Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR116W1167114659640.0
KLLA0C17732g119495736640.0
Kwal_56.23445132996036320.0
Scas_636.17118496235270.0
YDR097C (MSH6)124295935100.0
CAGL0G08129g1216120134140.0
Kwal_23.646610379046744e-73
KLLA0C18590g10299096639e-72
Sklu_2128.210609066631e-71
ADR168C10329506577e-71
CAGL0E00473g10259766401e-68
YCR092C (MSH3)10479686355e-68
Kwal_56.226139567866103e-65
Scas_720.10210389426044e-64
Scas_628.39597975767e-61
CAGL0I07733g9577795768e-61
YOL090W (MSH2)9648115696e-60
KLLA0F02706g9567565144e-53
AFR603C9563044512e-45
KLLA0F24156g9409313986e-39
Scas_544.28746253842e-37
KLLA0F11022g8885313522e-33
KLLA0C16423g9346183478e-33
Sklu_1903.38997323469e-33
CAGL0L13002g9492063282e-30
ABR137W9552053262e-30
YFL003C (MSH4)8787153226e-30
YHR120W (MSH1)9592193201e-29
Scas_697.279482033139e-29
Kwal_33.147389632983121e-28
CAGL0I03586g8672442888e-26
YDL154W (MSH5)9012412824e-25
Scas_707.288815342701e-23
CAGL0F02167g8951532574e-22
Scas_504.13076183780.55
YBR002C (RER2)28657703.8
YDR522C (SPS2)50267704.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR116W
         (1146 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH] complement(...  2301   0.0  
KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834 S...  1415   0.0  
Kwal_56.23445                                                        1403   0.0  
Scas_636.17                                                          1363   0.0  
YDR097C (MSH6) [947] chr4 complement(640103..643831) Component w...  1356   0.0  
CAGL0G08129g complement(770779..774429) similar to sp|Q03834 Sac...  1319   0.0  
Kwal_23.6466                                                          264   4e-73
KLLA0C18590g complement(1642291..1645380) similar to sp|P25336 S...   259   9e-72
Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement         259   1e-71
ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH] (997371..10...   257   7e-71
CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces cer...   251   1e-68
YCR092C (MSH3) [615] chr3 complement(276760..279903) Component o...   249   5e-68
Kwal_56.22613                                                         239   3e-65
Scas_720.102                                                          237   4e-64
Scas_628.3                                                            226   7e-61
CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharo...   226   8e-61
YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3...   223   6e-60
KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1...   202   4e-53
AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH] (1524851..1...   178   2e-45
KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces...   157   6e-39
Scas_544.2                                                            152   2e-37
KLLA0F11022g complement(1016214..1018880) similar to sp|P40965 S...   140   2e-33
KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175 S...   138   8e-33
Sklu_1903.3 YFL003C, Contig c1903 4902-7601                           137   9e-33
CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces...   130   2e-30
ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH] complement(6...   130   2e-30
YFL003C (MSH4) [1678] chr6 complement(134516..137152) Meiosis-sp...   128   6e-30
YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in ...   127   1e-29
Scas_697.27                                                           125   9e-29
Kwal_33.14738                                                         124   1e-28
CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces c...   115   8e-26
YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific prot...   113   4e-25
Scas_707.28                                                           108   1e-23
CAGL0F02167g complement(216080..218767) similar to sp|P40965 Sac...   103   4e-22
Scas_504.1                                                             35   0.55 
YBR002C (RER2) [195] chr2 complement(241672..242532) Cis-prenylt...    32   3.8  
YDR522C (SPS2) [1334] chr4 complement(1483783..1485291) Protein ...    32   4.0  

>AGR116W [4427] [Homologous to ScYDR097C (MSH6) - SH]
            complement(960587..964090) [3504 bp, 1167 aa]
          Length = 1167

 Score = 2301 bits (5964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1110/1146 (96%), Positives = 1110/1146 (96%)

Query: 1    MPPSTPQQSKKVMQMTPGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETSTPCKA 60
            MPPSTPQQSKKVMQMTPGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETSTPCKA
Sbjct: 1    MPPSTPQQSKKVMQMTPGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETSTPCKA 60

Query: 61   EQLQLFVEDASDEGETTFVTAHDDGAVKEEGATQVDSQGSARRRRSVSYAEESDDEDVVA 120
            EQLQLFVEDASDEGETTFVTAHDDGAVKEEGATQVDSQGSARRRRSVSYAEESDDEDVVA
Sbjct: 61   EQLQLFVEDASDEGETTFVTAHDDGAVKEEGATQVDSQGSARRRRSVSYAEESDDEDVVA 120

Query: 121  VRRKTRRMAGDDEDAEFVPERGGGDKDASMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
            VRRKTRRMAGDDEDAEFVPERGGGDKDASM                              
Sbjct: 121  VRRKTRRMAGDDEDAEFVPERGGGDKDASMLLEDDDDILELAAKPRTAQPRRPAPPPARR 180

Query: 181  XXXXXXVRDVSPGKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARF 240
                  VRDVSPGKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARF
Sbjct: 181  PPAVRPVRDVSPGKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARF 240

Query: 241  TPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPE 300
            TPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPE
Sbjct: 241  TPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPE 300

Query: 301  MSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHS 360
            MSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHS
Sbjct: 301  MSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHS 360

Query: 361  DQSTYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECT 420
            DQSTYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECT
Sbjct: 361  DQSTYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECT 420

Query: 421  QLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNG 480
            QLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNG
Sbjct: 421  QLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNG 480

Query: 481  GYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQT 540
            GYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQT
Sbjct: 481  GYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQT 540

Query: 541  SLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER 600
            SLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER
Sbjct: 541  SLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER 600

Query: 601  LDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISS 660
            LDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISS
Sbjct: 601  LDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISS 660

Query: 661  LNEYELSGSLSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKM 720
            LNEYELSGSLSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKM
Sbjct: 661  LNEYELSGSLSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKM 720

Query: 721  RALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKR 780
            RALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKR
Sbjct: 721  RALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKR 780

Query: 781  YYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLA 840
            YYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLA
Sbjct: 781  YYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLA 840

Query: 841  RTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGK 900
            RTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGK
Sbjct: 841  RTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGK 900

Query: 901  STAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIM 960
            STAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIM
Sbjct: 901  STAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIM 960

Query: 961  QGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGF 1020
            QGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGF
Sbjct: 961  QGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGF 1020

Query: 1021 FATHYGTLGQSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIP 1080
            FATHYGTLGQSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIP
Sbjct: 1021 FATHYGTLGQSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIP 1080

Query: 1081 RSVVENAERAAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGE 1140
            RSVVENAERAAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGE
Sbjct: 1081 RSVVENAERAAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGE 1140

Query: 1141 GVKYYD 1146
            GVKYYD
Sbjct: 1141 GVKYYD 1146

>KLLA0C17732g complement(1572115..1575699) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1194

 Score = 1415 bits (3664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/957 (67%), Positives = 796/957 (83%), Gaps = 6/957 (0%)

Query: 191  SPGKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQI 250
            S GKH+ F+K N ERYQWLV ERDA GR  SDP+YDPRTL+IP  AW++FTPFEKQYW+I
Sbjct: 223  SQGKHTKFNKTNGERYQWLVHERDAEGRDKSDPDYDPRTLYIPGDAWSKFTPFEKQYWEI 282

Query: 251  KSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQF 310
            KSKMWDCI+FFKKGKFFELYEKDAHL + LFDLKIAGGGRANMQLAG+PEMSFDYWASQF
Sbjct: 283  KSKMWDCILFFKKGKFFELYEKDAHLGHHLFDLKIAGGGRANMQLAGVPEMSFDYWASQF 342

Query: 311  IQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIH 370
            IQ+GYKVAKVDQKESMLAKEMREG+KGIVERELQCVL+ GTLTD +ML SD +TYC+++ 
Sbjct: 343  IQYGYKVAKVDQKESMLAKEMREGSKGIVERELQCVLTSGTLTDSEMLKSDLATYCVAVR 402

Query: 371  EAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVR 430
            E P+  Y  E   A+P    + G+ FG A IDTATG I LLEFEDD EC+QLDT+M+Q +
Sbjct: 403  EEPITYYD-EEILALP----KTGKYFGFAAIDTATGHIDLLEFEDDEECSQLDTIMSQFK 457

