 278

Query: 771 KRRDHVLQH 779
             + ++L+H
Sbjct: 279 NAKSNMLRH 287

>Kwal_14.2543
          Length = 711

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFK 771
           T  T  I  + +      K Y C  C + F++   L  H ++ H+GEKP  C  CGK+F 
Sbjct: 614 TFSTQDILQQHMRTHSGEKPYKCSHCGKGFATSSSLRIHIRT-HTGEKPLECKVCGKRFN 672

Query: 772 RRDHVLQHL 780
              ++ +H+
Sbjct: 673 ESSNLSKHM 681

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 728 KGKA-YVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +GK+ YVC  + C R  +    L RH + VH+  KP  C  C K F  +D + QH+
Sbjct: 571 RGKSSYVCGWENCGRVITQRQKLLRHLR-VHTRYKPCKCVHCLKTFSTQDILQQHM 625

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 726 SDKGKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           S K     CQ  +CQ +     H+T H + VH   KP +C  C KKFKR   + +HL
Sbjct: 141 SQKNLQLNCQWGDCQTKTVKRDHITSHLR-VHVQLKPFACSTCNKKFKRPQDLKKHL 196

>Kwal_27.11824
          Length = 199

 Score = 36.6 bits (83), Expect = 0.039,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 729 GKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
            K + C +C+  F     L RH+++ H    P+ C  CGK F R+D + +H +
Sbjct: 116 AKKFPCAKCELVFRRSSDLRRHERA-HLPILPNICSLCGKGFARKDALKRHFD 167

>Kwal_47.16577
          Length = 881

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 4/50 (8%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLNKKI 784
           C + FS   HL RHK + HS EK + C  P CG++F R D   +H  + +
Sbjct: 20  CSKSFSRSDHLGRHKAN-HSSEK-YKCEWPACGREFSRLDVKKKHFGRHL 67

>Scas_718.67
          Length = 473

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 18/83 (21%)

Query: 719 SAEEIIISDKGKAYVC--------QECQRQFSSGHHLTRHKKSVHSGEKP-HSCPKC--- 766
           S + I  S   + Y C        + C  QFS  + LTRH+ ++H+ +K    C +C   
Sbjct: 366 SLKAITESSTDETYTCRIINLTTNEPCCAQFSRSYDLTRHQNTIHASKKTVFRCSECIKS 425

Query: 767 ------GKKFKRRDHVLQHLNKK 783
                  K F R D + +H+  K
Sbjct: 426 LGNEGYDKTFSRLDALTRHIKSK 448

>Scas_627.6
          Length = 1207

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 16/80 (20%)

Query: 710 RATSPTSKISAEEIIISDKGKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCP--- 764
           RA++P  K  + ++ ++++   Y+C   +C + F+   HL+RHK + H  ++   CP   
Sbjct: 25  RASAPVQK--SAKLAVTER---YICPHPDCNKSFTRQEHLSRHKLN-HWPKEIFVCPFIF 78

Query: 765 -----KCGKKFKRRDHVLQH 779
                 C K F R+D +++H
Sbjct: 79  PNTNITCNKTFVRKDLLIRH 98

>Kwal_14.2206
          Length = 254

 Score = 36.2 bits (82), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 3/48 (6%)

Query: 734 CQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           C+ C + FS    L+ H   +H+G +P++C  P CGK+F  + ++++H
Sbjct: 196 CRICGKTFSRPSGLSTHAL-IHTGHQPYACDAPNCGKRFNVKSNLMRH 242

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 36.2 bits (82), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           C  +     H+T H + VH   KP  C  CGKKFKR   + +HL
Sbjct: 95  CNTKTVKRDHITSHLR-VHVPLKPFGCSTCGKKFKRPQDLKKHL 137

>CAGL0E04312g 412563..414629 some similarities with sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 or sp|P38704
           Saccharomyces cerevisiae YHR006w SPT2, hypothetical
           start
          Length = 688

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 13/81 (16%)

Query: 712 TSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP------- 764
           TS      A+   + D  K +VC  C  +F    +LTRH K  H+ EK + CP       
Sbjct: 178 TSIKKDTKAKSETLDDDEKEFVCHYCDAKFRIRGYLTRHIKK-HAIEKAYHCPFYNGQEV 236