Query: 431  PKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWP 490
            P EV+MEK N+  +A KI+KFN+QP+ I N RTS EFYD+ +TFDE+    YF  MD WP
Sbjct: 458  PTEVIMEKSNVCSLAQKIIKFNAQPEAIINQRTSKEFYDFEKTFDELITHEYFKSMDRWP 517

Query: 491  AILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQ 550
             +LK YY+ GKKVGF AFGGLLSYLQWLKLD SL++MG VEEYNP+++QT L LDGITLQ
Sbjct: 518  TVLKSYYETGKKVGFHAFGGLLSYLQWLKLDTSLVTMGQVEEYNPVRSQTCLALDGITLQ 577

Query: 551  NLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNE 610
            NLEIFAN++DGTD+G+LFKL+NRAITPMGKR++R WVMHPLL+ E I  RLDSVD LL++
Sbjct: 578  NLEIFANTYDGTDRGSLFKLINRAITPMGKRKLRKWVMHPLLKIEDINSRLDSVDLLLSD 637

Query: 611  MPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEY-ELSGS 669
            M +RDL E+ L  LPDLER+L+RVHS +L I+ F+KV+CGFE+I+ L+  L+ + +L GS
Sbjct: 638  MNLRDLLENELLKLPDLERMLSRVHSCSLKIQYFNKVLCGFEDILALVEKLSIFADLKGS 697

Query: 670  LSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDA 729
            L  +L +IPS+L + +E+W+  +DRN+AV +G +VPN GVEP+FD S+ +++ +E++L  
Sbjct: 698  LKSYLTEIPSSLTTVLEAWSNAFDRNLAVKDGVIVPNRGVEPEFDESMDRIQGIEDQLQE 757

Query: 730  VLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKL 789
             L++YK+  K S IQ+KDSGKE+YTIE+P++  ++VP  WTQ+ ANKS KRYYS  VQ+L
Sbjct: 758  CLTQYKKLLKSSNIQFKDSGKEIYTIEVPMAATRNVPHEWTQMAANKSFKRYYSADVQRL 817

Query: 790  ARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFP 849
            AR MAEARE+HK+LE+ LK RLY+KF  +++  W PTI+AISNIDCI+SLARTSESLGFP
Sbjct: 818  ARQMAEAREMHKVLEDDLKNRLYKKFTNHYNAVWLPTIQAISNIDCIISLARTSESLGFP 877

Query: 850  ACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLT 909
            ACRP   + + P T  KLNGY+ FKELRHPC+N G + A EFIPNDV LGK   Q+ LLT
Sbjct: 878  ACRPKLVEGLHPETNEKLNGYIRFKELRHPCFNMGSSSAKEFIPNDVVLGKDAPQLGLLT 937

Query: 910  GANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVE 969
            GANAAGKST+LRMTC+AVI+AQLGCY+PCE+AE +P+DRIMTRLGA+DNIMQGKSTFFVE
Sbjct: 938  GANAAGKSTVLRMTCVAVILAQLGCYIPCEEAEFTPVDRIMTRLGASDNIMQGKSTFFVE 997

Query: 970  LSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLG 1029
            LSET+KILD+ TNR+L+V+DELGRGGSSSDGFAIAE VLHH++TH+QSLGFFATHY  LG
Sbjct: 998  LSETKKILDLVTNRSLLVVDELGRGGSSSDGFAIAEAVLHHVATHIQSLGFFATHYAALG 1057

Query: 1030 QSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAER 1089
             SFT+HP V+PL+MAILVDE S+ VTFLYKL++G+S+GSFGMHVA+MCGIPRSVV+NA  
Sbjct: 1058 SSFTNHPNVQPLKMAILVDEESRNVTFLYKLVDGKSDGSFGMHVASMCGIPRSVVDNASI 1117

Query: 1090 AAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGEGVKYYD 1146
            AAE+ EHTS+++KERK      + VPLGLQSD VRLV+GDGL  +  G+GEGV+ YD
Sbjct: 1118 AAENLEHTSKLIKERKNLHQSINPVPLGLQSDVVRLVYGDGLTNSKGGTGEGVRVYD 1174

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 1  MPPSTPQQSKKVMQM--TPGKKRLKQATLMSFFKK 33
          M   TP+  KKV  M  + GKK+ KQAT+ SFFKK
Sbjct: 1  MTVETPKSLKKVTTMPGSSGKKKYKQATISSFFKK 35

>Kwal_56.23445
          Length = 1329

 Score = 1403 bits (3632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/960 (68%), Positives = 796/960 (82%), Gaps = 8/960 (0%)

Query: 193  GKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKS 252
            GKHSNF+K NE+RYQWLV+ERDA GR   D +YDPRTL+IP  AW +FTPFEKQYW+IKS
Sbjct: 353  GKHSNFAKENEDRYQWLVNERDAQGRATDDSDYDPRTLYIPPSAWTKFTPFEKQYWEIKS 412

Query: 253  KMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQ 312
            +MWDCIVFFKKGKFFELYEKDA L N LFDLKIAGGGRANMQLAGIPEMSFDYWA QFIQ
Sbjct: 413  RMWDCIVFFKKGKFFELYEKDALLGNHLFDLKIAGGGRANMQLAGIPEMSFDYWAMQFIQ 472

Query: 313  HGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEA 372
            HGYKVAKVDQ+ESMLAKEMREGNKGIV+RELQ VL+ GTLTD  ML SD +T+CL++ E 
Sbjct: 473  HGYKVAKVDQRESMLAKEMREGNKGIVKRELQHVLTSGTLTDSGMLQSDHATFCLAVREE 532

Query: 373  PLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432
              + Y  + GE     +Q+  +++G AFIDTATG I LLEFEDD EC++LDTLM+QVRPK
Sbjct: 533  DGSYY--DAGEESNGTSQKSAKVYGVAFIDTATGEIELLEFEDDDECSKLDTLMSQVRPK 590

Query: 433  EVVMEKRNLSVIAHKIVKFNSQPDCIFNY-RTSAEFYDYARTFDEV--SNGGYFAGMDSW 489
            E++MEK NL  +AHKIVK+N+Q   IFNY +   EFYD+ RTFDE+  S+  YF+GMD W
Sbjct: 591  EIIMEKGNLCNLAHKIVKYNAQSQAIFNYLKPQEEFYDFNRTFDELTSSDAKYFSGMDQW 650

Query: 490  PAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITL 549
            P IL +YY++G+KVGFSAFGGLL YL+WLKLD++++SMG ++EYNP+++QTSLVLDG+TL
Sbjct: 651  PEILTKYYEKGRKVGFSAFGGLLYYLKWLKLDEAMISMGNIKEYNPVRSQTSLVLDGVTL 710

Query: 550  QNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLN 609
            QNLEIF NS+D TDKGTLFKLVNRAITPMGKR ++ WV+ PLL+K+ IE+RLDSVD LL 
Sbjct: 711  QNLEIFGNSYDNTDKGTLFKLVNRAITPMGKRMLKKWVIQPLLQKKDIEQRLDSVDLLLT 770

Query: 610  EMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSGS 669
            +  +R+  E + +GLPDLER LAR+HSGNL IKDF++VI GFE I++L+  L +Y+L+GS
Sbjct: 771  DCDLRETLEETFSGLPDLERFLARIHSGNLKIKDFNRVIEGFEAILQLLEKLQKYQLTGS 830

Query: 670  LSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDA 729
            L  FL  +P  L   V+SW+  +DR  AV+EG +VP  GVEP+FD SL  ++ L++EL+ 
Sbjct: 831  LKYFLEQVPQKLAECVKSWSGAFDRKKAVNEGVIVPEPGVEPEFDQSLQGIKELKDELEE 890

Query: 730  VLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKL 789
             LS YK+ FKCS IQYKDSGKE+YTIE+P+S  + +PS+W Q+GANKS KRYYSP+V KL
Sbjct: 891  YLSSYKKRFKCSSIQYKDSGKEIYTIEVPMSATRQIPSDWIQMGANKSNKRYYSPEVAKL 950

Query: 790  ARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFP 849
            ARSMAE +E+HKILEEGLK RLY KFD ++   W PT+ AIS IDCILSLARTSESLGFP
Sbjct: 951  ARSMAEGKEMHKILEEGLKSRLYNKFDTHYKDVWMPTLTAISQIDCILSLARTSESLGFP 1010

Query: 850  ACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLT 909
             CRP F D++DP TGHKLNG+++F+ELRHPC+N G   + +FIPND+ LG  + QI LLT
Sbjct: 1011 CCRPKFVDDVDPVTGHKLNGFINFQELRHPCFNLGTTTSRDFIPNDISLGGDSHQIGLLT 1070

Query: 910  GANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVE 969
            GANAAGKST+LRMTCIAVIMAQ+GCY+P E A LSP+DRIMTRLGANDNIMQGKSTFFVE
Sbjct: 1071 GANAAGKSTVLRMTCIAVIMAQIGCYIPAESATLSPIDRIMTRLGANDNIMQGKSTFFVE 1130

Query: 970  LSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLG 1029
            LSET+KILD ATNR+L+VLDELGRGGSSSDGFAIAEGVLHH++TH+QSLGFFATHYG LG
Sbjct: 1131 LSETKKILDTATNRSLLVLDELGRGGSSSDGFAIAEGVLHHVATHIQSLGFFATHYGGLG 1190

Query: 1030 QSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAER 1089
              F HHP V+PL+M ILVDE S+++TFLYKL++GQSEGSFGMHVA+MCGI + +V NA++
Sbjct: 1191 LGFKHHPKVQPLKMNILVDEESREITFLYKLVKGQSEGSFGMHVASMCGIGKEIVNNAQQ 1250

Query: 1090 AAESFEHTSRILKERK---RYINDEHVVPLGLQSDFVRLVFGDGLKKTALGSGEGVKYYD 1146
            AAE+ EHTS ++KER+   + +++E ++PLGLQSD VRL  GDGL    LG GEGV +YD
Sbjct: 1251 AAENREHTSLLIKERQAADKGVSEEKMIPLGLQSDLVRLRHGDGLSTQKLGCGEGVSFYD 1310

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 4/77 (5%)

Query: 68  EDASDEGETTFVTAHDDGAVKEEGATQVDSQGSARR--RRSVSYAEESDDED--VVAVRR 123
           +DAS+  + T V   + G  KE       SQ S  R  +R++SYAE SDD+D  V++V +
Sbjct: 192 KDASELSDGTTVHGKEPGKQKEISENDASSQISDGRLPKRNISYAELSDDDDEEVLSVGK 251

Query: 124 KTRRMAGDDEDAEFVPE 140
           K RR    D++ E+VPE
Sbjct: 252 KKRRQLPSDDEEEYVPE 268

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 57/132 (43%), Gaps = 10/132 (7%)

Query: 1   MPPSTPQQ-SKKVMQMTP---GKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETST 56
           + PSTP+  SK+    +P   GKK  KQA+++SFF K     S     +  R   VE   
Sbjct: 58  VAPSTPKHNSKRRFAGSPQSSGKKNFKQASVLSFFSKHKASASTPLKEKNSRSLFVENED 117

Query: 57  PCKAEQLQLFVEDASDEGETTFVTAHDDGAVKEEGATQVDSQGSARRRRSV------SYA 110
             + E   +   D + +  T  VT     +   E     +SQ ++   +SV      +  
Sbjct: 118 NTENESGFVTAMDETMDTSTAPVTGSATASDDLEKTKTPNSQSASNNAKSVLAGLDNAEN 177

Query: 111 EESDDEDVVAVR 122
           +E D  DV+A R
Sbjct: 178 DEGDSADVIAQR 189

>Scas_636.17
          Length = 1184

 Score = 1363 bits (3527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/962 (66%), Positives = 793/962 (82%), Gaps = 10/962 (1%)

Query: 194  KHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKSK 253
            K   F+K NEERY WLV+E+DA GR P+DPEYDPRTLHIP+ AW +FT FEKQYW+IKSK
Sbjct: 206  KAQKFNKQNEERYHWLVNEKDAQGRAPTDPEYDPRTLHIPSSAWGKFTAFEKQYWEIKSK 265

Query: 254  MWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQH 313
            MWDC+VFFKKGKF+ELYEKDA LAN LFD K+AGGGRANMQLAG+PEMSF+YWASQFIQ+
Sbjct: 266  MWDCVVFFKKGKFYELYEKDAFLANSLFDWKLAGGGRANMQLAGVPEMSFEYWASQFIQY 325

Query: 314  GYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEAP 373
            GYKVAKVDQKESMLAKEMREG+KGIV+REL+CVL+ GTLTD  MLHSD +T+CL++ E P
Sbjct: 326  GYKVAKVDQKESMLAKEMREGSKGIVKRELECVLTSGTLTDGDMLHSDLATFCLAVREEP 385

Query: 374  LALYAMERG----EAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQV 429
               Y  E+     ++  P +  + +LFG AFIDT+TG + LLEFEDDSECT+LDT+M+QV
Sbjct: 386  RDFYIDEQTTFTTDSTGPSSIGK-KLFGIAFIDTSTGELQLLEFEDDSECTKLDTIMSQV 444

Query: 430  RPKEVVMEKRNLSVIAHKIVKFNSQPDCIFN-YRTSAEFYDYARTFDEVSNGGYFAGMDS 488
            +PKE++MEK NLS +A+KIVKFN+ P+ IFN  +   EFY++ +T+DE+  G YF     
Sbjct: 445  KPKEIIMEKNNLSSLANKIVKFNAAPNAIFNNIKPDQEFYNFEKTYDELITGNYFEDESK 504

Query: 489  WPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGIT 548
            WP  LK YY +GKK+GFS FGGLL YL+WLKLD++L+S+G ++EYNP+++Q SL+LDG+T
Sbjct: 505  WPETLKNYYKEGKKIGFSTFGGLLYYLKWLKLDQNLISLGNIKEYNPIESQNSLILDGVT 564

Query: 549  LQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLL 608
            LQNLEIF+NSFDGTDKGTLFKL NRAITPMGKR M+ W+MHPLL K+ IE+RLDS++ L+
Sbjct: 565  LQNLEIFSNSFDGTDKGTLFKLFNRAITPMGKRMMKKWLMHPLLHKKDIEKRLDSIETLM 624

Query: 609  NEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSG 668
            N + +RD  ES+ T LPD+ER+LAR+HSG L +KDFD+VI  FE+IV L +S+ +++L G
Sbjct: 625  NNVELRDTIESTFTKLPDVERMLARIHSGTLKVKDFDRVIQAFEDIVTLQNSIKDFDLKG 684

Query: 669  SLSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELD 728
            +LS +   IP +L  DVE+WT  +DR  AV E  ++P+ G+EP+FD SL  ++ LE++L 
Sbjct: 685  ALSVYFSQIPKSLIDDVENWTNAFDRIKAVEENIIIPHRGIEPEFDKSLDDIQELEDQLQ 744

Query: 729  AVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQK 788
              L+ YK+ FK S IQYKDSGKE+YTIE+P+SI K +PS+WTQ+ ANKSTKRYYS +V+ 
Sbjct: 745  DQLNLYKKRFKNSNIQYKDSGKEIYTIEVPVSITKQIPSDWTQMAANKSTKRYYSEEVRV 804

Query: 789  LARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGF 848
            LARSMAEARELHK LE  LK RL +KFD +++TTW PT+  ISNIDC+L+L RTSESLG+
Sbjct: 805  LARSMAEARELHKALENELKIRLCKKFDAHYNTTWMPTVHVISNIDCLLALTRTSESLGY 864

Query: 849  PACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALL 908
            PACRP  +DE++  TG KLNGYL F  LRHPC+N G +   +FIPNDV LGK + Q+ LL
Sbjct: 865  PACRPVLRDEVNLETGTKLNGYLKFTSLRHPCFNLGSSSTKDFIPNDVELGKDSPQLGLL 924

Query: 909  TGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFV 968
            TGANAAGKST+LRMTCIAVIMAQ+GCYVPCE AEL+  DRIMTRLGANDNIMQGKSTFFV
Sbjct: 925  TGANAAGKSTVLRMTCIAVIMAQMGCYVPCESAELTSFDRIMTRLGANDNIMQGKSTFFV 984