Query: 765 ---KC--GKKFKRRDHVLQHL 780
              +C     F RRD    H+
Sbjct: 237 PSKRCHNSGGFSRRDTYKTHM 257

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 35.8 bits (81), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
           K  VC+ C R+      L  H  + H+G++P SC  P C K F  R ++L+H
Sbjct: 202 KKNVCKVCGRECRRPSTLKTHMLT-HTGQRPFSCRHPGCSKSFNVRSNMLRH 252

>Sklu_2436.9 YDR463W, Contig c2436 18516-20069
          Length = 517

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 40/95 (42%), Gaps = 14/95 (14%)

Query: 701 VLPGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKP 760
           + P +G   +  S   K   EEI   ++   YVC  C  +F    +LTRH K  H+ EK 
Sbjct: 132 ISPSSGSESKHDSQNPK-DGEEIDDEEQRGKYVCHYCDAEFRIRGYLTRHIKK-HAVEKA 189

Query: 761 HSCP----------KCGKK--FKRRDHVLQHLNKK 783
           + CP          +C     F RRD    HL  +
Sbjct: 190 YHCPFFNSKLPPESRCHTTGGFSRRDTYKTHLKSR 224

>KLLA0D11902g 1015273..1016142 some similarities with sp|Q12041
           Saccharomyces cerevisiae YDR253c MET32 transcriptional
           regulator of sulfur amino acid metabolism, hypothetical
           start
          Length = 289

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLNKK 783
           K + C++C   F     L RH++  H    P+ C  CGK F R+D + +H + +
Sbjct: 202 KRFPCEKCHMVFRRSSDLRRHERQ-HLPILPNICTLCGKGFARKDALKRHFDTQ 254

>CAGL0K01727g complement(152569..154068) similar to sp|Q03465
           Saccharomyces cerevisiae YDL020c, start by similarity
          Length = 499

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 18/72 (25%)

Query: 730 KAYVCQ--------ECQRQFSSGHHLTRHKKSVHSGEKP-HSCPKC---------GKKFK 771
           +A+VC+         C  QFS  + LTRH+ ++H+ ++    C +C          K F 
Sbjct: 403 EAFVCELVNSVTNEVCGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQKTFS 462

Query: 772 RRDHVLQHLNKK 783
           R D + +H+  K
Sbjct: 463 RLDALTRHIKAK 474

>CAGL0L00583g 69547..70713 similar to tr|Q12132 Saccharomyces
           cerevisiae YPL230w USV1, hypothetical start
          Length = 388

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 741 FSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           F+   H  RH +  H+GEKP  C  C K F R D++ QH
Sbjct: 3   FTRAEHHARHIRK-HTGEKPFQCDICMKFFSRIDNLKQH 40

>Scas_604.4
          Length = 585

 Score = 35.0 bits (79), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 746 HLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           H+T H + VH   KP +C KC KKFKR   + +HL
Sbjct: 233 HITSHLR-VHVPLKPFACKKCTKKFKRPQDLKKHL 266

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 726 SDKGKAYVCQ--ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           S K     CQ   C  +     H+T H + VH   KP +C  C K+FKR   + +HL
Sbjct: 183 SQKNLQLKCQWDNCTSKTEKRDHMTSHLR-VHVPLKPFACSTCSKRFKRPQDLKKHL 238

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 730 KAYVCQE--CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQH 779
           + +VC+E  C + F    HL  HK S HS  KP +CP C K F     + +H
Sbjct: 36  RPFVCEEPGCGKGFLRASHLKVHKWS-HSQVKPLACPVCSKGFTTNQQLSRH 86

>Scas_660.12
          Length = 367

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%), Gaps = 13/64 (20%)

Query: 732 YVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGKK--FKRRDHVLQH 779
           YVC  CQ +F    +LTRH K  H+ EK + CP          +C     F RRD    H
Sbjct: 96  YVCHYCQAKFRIKGYLTRHIKK-HAVEKAYHCPFFSTESPPELRCHNSGGFSRRDTYKTH 154

Query: 780 LNKK 783
           L  +
Sbjct: 155 LKAR 158

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 33.9 bits (76), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 731 AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQH 779
            Y C +C+++F     L  H   +H G  P  C  P C KKF  + ++L+H
Sbjct: 215 TYCCPKCKKEFKRPSGLRTHM-VIHYGRNPFFCKWPNCSKKFNVKSNLLRH 264

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 736 ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +C  +     H+T H + VH   KP  C  C KKFKR   + +HL
Sbjct: 188 DCTTKTEKRDHITSHLR-VHVPLKPFGCSTCSKKFKRPQDLKKHL 231