Query: 969  ELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTL 1028
            ELSET+KILD+ATNR+L+VLDELGRGGSS+DGFAIAE VLHH++TH+QSLGFFATHY +L
Sbjct: 985  ELSETKKILDLATNRSLLVLDELGRGGSSNDGFAIAESVLHHVATHIQSLGFFATHYASL 1044

Query: 1029 GQSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAE 1088
            G SF  HP VKP++M+ILVD+ ++ VTFLYKL+ GQSEGSFGMHVA+MCGIP  +V+NA+
Sbjct: 1045 GLSFKGHPQVKPMKMSILVDDETRNVTFLYKLVPGQSEGSFGMHVASMCGIPSEIVDNAQ 1104

Query: 1089 RAAESFEHTSRILKERKRY---INDEHV-VPLGLQSDFVRLVFGDGLKKTALGSGEGVKY 1144
             AA++ EHTSR++KERK     +N++ + VP+GLQSDFVRLV+GDGL+ T+ G+GEGV  
Sbjct: 1105 VAADTLEHTSRLMKERKMLNGGLNEDIITVPMGLQSDFVRLVYGDGLRNTSKGAGEGVLN 1164

Query: 1145 YD 1146
            YD
Sbjct: 1165 YD 1166

>YDR097C (MSH6) [947] chr4 complement(640103..643831) Component with
            Msh2p of DNA mismatch binding factor, involved in repair
            of single base mismatches [3729 bp, 1242 aa]
          Length = 1242

 Score = 1356 bits (3510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/959 (66%), Positives = 776/959 (80%), Gaps = 5/959 (0%)

Query: 193  GKHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKS 252
             K S F+K NEERYQWLVDERDA  RP SDPEYDPRTL+IP+ AW +FTPFEKQYW+IKS
Sbjct: 264  SKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS 323

Query: 253  KMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQ 312
            KMWDCIVFFKKGKFFELYEKDA LAN LFDLKIAGGGRANMQLAGIPEMSF+YWA+QFIQ
Sbjct: 324  KMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGGRANMQLAGIPEMSFEYWAAQFIQ 383

Query: 313  HGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEA 372
             GYKVAKVDQ+ESMLAKEMREG+KGIV+RELQC+L+ GTLTD  MLHSD +T+CL+I E 
Sbjct: 384  MGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTSGTLTDGDMLHSDLATFCLAIREE 443

Query: 373  PLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432
            P   Y   + ++     +   ++FG AFIDTATG + +LEFEDDSECT+LDTLM+QVRP 
Sbjct: 444  PGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQMLEFEDDSECTKLDTLMSQVRPM 503

Query: 433  EVVMEKRNLSVIAHKIVKFNSQPDCIFN-YRTSAEFYDYARTFDEVSNGGYFAGMDSWPA 491
            EVVME+ NLS +A+KIVKFNS P+ IFN  +   EFYD  +T+ E+ +  YF+  + WP 
Sbjct: 504  EVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFYDCDKTYAEIISSEYFSTEEDWPE 563

Query: 492  ILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQN 551
            +LK YYD GKKVGFSAFGGLL YL+WLKLDK+L+SM  ++EY+ +K+Q S+VLDGITLQN
Sbjct: 564  VLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMKNIKEYDFVKSQHSMVLDGITLQN 623

Query: 552  LEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEM 611
            LEIF+NSFDG+DKGTLFKL NRAITPMGKR M+ W+MHPLLRK  IE RLDSVD LL ++
Sbjct: 624  LEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLMHPLLRKNDIESRLDSVDSLLQDI 683

Query: 612  PIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSGSLS 671
             +R+  E + + LPDLER+LAR+HS  + +KDF+KVI  FE I+ L  SL   +L G +S
Sbjct: 684  TLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVITAFETIIELQDSLKNNDLKGDVS 743

Query: 672  RFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVL 731
            +++   P  L   V+SWT  ++R  A++E  +VP  G + +FD S+ +++ LE+EL  +L
Sbjct: 744  KYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRGFDIEFDKSMDRIQELEDELMEIL 803

Query: 732  SEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLAR 791
              Y++ FKCS IQYKDSGKE+YTIE+PIS  K+VPSNW Q+ ANK+ KRYYS +V+ LAR
Sbjct: 804  MTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSNWVQMAANKTYKRYYSDEVRALAR 863

Query: 792  SMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFPAC 851
            SMAEA+E+HK LEE LK RL QKFD +++T W PTI+AISNIDC+L++ RTSE LG P+C
Sbjct: 864  SMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQAISNIDCLLAITRTSEYLGAPSC 923

Query: 852  RPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGA 911
            RP   DE+D  T  +LNG+L FK LRHPC+N G   A +FIPND+ LGK   ++ LLTGA
Sbjct: 924  RPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGA 983

Query: 912  NAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELS 971
            NAAGKSTILRM CIAVIMAQ+GCYVPCE A L+P+DRIMTRLGANDNIMQGKSTFFVEL+
Sbjct: 984  NAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELA 1043

Query: 972  ETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQS 1031
            ET+KILDMATNR+L+V+DELGRGGSSSDGFAIAE VLHH++TH+QSLGFFATHYGTL  S
Sbjct: 1044 ETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVATHIQSLGFFATHYGTLASS 1103

Query: 1032 FTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA 1091
            F HHP V+PL+M+ILVDE ++ VTFLYK++EGQSEGSFGMHVA+MCGI + +++NA+ AA
Sbjct: 1104 FKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNAQIAA 1163

Query: 1092 ESFEHTSRILKERK---RYINDEHV-VPLGLQSDFVRLVFGDGLKKTALGSGEGVKYYD 1146
            ++ EHTSR++KER      +N E V VP GLQSDFVR+ +GDGLK T LGSGEGV  YD
Sbjct: 1164 DNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVRIAYGDGLKNTKLGSGEGVLNYD 1222

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 72/175 (41%), Gaps = 36/175 (20%)

Query: 1   MPPSTPQQSKKVM---QMTPGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVE---- 53
           M P+TP+ SK        T  +K++KQ++L+SFF K +   +P+   +    A +E    
Sbjct: 1   MAPATPKTSKTAHFENGSTSSQKKMKQSSLLSFFSKQVPSGTPSKKVQKPTPATLENTAT 60

Query: 54  ---TSTPCKAEQLQLFVEDASDE----GETTFVTAHDD--------------GAVKEEGA 92
              T  P   +  +LFV+   D      E T  T   D                  E  +
Sbjct: 61  DKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKS 120

Query: 93  TQVD-----SQGSARRRRSVSYAE---ESDDEDVVAVRRKTRRMAGDDEDAEFVP 139
           T  D     SQ     +R V+YAE   +  D    A R+K + +  + ++ E++P
Sbjct: 121 TTTDEDLSSSQSRRNHKRRVNYAESDDDDSDTTFTAKRKKGKVVDSESDEDEYLP 175

>CAGL0G08129g complement(770779..774429) similar to sp|Q03834
            Saccharomyces cerevisiae YDR097c MSH6 DNA mismatch repair
            protein, start by similarity
          Length = 1216

 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 678/1201 (56%), Positives = 846/1201 (70%), Gaps = 65/1201 (5%)

Query: 3    PSTPQQSKKVMQMT-PGKKRLKQATLMSFFKKGMGGTSPAAGAEPQRGAAVETSTPC-KA 60
            P+TP+ +KK +  T   +K+LKQ+TL+SFF K    TSP+      +      S    K 
Sbjct: 4    PTTPKANKKKVGNTGSSQKKLKQSTLLSFFSKQ---TSPSVSKSKTKVFPSPKSRESEKE 60

Query: 61   EQLQLFVED----------ASDEGETTFVTAH--------------DDGAVKEEGATQ-- 94
            +Q  LFV D          A  E  T    A               D+  VKEE   Q  
Sbjct: 61   DQKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKTPIKDDNIKVKEESTEQND 120

Query: 95   ---VDSQGSAR-RRRSVSYAEESDDEDVVAV--RRKTRRMAGDDED--AEFVPERGGGDK 146
                D+Q   R R+R VSYAEESD ED + V  R++T     +D D  A+ V +    D 
Sbjct: 121  DDTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVSDDEDSDFKADAVSDADNDDD 180

Query: 147  -DASMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRDVSPG------------ 193
              +                                      V+ ++P             
Sbjct: 181  YKSDKSAVSSIGGFDDSDDDDILALTTNKYKKPKAAAPKKVVQRITPPAAKPKFTMATTG 240

Query: 194  -KHSNFSKNNEERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKS 252
             K++ F+K NEERYQWLVDERDA  RP  DPEYDPRTL+IP+ AW +FTPFEKQYW+IKS
Sbjct: 241  PKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPRTLYIPSSAWNKFTPFEKQYWEIKS 300

Query: 253  KMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWASQFIQ 312
            KMWDCIVFFKKGKFFELYEKDA LAN LFD K+AGGGRANMQLAGIPEMSF++WASQFIQ
Sbjct: 301  KMWDCIVFFKKGKFFELYEKDAFLANALFDWKLAGGGRANMQLAGIPEMSFEHWASQFIQ 360

Query: 313  HGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEA 372
             GYKVAKVDQ+ESMLAKEMREG+KGIV+RELQCVL+ GTL D  M+HSD +TYCL++ E 
Sbjct: 361  LGYKVAKVDQRESMLAKEMREGSKGIVKRELQCVLTSGTLVDGDMIHSDLATYCLAVREE 420

Query: 373  PLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432
            P   Y + +     P +    ++FG AFIDT+TG + + EF DD EC++LDTLM+QVRPK
Sbjct: 421  PSNFYDITQ-----PSSATYTKIFGVAFIDTSTGEVQMTEFLDDEECSRLDTLMSQVRPK 475

Query: 433  EVVMEKRNLSVIAHKIVKFNSQPDCIFNY-RTSAEFYDYARTFDEV--SNGGYFAGMDSW 489
            EV++EK NL  +A+KIVKF + P+ +FNY +   EFYD+ +T +E+  +   YF   D W
Sbjct: 476  EVIIEKHNLCNLANKIVKFCAAPNALFNYIKPVEEFYDFEKTHNELLANEEAYFGTADGW 535

Query: 490  PAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITL 549
            P++LK YYD  KKVGFSAFGGLL YL+WLKLD+SL+SM    EYN +K+Q ++VLDGI+L
Sbjct: 536  PSVLKNYYDSNKKVGFSAFGGLLYYLKWLKLDESLISMKNFTEYNFVKSQNTMVLDGISL 595

Query: 550  QNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLN 609
            QNLEIF+NSFDG+DKGTLFKL N +ITPMGKR MR W+M+PLL KE IE+R DSV+ L+N
Sbjct: 596  QNLEIFSNSFDGSDKGTLFKLFNNSITPMGKRMMRKWLMNPLLLKEDIEKRQDSVELLMN 655

Query: 610  EMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEYELSGS 669
               +R   ES  TGLPDLERLL+R+H+G+L +KDFDKVI  FENI+++   +   EL G+
Sbjct: 656  NHELRTKIESVFTGLPDLERLLSRIHAGSLKVKDFDKVITAFENILQMTKEIESNELHGA 715

Query: 670  LSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDA 729
            L  +   IP  L+++V+ W + +DR  AV EG ++P  GVEPDFD SL K+  LE EL+ 
Sbjct: 716  LKSYFIQIPKQLENEVQHWESAFDRRKAVEEGVIIPEVGVEPDFDKSLEKLEGLENELNL 775

Query: 730  VLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKL 789
            +L  Y +  K S +QYKDSGKE+YTIE+P+S  K VP+NW Q+GANK+TKRYYS +V+ L
Sbjct: 776  LLKSYMKLLKTSNLQYKDSGKEIYTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVL 835

Query: 790  ARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFP 849
            ARS+AEARELHK LE  L  RL +KFD  +ST W PT+  ++NIDC+L L RTSESLG P
Sbjct: 836  ARSVAEARELHKTLENDLNFRLCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTP 895

Query: 850  ACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLT 909
            +CRP   DE+DP+T  K  G++ FK LRHPC+N       +FIPNDV LG  +  I LLT
Sbjct: 896  SCRPVICDEVDPSTKCKKQGFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLT 955

Query: 910  GANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVE 969
            GANAAGKST+LRMTCIAVIMAQLGCYVP E A L+P+DRIMTRLGANDNIMQGKSTFFVE
Sbjct: 956  GANAAGKSTVLRMTCIAVIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVE 1015

Query: 970  LSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLG 1029
            LSET++ILD+ATNR+L+VLDELGRGGSS+DGF+IAE VLHH++TH+QSLGFFATHYG+LG
Sbjct: 1016 LSETKRILDLATNRSLLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLG 1075

Query: 1030 QSFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAER 1089
             SF  HP +KP++M+ILVDE ++ VTFLYKL++GQSEGSFGMHVA+MCGI +S+V+NA+ 
Sbjct: 1076 LSFRSHPQIKPMKMSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQS 1135

Query: 1090 AAESFEHTSRILKERKRYINDE----HVVPLGLQSDFVRLVFGDGLKKTALGSGEGVKYY 1145
            AA++ EHTSR++KERK  +        +VPLGLQSDF RL FGDGL   ++G+GEGV  Y
Sbjct: 1136 AADNLEHTSRLIKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVY 1195

Query: 1146 D 1146
            D
Sbjct: 1196 D 1196

>Kwal_23.6466
          Length = 1037

 Score =  264 bits (674), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 229/904 (25%), Positives = 415/904 (45%), Gaps = 110/904 (12%)

Query: 239  RFTPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGG---------- 288
            + TP ++Q   +K +  D ++  + G  ++ +  DA + +++  + + GG          
Sbjct: 151  KLTPLDQQVKDLKLQHMDKVLAVRVGYKYKFFAMDAVIVSKILQIMLIGGKLTLDNSHPG 210

Query: 289  GRANMQLA--GIPEMSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCV 346
             RA  QLA   IP+        + + H  KV  V+Q E+   K+    + G+  R++  V
Sbjct: 211  DRAYKQLAYCSIPDNRLQVHIQRLLHHNLKVGVVEQTETQAIKKANGSSSGVFRRQVDKV 270

Query: 347  LSGGTLTDLKMLHSDQSTYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATG 406
             +  T +    ++ + S   ++  E    ++A+   E        Q   F    +  ++G
Sbjct: 271  FTKATFS----INENFSRTQINPSEEINTIWALRVDE------DDQFYHFWLFSVQLSSG 320

Query: 407  RICLLEFEDDSECT--QLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTS 464
             +   +F D+ +    +L+  ++ ++P E+V  K  LS +    ++   QPD        
Sbjct: 321  EVIYDQFSDNKKLVKLELEKRISYLQPIEIV-SKGTLSPLISTFIR-KRQPD-------- 370

Query: 465  AEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSL 524
             +F+DY     +V       G+              +K        L  YL+    +K  
Sbjct: 371  VQFHDYDSLLPDVCEDDQVGGL------------NLEKELLELRNTLRRYLENYNTEKV- 417

Query: 525  LSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMR 584
              M +   Y P  ++T+++L   TL++LEIF N  DG  +G+L  L++   T  G R +R
Sbjct: 418  --MDIPHNYKPFHSKTNMILSSNTLESLEIFENQTDGNSRGSLMWLLDHTRTSFGYRLLR 475

Query: 585  TWVMHPLLRKEHIEERLDSVDQLLNEMP--IRDLWESSLTGLPDLERLLARVHSGNLPIK 642
             W+  PL  K+ I ERLD+V+    E+     +   + L   PD  R L R++ G     
Sbjct: 476  EWISRPLTDKDSINERLDAVECTKQEVTNIFMEALGNVLKDTPDFLRNLNRIYYGQTSRS 535

Query: 643  DFDKVICGFENIVRLISSLNEY----------------ELSGSLSRFLHDIPSTLKSDVE 686
            +    +   + + +  +S + Y                +L  SL + LHD     K +  
Sbjct: 536  EVYNFLKHLDKVAKHFTSHHYYLQEQVFSSSGRVHQKSKLMTSLLQRLHD--GLKKVNTT 593