>KLLA0F10109g complement(939195..941066) weakly similar to sp|Q00947
           Saccharomyces cerevisiae YDR463w STP1 pre-tRNA splicing
           protein, transcription factor, start by similarity
          Length = 623

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 36/89 (40%), Gaps = 20/89 (22%)

Query: 714 PTSKISAEEIIISDKGK-------AYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP-- 764
           P S   +E  + +DK          +VC  C  +F    +LTRH K  H+ EK + CP  
Sbjct: 217 PVSSTDSESQVPTDKSDEKKETDMKFVCHYCDAEFKMRGYLTRHIKK-HAIEKAYHCPFW 275

Query: 765 --------KCGKK--FKRRDHVLQHLNKK 783
                   +C     F RRD    HL  +
Sbjct: 276 DASLPSEKRCHSTGGFSRRDSYKTHLRSR 304

>AFR461C [3653] [Homologous to ScYDR463W (STP1) - SH]
           (1269565..1271199) [1635 bp, 544 aa]
          Length = 544

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 41/99 (41%), Gaps = 21/99 (21%)

Query: 705 AGRP----ERATSPTSKISAEEIIISD----KGKAYVCQECQRQFSSGHHLTRHKKSVHS 756
           AG P    E   SP S  SA ++   D      + +VC  C  +F    +LTRH K  H+
Sbjct: 117 AGTPTQSNEEPLSPRSSSSAAQLKDEDGDELSKERFVCHYCDAEFRIRGYLTRHIKK-HA 175

Query: 757 GEKPHSCP----------KCGKK--FKRRDHVLQHLNKK 783
            EK + CP          +C     F RRD    HL  +
Sbjct: 176 VEKAYHCPFFNSHVPPETRCHTTGGFSRRDTYKTHLRSR 214

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 36/87 (41%), Gaps = 10/87 (11%)

Query: 702 LPGAGRPERATSPTSKISAEEIIISDKGKAYVCQE--CQRQFSSGHHLTRHKKSVHSGE- 758
           LP +G         SK +   ++  D    Y C    C + FS   HL+RHK +    E 
Sbjct: 16  LPSSGGEVHVVRKRSK-TVSMVVGEDGQYRYKCPHPTCDKSFSRQEHLSRHKLNHWPKEI 74

Query: 759 ------KPHSCPKCGKKFKRRDHVLQH 779
                  P S   CGK F RRD + +H
Sbjct: 75  FKCHYVSPLSGQPCGKTFVRRDLLNRH 101

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 725 ISDKGKAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 780
           +  + K YVC  + C +++S    L +H +S H+ EKP  CP+  C K F R  H+  H+
Sbjct: 1   MEKRPKRYVCPIESCGKKYSRPCLLRQHVRS-HTNEKPFHCPEPGCDKAFLRPSHLRVHM 59

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 736 ECQRQFSSGHHLTRHKKS-------VHSGEKPHSCPKCGKKFKRRDHVLQH 779
           EC + FS   HL+RHK +       V S   P +   C K F R+D +++H
Sbjct: 37  ECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

>AFR190C [3382] [Homologous to ScYHL027W (RIM101) - SH]
           (783110..784408) [1299 bp, 432 aa]
          Length = 432

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           C  +     H+T H + VH   KP SC  C +KFKR   + +HL
Sbjct: 113 CTTKTVKRDHITSHLR-VHVPLKPFSCSTCSRKFKRPQDLKKHL 155

>Kwal_47.18337
          Length = 536

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 38/95 (40%), Gaps = 16/95 (16%)

Query: 701 VLPGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKP 760
           + P    PE   S  SK   EE       K +VC  C  +F    +LTRH K  H+ EK 
Sbjct: 129 ITPNFNSPE---SNGSKTEDEEKDAHKGQKRFVCHYCNAEFYIRGYLTRHIKK-HAVEKA 184

Query: 761 HSCP----------KCGKK--FKRRDHVLQHLNKK 783
           + CP          +C     F RRD    HL  +
Sbjct: 185 YYCPFFNADAPKDARCHTTGGFSRRDTYKTHLRSR 219

>YDL020C (RPN4) [840] chr4 complement(415110..416705) Subunit of the
           regulatory particle of the proteasome, also binds DNA to
           act as a positive regulator of expression of many
           proteasome subunit genes, functions in RNA polymerase II
           transcription elongation [1596 bp, 531 aa]
          Length = 531

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 12/91 (13%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEK-PH 761
           P    P   TS  S     EI           + C  QFS  + LTRH+ ++H+  K   
Sbjct: 418 PSTASPSAHTS--SSDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVF 475

Query: 762 SCPKC---------GKKFKRRDHVLQHLNKK 783
            C +C          K F R D + +H+  K
Sbjct: 476 RCSECIKILGSEGYQKTFSRLDALTRHIKSK 506

>YHR006W (STP2) [2292] chr8 (117808..119433) Transcription factor
           involved in regulating transcription of amino acid
           permease genes, functions redundantly with Stp1p, which
           is involved in tRNA splicing and branched-chain amino
           acid uptake [1626 bp, 541 aa]
          Length = 541

 Score = 33.5 bits (75), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 39/93 (41%), Gaps = 23/93 (24%)

Query: 713 SPTSKISAEEIIISDKGKA----------YVCQECQRQFSSGHHLTRHKKSVHSGEKPHS 762
           +P SK S +E  +SD+ +           Y+C  C  +F    +LTRH K  H+  K + 
Sbjct: 175 TPASKKSIDESPLSDEVQGIADESSETLPYICHYCDARFRIRGYLTRHIKK-HAKRKAYH 233

Query: 763 CP----------KCGKK--FKRRDHVLQHLNKK 783
           CP          +C     F RRD    HL  +
Sbjct: 234 CPFFDNSISQELRCHTSGGFSRRDTYKTHLKSR 266

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 728 KGKAY-----VCQECQRQFSSGHHLTRHKKSVHSGEKPHSCPK--CGKKFKRRDHVLQHL 780
           +G AY     VC+ C + F     L  H   VH+ +KP++C    C K+F  + ++L+H+
Sbjct: 216 RGSAYKKNGSVCEICGKDFKRPSALRTHM-VVHNNDKPYNCEHRGCQKRFNVKSNMLRHM 274

Query: 781 NK 782
            K
Sbjct: 275 RK 276

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 28/54 (51%), Gaps = 3/54 (5%)

Query: 730 KAYVCQE--CQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
           K Y C E  C ++F    HL  HK + HS  KP +C  C K+F     + +HLN
Sbjct: 40  KPYHCDEPGCGKKFIRPCHLRVHKWT-HSQIKPKACTLCQKRFVTNQQLRRHLN 92

>Scas_713.11
          Length = 465

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 10/57 (17%)

Query: 737 CQRQFSSGHHLTRHKKSVHSGEK-PHSCPKC---------GKKFKRRDHVLQHLNKK 783
           C  QFS  + L RH+ ++H+ +K    C +C          K F R D + +HL  K
Sbjct: 383 CSAQFSRSYDLVRHQNTIHAKQKIVFHCLQCIKLFGERGFSKTFSRLDALSRHLKSK 439

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 730 KAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP--KCGKKFKRRDHVLQHLNK 782
           K Y C  C+++FS   +L  HK + H   +P  C    C K F +  ++  H NK
Sbjct: 9   KPYECDICKKRFSRKGNLAAHKMT-HGKIRPFICKLDNCNKSFSQLGNMKSHQNK 62

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 16/24 (66%)

Query: 756 SGEKPHSCPKCGKKFKRRDHVLQH 779
           +GEKP+ C  C K+F R+ ++  H
Sbjct: 6   TGEKPYECDICKKRFSRKGNLAAH 29

>YDR463W (STP1) [1281] chr4 (1386804..1388363) Transcription factor
           involved in regulating transcription of amino acid
           permease genes and involved in pre-tRNA splicing of
           specific tRNA species, has three C2H2-type zinc fingers
           [1560 bp, 519 aa]
          Length = 519

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 37/93 (39%), Gaps = 23/93 (24%)

Query: 703 PGAGRPERATSPTSKISAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHS 762
           P    PE +T           ++++  + ++C  C   F    +LTRH K  H+ EK + 
Sbjct: 141 PSGSTPEHSTK----------VLNNGEEEFICHYCDATFRIRGYLTRHIKK-HAIEKAYH 189

Query: 763 CP----------KCGKK--FKRRDHVLQHLNKK 783
           CP          +C     F RRD    HL  +
Sbjct: 190 CPFFNSATPPDLRCHNSGGFSRRDTYKTHLKAR 222