Query: 687  SWTTLYDRNMAVSEGKVVP-----NAGVEPDFDVSLSKMRALE---EELDAVLSEYKRSF 738
            +   + + + A+ + K        N     + DV LSK++ +E   EEL   L   +R  
Sbjct: 594  NLLNMINVSGALEKDKEKSCVEFFNLNNYDNADVILSKLKDIESVKEELQIELGNIRRLL 653

Query: 739  KCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLARSMAEARE 798
            K  +  YKD  +  + IE+  +    +P++W ++G+ K   R+ +PK  KL   +    +
Sbjct: 654  KRPRFCYKDEIE--FLIEVRNTQLTGLPTDWIKVGSTKMVSRFKTPKTTKLIDQL----D 707

Query: 799  LHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNI---DCILSLARTSESLGFPACRPNF 855
             HK L   +    +++F  N S+ +    + I N+   DC+LSLA TS +  +   RP F
Sbjct: 708  YHKNLLVIICDEQFKRFLANISSQYLLLKEVIENLATFDCMLSLAATSFNRQY--VRPQF 765

Query: 856  KDEIDPTTGHKLNGYLSFKELRHPCYNA-GVNGATEFIPNDVHLGKSTAQIALLTGANAA 914
                    G +    +  +  R+P   +  VN    ++ NDV++ +  +++ ++TG N  
Sbjct: 766  ------CEGRR---EMKIRNGRNPIIESLDVN----YVANDVYMKEDQSKLLIITGPNMG 812

Query: 915  GKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETR 974
            GKS+ +R   +  I+AQ+G +VP E A L     I TR+GA+DN+++G STF VE+ E  
Sbjct: 813  GKSSFIRQVALISILAQVGSFVPAESANLPIFSNIFTRIGAHDNLIKGDSTFKVEMLEML 872

Query: 975  KILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGF--FATHYGTLGQSF 1032
             IL  +   +L++LDE+GRG  ++DG +I++  +++     +   F  F THY  LG   
Sbjct: 873  DILKNSDENSLLLLDEVGRGTGTTDGISISDATINYFIDMDKKCPFILFITHYPILGS-- 930

Query: 1033 THHPMVKPLQMAILVDE--GSK--KVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAE 1088
               P+++   M  + +   G K     FLYKL +G +  S+G++VA +  +P S++ NA 
Sbjct: 931  IKSPLIENYHMGFMEERRAGEKWPTAVFLYKLTQGIATDSYGLNVARLANLPMSIINNAY 990

Query: 1089 RAAE 1092
              +E
Sbjct: 991  VVSE 994

>KLLA0C18590g complement(1642291..1645380) similar to sp|P25336
            Saccharomyces cerevisiae YCR092c MSH3 DNA mismatch repair
            protein, hypothetical start
          Length = 1029

 Score =  259 bits (663), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 239/909 (26%), Positives = 413/909 (45%), Gaps = 123/909 (13%)

Query: 239  RFTPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRA------- 291
            + T  ++Q+ ++K K  D I+  + G  ++ + KDA + + +  +K+  G +        
Sbjct: 148  KLTELDQQFKELKLKHMDTILCVRVGYKYKFFAKDAEIVSNILQIKLVPGKKTLDESDPN 207

Query: 292  -----NMQLAGIPEMSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKG-IVERELQC 345
                   Q   IP+        + +   YKVA V+Q E+   K  +  N G +  RE++ 
Sbjct: 208  DRNYRKFQYCSIPDTRLHVHLQRLVFFNYKVAVVEQTETSALK--KNNNSGSLFTREIKN 265

Query: 346  VLSGGTL--------TDLKMLHSDQSTYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFG 397
            + +  +         ++ ++L    S + +SI+E                    + R   
Sbjct: 266  IFTKVSYGINETFDKSEDRILGDLTSVWAISINETS------------------KMRKVN 307

Query: 398  TAFIDTATGRICLLEFEDDSEC-TQLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPD 456
               +   +G I   +F DD      L+  +  + P E++ E+     I     K N   D
Sbjct: 308  LISVQLNSGEIVHDQFSDDILLNVNLEARIRYLNPTEIITEEELPPSIRTIFTKLNQ--D 365

Query: 457  CIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQ 516
              F Y++  E       FD +       G+D          ++ K++       L SYL 
Sbjct: 366  IQF-YQSHKE--ACPNLFDALQ------GLD--------LNNELKRL----LSVLHSYLS 404

Query: 517  WLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAIT 576
              +  K L        Y+   A+  +VL   T+++LEIF NS      G+L  +++   T
Sbjct: 405  TFENTKVLY---FASNYSSFTAKNFMVLPRNTIESLEIFENSTTNKTNGSLLWVMDHTRT 461

Query: 577  PMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRDLWESSLTGL----PDLERLLA 632
              G R +R W+  PL+  + I +R D++  ++ E  +  ++  S   L     DLER L 
Sbjct: 462  QFGYRLLRKWISKPLIDLKSILDRQDAITCIMKE--VHSIFFESFNELLRKSIDLERALN 519

Query: 633  RVHSGNLPIKD---FDKVICGFENIVRLISSLNEYELSG------SLSRFLHDIPSTLK- 682
            R+  G+   K+   F K I  F ++ +   +    +L          S  L +I   L  
Sbjct: 520  RIAYGSTSRKEVYFFLKQIATFASLFKSHHTFIHDQLHKENSALRKTSCLLFNILQNLDA 579

Query: 683  ----SDVESWTTLYDRNMAV---SEGKVVPNAGVEP-DF-DVSLSKMRALEE---ELDAV 730
                +D+  +  + + + A+   S   V+    +   DF +  L K R +EE   ELD  
Sbjct: 580  FFSATDLPLFLQMINVDAALDKDSHKNVIEFFNLNKYDFPEGLLHKYRDIEEVKTELDDE 639

Query: 731  LSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLA 790
            L   KR  K   + YKD+    Y IE+  + AK+VPSNW ++ + K+  R+ +PK ++L 
Sbjct: 640  LQNIKRVLKRPTLSYKDTKD--YLIEVRNTQAKTVPSNWVKVNSTKAVSRFRTPKTEELV 697

Query: 791  RSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFPA 850
              +    +L  +L E    R  Q+    ++      I  ++  DCILSLA TS ++ +  
Sbjct: 698  GKLLYHNDLLNLLAEDEFKRFLQRIVDRYAEIK-TCINNLATYDCILSLAATSSNVNY-- 754

Query: 851  CRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNA-GVNGATEFIPNDVHLGKSTAQIALLT 909
             +P   +         L+  +  K  R+P   +  VN    ++PNDV +  ++ +I ++T
Sbjct: 755  VKPKLTE---------LHQKVKVKNGRNPIIESLDVN----YVPNDVLMSSNSGKINIIT 801

Query: 910  GANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVE 969
            G N  GKS+ +R   + VIM Q+GCY+P + AE+S  DRI TR+G++D+++  KSTF VE
Sbjct: 802  GPNMGGKSSYIRQVALLVIMTQIGCYIPADSAEMSICDRIFTRIGSHDDLLNAKSTFQVE 861

Query: 970  LSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQS--LGFFATHYGT 1027
            +SE   IL+ +T R+L++LDE+GRG  + DG +I+  +L++      +  L  F THY  
Sbjct: 862  MSEVLHILNSSTPRSLLLLDEVGRGTGTHDGLSISFAILNYFVYLADNCPLVLFITHYSA 921

Query: 1028 LGQSFTHHPMVKPLQMAILVD----EGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSV 1083
            L Q      ++    M+ +      E    V FLYKL+ GQ+  S+G +VA +  IP  +
Sbjct: 922  LCQ--IDSKLIANYHMSYIEKHQPGEKWTNVIFLYKLVLGQAHNSYGFNVAKLSNIPTEI 979

Query: 1084 VENAERAAE 1092
            +  A   +E
Sbjct: 980  INRAFEVSE 988

>Sklu_2128.2 YCR092C, Contig c2128 573-3755 reverse complement
          Length = 1060

 Score =  259 bits (663), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 239/906 (26%), Positives = 408/906 (45%), Gaps = 127/906 (14%)

Query: 240  FTPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQ-LFDLKIAGG---------G 289
             TP ++QY  +K K  D I+  + G  ++ + +DA +  Q L ++ I G           
Sbjct: 180  LTPLDQQYKDLKLKNMDKILAVRVGYKYKFFAQDAVIVTQILHNMLIPGKLTIDDSDPQD 239