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 702 LPGAGRPERATSPTSKISAEEIIISDKGKAYV---CQECQRQFSSGHHLTRHKKS-VHSG 757
           +P    P        +I+ ++ +++D  K      C  C + F+   +L+ HK + + S 
Sbjct: 291 IPNTTLPSSNNMTLQEINLKKALLADYSKTKKKRQCPICHKYFA---NLSTHKSTHLTSQ 347

Query: 758 EKPHSCPKCGKKFKRRDHVLQH 779
           ++PH C  C   F R + +++H
Sbjct: 348 DRPHKCIICQSGFARNNDLIRH 369

>Scas_641.24
          Length = 532

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 14/74 (18%)

Query: 719 SAEEIIISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGEKPHSCP----------KCGK 768
           + EE   +D G  ++C  C  +F    +LTRH K  H+ EK + CP          +C  
Sbjct: 171 TKEEDEETDDG-PFICHYCDAKFRIRGYLTRHIKK-HAVEKAYHCPFFNSDILSESRCHN 228

Query: 769 K--FKRRDHVLQHL 780
              F RRD    HL
Sbjct: 229 TGGFSRRDTYKTHL 242

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 733 VCQECQRQFSSGHHLTRHKKSVHSGEKPHSC--PKCGKKFKRRDHVLQHLN 781
            C  C R+ +    L  H   +H+GE P  C  P C K+F  R ++ +H+N
Sbjct: 259 TCLVCGRRCTRPSTLKTHML-IHTGELPFQCSWPGCSKRFNVRSNMNRHVN 308

>Kwal_27.12044
          Length = 671

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 495 SNAMAPNPVSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGNSSPRNALPPLNSA 554
           S+  +P P+   G+P+       P LN   + S+ A +L S+ +    SPR  +PP+NS 
Sbjct: 431 SSGFSPAPI---GSPLKRFKFDDPKLNQQRQNSMSA-TLDSLLSKATGSPRLTMPPMNSG 486

>Kwal_26.9300
          Length = 304

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 747 LTRHKKS-VHSGEKPHSCPKCGKKFKRRDHVLQHLNK 782
           L+ H+ S +    KPH CP CG+ F R + +L+H  +
Sbjct: 158 LSTHRSSHLQPENKPHKCPVCGRGFTRHNDLLRHRKR 194

>Kwal_55.20634
          Length = 419

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 736 ECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHL 780
           +C  +     H+T H + VH   KP +C  C K FKR   + +HL
Sbjct: 98  KCTAKTVKRDHITSHLR-VHVPLKPFACSTCTKTFKRPQDLKKHL 141

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 10/65 (15%)

Query: 725 ISDKGKA-YVCQE--CQRQFSSGHHLTRHKKSVHSGE-------KPHSCPKCGKKFKRRD 774
           +  +GK  YVC    C + F+   HL+RHK +    E        P     C + F RRD
Sbjct: 8   VQQQGKPRYVCPHPNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRD 67

Query: 775 HVLQH 779
            +++H
Sbjct: 68  LLVRH 72

>Scas_670.2
          Length = 435

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 713 SPTSKISAEEIIISDKGK--AYVCQECQRQFSSGHHLTRHKKS-VHSGEKPHSCPKCGKK 769
           +PT+     + ++S K K     C  C   ++   +LT HK + +   ++PH CP C + 
Sbjct: 231 APTNATLINDPLVSAKTKRRKKQCPICSGYYA---NLTTHKATHLVPEDRPHKCPICQRG 287

Query: 770 FKRRDHVLQH 779
           F R + +++H
Sbjct: 288 FGRNNDLIRH 297

>Kwal_33.14227
          Length = 551

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 737 CQRQFSSGHHLTRHKKSVH-SGEKPHSCPKC---------GKKFKRRDHVLQHLNKK 783
           C ++FS  + L RH+K++H S +K   C  C          K F R D + +H+  K
Sbjct: 471 CSKKFSRPYDLIRHQKTIHASKKKVFRCVFCIQQQGAEGYQKTFSRGDALSRHIKVK 527

>Scas_712.2
          Length = 327

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 730 KAYVC--QECQRQFSSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDHVLQHLN 781
           + Y+C  + C ++F    HL  HK + HS  KP  C  C K F     + +HLN
Sbjct: 41  RPYICDVEGCGKRFMRPCHLKVHKWT-HSKVKPLKCAFCEKGFITNQQLKRHLN 93