Query: 290  RANMQLA--GIPEMSFDYWASQFIQHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVL 347
            +   Q A   IP+   +    + I +  K+  V+Q E+   K+   G   + ERE+  V 
Sbjct: 240  KLYKQFAYCSIPDNRLNIHLQKLIHYNLKIGVVEQVETSAVKKNNGGGSSVFEREVTNVF 299

Query: 348  SGGTLTDLKMLHSDQSTYCLSIHEAPLALYAMERGEAV---PPEAQQQGRLFGTAFIDTA 404
            +             ++TY ++ +      + +     +     E++ + + +    +   
Sbjct: 300  T-------------RATYGINENFGSSEKHVIGESNTIWGLHFESESKYKNYWLISVKVN 346

Query: 405  TGRICLLEFEDDSECT-QLDTLMAQVRPKEVVMEKRNLSVIAHKIVKF--NSQPDCIFNY 461
            +G +   EF+++     QL+T +  + P EVV +      + H + K      PD  F Y
Sbjct: 347  SGEVTYDEFKEEVALNEQLETRLKYLEPIEVVSKNE----LPHDVCKIFRRENPDIKF-Y 401

Query: 462  RTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLD 521
            ++  E            N      +      L +   Q  ++       L  YL+   ++
Sbjct: 402  QSDPE------------NDSCLEKVLVDKLGLSERLRQVTQI-------LYRYLKTYSIE 442

Query: 522  KSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKR 581
              L   G    +    ++T + L   TL++LEIF N  D   KG+L  +++   T  G +
Sbjct: 443  NVLKITG---NFKAFSSKTHMTLSAGTLESLEIFNNHTDKGVKGSLIWVLDHTRTAFGFQ 499

Query: 582  QMRTWVMHPLLRKEHIEERLDSVDQLLNE--MPIRDLWESSLTGLPDLERLLARVHSGNL 639
            Q++ W+  PL+  + IE+RLD+++ +  E  M   +   + L   PDL R+L R+  G  
Sbjct: 500  QLKDWIAKPLIHLKDIEDRLDAIECITTEVNMIFVESLNNMLKDTPDLLRILNRITYGKT 559

Query: 640  PIKDFDKVICGFENIVRLISSLNEY--------------------ELSGSLSRFLHD--I 677
              K+    +      V+L +   +Y                    EL   L  +L +  I
Sbjct: 560  SRKEVYFFLKHINLFVKLFADHYKYLEEHIYSKIGRVATKSILLTELFKELDTYLKECQI 619

Query: 678  PSTLKSDVESWTTLYDRNMAVSEGKVVP--NAGVEPDFDVSLSKMRALEE---ELDAVLS 732
            P  L   + +   + D+N    E   V   N     + +  +S+ R ++E   ELD  L 
Sbjct: 620  PKLLS--MINVAAVMDKN---QEAACVEFFNLNNYDNPERIISRQRNIDEVRTELDEELQ 674

Query: 733  EYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLARS 792
            + +R  K   + YKD     + IE+  +  K+VP +W ++ + K   R+ +P+  KL   
Sbjct: 675  KIRRILKRPMLNYKDDID--FLIEVRNTQVKNVPVSWVKINSTKMVSRFRTPETTKLVEK 732

Query: 793  MAEARELH-KILEEGLKGRLYQKFDQNFSTTWFPTIKAISNI---DCILSLARTSESLGF 848
            +   +EL  K+ EE      Y  F +     +    KAI N+   DCILSLA TS ++ +
Sbjct: 733  LQYHKELLIKVAEEE-----YLDFLKRIGENYMDLKKAIQNLATYDCILSLAATSSNVNY 787

Query: 849  PACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNA-GVNGATEFIPNDVHLGKSTAQIAL 907
               RP FK E           +L  K  R+P   +  VN    ++PND+ + +   ++ +
Sbjct: 788  --VRPTFKAE---------KQHLKIKNGRNPIIESLDVN----YVPNDIEMTQKMNKVMV 832

Query: 908  LTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFF 967
            +TG N  GKS+ +R   I VIM+Q+G +VP E AELS  D I TR+GA DNI++G+STF+
Sbjct: 833  ITGPNMGGKSSYIRQVAIIVIMSQVGAFVPAESAELSLCDAIYTRIGATDNILRGESTFY 892

Query: 968  VELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQS--LGFFATHY 1025
            VE+ E  +IL   T  +L++LDE+GRG  ++DG AI   +L       +   L  F THY
Sbjct: 893  VEMLEMLQILKSCTENSLLLLDEVGRGTGTTDGIAITYSILKFFLELQEKCPLILFTTHY 952

Query: 1026 GTLGQSFTHHPMVKPLQMAIL----VDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPR 1081
              LG       ++    M+ +     +E    V FLYKL +G +  S+G++VA +  +P 
Sbjct: 953  PVLGT--IKSKLLGNYHMSYIEEKRPNENWPSVVFLYKLRKGLAHNSYGLNVARLANVPT 1010

Query: 1082 SVVENA 1087
            S++  A
Sbjct: 1011 SIINRA 1016

>ADR168C [1910] [Homologous to ScYCR092C (MSH3) - SH]
            (997371..1000469) [3099 bp, 1032 aa]
          Length = 1032

 Score =  257 bits (657), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 231/950 (24%), Positives = 425/950 (44%), Gaps = 142/950 (14%)

Query: 204  ERYQWLVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKSKMWDCIVFFKK 263
            ER Q +++ R+       + E D            R T  ++Q+  +K +  D ++  + 
Sbjct: 104  ERLQRIMERREGGCVEEDETELDNEAPRSKRAKPNRLTELDQQFKDLKLQHMDKVLAVRV 163

Query: 264  GKFFELYEKDAHLANQLFDLKIAGGG------------RANMQLAGIPEMSFDYWASQFI 311
            G  ++ + +DA + +++  +K+  G                     IP+   +    + +
Sbjct: 164  GYKYKFFAEDAVMVSRVLQIKLVPGKLTVHETDPADHKHKKFAYCTIPDTRLEVHLQRLM 223

Query: 312  QHGYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTL--------TDLKMLHSDQS 363
             H  KV  V+Q E+   K+    +  +  RE+  + +  T          D ++L    S
Sbjct: 224  HHNLKVGVVEQTETSAVKKNSGTSSSVFSREVTNIFTRATYGINETFGTKDRRVLGDSAS 283

Query: 364  TYCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQ-L 422
             + L     P                    R F  + ++  +G +   +F+++   T+ L
Sbjct: 284  VWGLVCKRQP-----------------SYTRYFLVS-VNLNSGEVIFDDFKEERFLTEAL 325

Query: 423  DTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGY 482
            +T +    P EVV+                S+ + +F+  TS    D   T + +   G 
Sbjct: 326  ETRIKYTNPSEVVVGD-----------GLGSEIEKVFH--TS----DSDITLNRIELVGL 368

Query: 483  FAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSL 542
            +  + S P        +G     +A   +  YL   K ++SLL     E + P  ++T +
Sbjct: 369  YEEIFSEP----HPAFKGNVPLQTALMLVHGYLTNFK-NESLLFFK--ENFKPFCSKTHM 421

Query: 543  VLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLD 602
            +L    +++L+IF NS D + KG+L  +++   T  G R ++ W+  PL+  + I++RLD
Sbjct: 422  ILPSSAIESLDIFENSTDRSSKGSLLWVLDHTRTNYGLRNLKNWIAKPLINIDQIQQRLD 481

Query: 603  SVDQLLNEMPIRDLWESSLTGL----PDLERLLARVHSGNLPIKDFDKVICGFENIVRLI 658
            +V  +  E  + +++  SL  +     DLER+L R+  G    ++    +     +  L 
Sbjct: 482  AVQCISTE--VGNIFIESLNNMLRDGQDLERILNRIAYGKTSRREVYLFLRELTQLATLF 539

Query: 659  SSLNEYELSGSLS-----RFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDF 713
            SS + Y  +  LS     R    + + + +D++ +   +           +PN     + 
Sbjct: 540  SSHHRYIETNVLSANGKIRMQSSLLANIFTDLDEYWKQFP----------IPNFLAMINI 589