>YDR127W (ARO1) [974] chr4 (704478..709244) Arom pentafunctional
           enzyme [4767 bp, 1588 aa]
          Length = 1588

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 9/131 (6%)

Query: 503 VSGVGAPVTSVCVGPPALNNLHEESVLALSLASMANSGNSSPRNALPPLNSAVGNSRPYT 562
           V G G    S C  P  L N    S    SLA++ NS +S     L    +A    RP  
Sbjct: 479 VEGHGGSTLSACADPLYLGNAGTASRFLTSLAALVNSTSSQKYIVLT--GNARMQQRPIA 536

Query: 563 PTGDAILA--PRPSYDQN----PLSYYSTQTTKSP-MPLFKRINSPNRVTLNISRESSRS 615
           P  D++ A   +  Y  N    P+  Y+    K   + L   ++S    ++ +    +  
Sbjct: 537 PLVDSLRANGTKIEYLNNEGSLPIKVYTDSVFKGGRIELAATVSSQYVSSILMCAPYAEE 596

Query: 616 PISFGSEYGKP 626
           P++     GKP
Sbjct: 597 PVTLALVGGKP 607

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 13/73 (17%)

Query: 716 SKISAEEIIISDKGKAYVCQ--ECQRQFSSGHHLTRHK-----KSVHSGE--KPHSCPKC 766
           SK ++EE +    G  YVC   +C++ FS   HL RHK     K +   E   P     C
Sbjct: 6   SKEASEEKV----GGRYVCPHPDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVC 61

Query: 767 GKKFKRRDHVLQH 779
            + F R+D +++H
Sbjct: 62  NRTFVRKDLLVRH 74

>YPL242C (IQG1) [5208] chr16 complement(90622..95109) Protein
           involved in cytokinesis, has similarity to mammalian
           IQGAP proteins [4488 bp, 1495 aa]
          Length = 1495

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 539 SGNSSPRNALPPLNS--AVGNSRPYTPTGDAILAPRPSYDQNP-----LSYYSTQTTK 589
           S   SP N  P +++   V   R +TP   ++L P PS + +P     LSYYS   +K
Sbjct: 313 SNTPSPYNEAPKMSNLDVVVEKRKFTPIEPSLLGPTPSLEYSPIKNKSLSYYSPTISK 370

>Sklu_1991.3 YDR081C, Contig c1991 4090-6477
          Length = 795

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 33/75 (44%), Gaps = 10/75 (13%)

Query: 473 IVEPTLEDPTLKFKRKVVAQD-----TSNAMAPNPVSGVGAPVTSVCVGPPALNNLHEES 527
           I+   ++ P      KVV QD       N +  NP  G GA   SV  GP      + E 
Sbjct: 526 IISELIDRPEDFIGEKVVQQDEPAKNLPNVVTQNPAVGPGAVYHSVTEGPTG----YFED 581

Query: 528 VLALSLASMANSGNS 542
           V   SLAS AN+ NS
Sbjct: 582 VFT-SLASDANASNS 595

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 725 ISDKGKAYVCQECQRQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 779
           I+   K   C  C+  +++   LT HK +  + E +PH CP C + F R + +L+H
Sbjct: 135 INKPRKKKQCPICRNFYAN---LTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

>Scas_683.30
          Length = 478

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 4/47 (8%)

Query: 734 CQECQRQFSSGHHLTRHKKSVHSGE-KPHSCPKCGKKFKRRDHVLQH 779
           C  C   ++   +L+ HK +  + E +PH CP C + F R + +++H
Sbjct: 289 CPTCLNYYA---NLSTHKSTHLTPEDRPHKCPICERGFARNNDLIRH 332

>ADL197C [1544] [Homologous to ScYNL326C - SH] (350993..352165)
           [1173 bp, 390 aa]
          Length = 390

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%)

Query: 742 SSGHHLTRHKKSVHSGEKPHSCPKCGKKFKRRDH 775
           S+G H    K  V   ++ H C  C K + RRDH
Sbjct: 164 STGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDH 197

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 26,237,531
Number of extensions: 1144397
Number of successful extensions: 4298
Number of sequences better than 10.0: 225
Number of HSP's gapped: 4184
Number of HSP's successfully gapped: 295
Length of query: 784
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 674
Effective length of database: 12,788,129
Effective search space: 8619198946
Effective search space used: 8619198946
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)