Query: 714  DVSLSK--------------------MRALEEELDAVLSEYKRSFKCSKI-------QYK 746
            D +L K                    + + +++++AV+ E +   K  ++        YK
Sbjct: 590  DAALDKNPDRPYVEYFNLTKYDRAEPLISKQQDIEAVIGELRDELKNIRVILKRPMLNYK 649

Query: 747  DSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEG 806
            D     + +E+  +   SVP +W ++ + K+  R+ +P   KL   +    + HK L + 
Sbjct: 650  DEID--FLVEIRNTQVSSVPVDWVKVASTKAVSRFQTPGTAKLVAKL----QYHKELLQD 703

Query: 807  LKGRLYQKFDQNFSTTWFPTIKAI---SNIDCILSLARTSESLGFPACRPNFKDEIDPTT 863
            L  + Y+ F +  +  +    KAI   S  DCILSLA TS ++ +   RP F     P  
Sbjct: 704  LALQEYESFIKRITGEYTSLRKAILHLSTYDCILSLAATSCNVDY--VRPKFNTA--PQC 759

Query: 864  GHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMT 923
             + +NG       R+P   +       ++PNDV+L +   +I ++TG N  GKS+ +R  
Sbjct: 760  INVING-------RNPIIESL---DVRYMPNDVNLNREGKKIMIITGPNMGGKSSYIRQV 809

Query: 924  CIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNR 983
             + VIMAQ+GCYVP ++AE S  D+I TR+GA DN+++  STF +E++E  +IL  +T  
Sbjct: 810  ALLVIMAQIGCYVPAQEAEFSIFDQIFTRIGAYDNLLRNDSTFKIEMTEMVQILRSSTEN 869

Query: 984  TLIVLDELGRGGSSSDGFAIAEGVLHH-ISTH-VQSLGFFATHYGTLGQSFTHHPMVKPL 1041
            +L++LDE+GRG  + DG +I+  +L + I  H    L  F THY +LG      P++   
Sbjct: 870  SLLLLDEVGRGTGTHDGISISYALLRYFIELHNACPLILFITHYASLGS--IRSPILGNY 927

Query: 1042 QMAILVD----EGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENA 1087
             M+ + +    E    V FLYKL EG++  S+G++VA +  I   ++  A
Sbjct: 928  HMSYIEEKRPGENWPSVVFLYKLKEGRAHNSYGLNVAKLADIQTGIINRA 977

>CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces
            cerevisiae YCR092c DNA mismatch repair protein,
            hypothetical start
          Length = 1025

 Score =  251 bits (640), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 239/976 (24%), Positives = 436/976 (44%), Gaps = 165/976 (16%)

Query: 209  LVDERDAAGRPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKSKMWDCIVFFKKGKFFE 268
            L+DE D         E D   +    +   + TP ++Q   +K    D ++  + G  ++
Sbjct: 120  LIDESDEIAE---QSEADEHNIKKKRKKSDQLTPLDRQVKDLKLGNMDKVLVIRVGYKYK 176

Query: 269  LYEKDAHLANQLFDLKIAGGGRA------------NMQLAGIPEMSFDYWASQFIQHGYK 316
            ++ +DA +A+ +  L++  G                      P++       + ++ G K
Sbjct: 177  IFAQDAIIASTILHLQLIPGKVTIDDSNPNDSKYKQFAYCSFPDVRLKVHLERLVRSGLK 236

Query: 317  VAKVDQKESMLAKEM--REGNKGIVERELQCVLSGGT--------LTDLKMLHSDQSTYC 366
            VA V+Q E+   K+    +    + ER++    S  T        +    +L ++ S + 
Sbjct: 237  VAVVEQSETATTKKFDNSKAKTSVFERKITGTYSKATYATNCEFEVNHENILGTNNSIWA 296

Query: 367  LSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSE-CTQLDTL 425
            L I E   ++Y                  +    I  + G +    FE+  +  ++++T 
Sbjct: 297  LDI-EVSDSIYK-----------------YYLWSIQLSNGEVIYDSFEESKDNFSKVETR 338

Query: 426  MAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAG 485
            M  + P E+V    +   I  K  +F     C  NY   AE  +  +   E+ N      
Sbjct: 339  MKYLNPSEIVSPVVDSFPIKLK-KRFLDLQLCQKNYDILAEDLNIPKK--ELLNNRLIEL 395

Query: 486  MDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLD 545
                   LK+Y ++                        LL++G    Y     + S+ L 
Sbjct: 396  WHILYRYLKEYSNE-----------------------KLLNIG--SNYRHFSQKISIQLQ 430

Query: 546  GITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVD 605
              T+ NL++ +N      KGTLF +++   TP GKR ++ W++ PLL K+ I +RL+++D
Sbjct: 431  AQTINNLDLISN---DDSKGTLFWILDHTRTPFGKRLLKEWLLRPLLSKDAIVDRLNAID 487

Query: 606  QLL---NEMPIRDLWESSLTGLPDLERLLARVHSGN-------LPIKDFDKVICGFE--- 652
             +L   N +    L    + G+PDL R + RV  G          +K    VI  FE   
Sbjct: 488  CILESANSIFFESL-NQMMKGIPDLLRTINRVSFGKTSQREVYFLLKQLTGVIKHFEAHK 546

Query: 653  -------------------NIVRLISSLNEYELSGSLSRFLH--DIPSTLKSDVESWTT- 690
                                +  +++ + E+ LS  + + L   ++ + ++ D +     
Sbjct: 547  DYIEVEINSNSGAIKTKSTKLASIMTQMFEFSLSSVIPQLLLMINVSAVMEKDQKKQLLG 606

Query: 691  -LYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCSKIQYKDSG 749
              +  N   SE  +     ++ D D       +++ +L   L   K+  K   + YKD  
Sbjct: 607  FFHLNNYDNSENII----KMQRDID-------SVKAQLHDELQNIKKILKRPHLAYKDEV 655

Query: 750  KELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKG 809
               + IE+  +  K +PS+W ++   K   R+ +P+ ++L   +    +L       L  
Sbjct: 656  D--FLIEVRNTQVKGIPSDWVKVNNTKMISRFLTPRTKELVELLEYQNDL-------LYN 706

Query: 810  RLYQKFDQ--NFSTTWFPTIKA----ISNIDCILSLARTSESLGFPACRPNFKDEIDPTT 863
             + +++DQ  N   +++  +K     ++  DC+LSLA  S ++G+   RP F D     +
Sbjct: 707  EISKEYDQFLNRIASYYNEVKTFIMNLAEYDCLLSLAAVSCNVGY--TRPVFTD-----S 759

Query: 864  GHKLNGYLSFKELRHPCYNA-GVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRM 922
              +L   +  K+ R+P   + GV    +++PND+ + K + ++ ++TG N  GKS+ +R 
Sbjct: 760  NEQL---IIAKQARNPIIESLGV----DYVPNDIEMEKDSGRVLVITGPNMGGKSSYIRQ 812

Query: 923  TCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATN 982
              + VIMAQ+G YVP E  +LS  D ++TR+G+ DNI+QG+STF VELSET +I++  T+
Sbjct: 813  IALMVIMAQIGSYVPAESLKLSVFDNVLTRIGSQDNILQGQSTFKVELSETVEIINSCTS 872

Query: 983  RTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQS-LGFFATHYGTLGQSFTHHPMVKPL 1041
            +TL++LDE+GRG S+ DG AIA  ++ +     Q     F TH+  +  +    P++K  
Sbjct: 873  KTLLLLDEVGRGTSTRDGNAIAWALIKYFVEEEQCPFILFTTHFTIV--TTVKSPLLKSY 930

Query: 1042 QMAILV----DEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAAESFEH- 1096
             M  +     +E    V FLY+L  G ++ S+G++VA + GI   ++  A   A S+++ 
Sbjct: 931  HMNYVQHKNENENWTTVVFLYQLKAGVTDSSYGLNVAKLAGIDTHIINRAHDVAISYKND 990

Query: 1097 ----TSRILKERKRYI 1108
                T+ IL ++ R I
Sbjct: 991  TEFDTNMILFQKVRNI 1006

>YCR092C (MSH3) [615] chr3 complement(276760..279903) Component of DNA
            mismatch binding factor along with Msh2p, involved in
            mismatch repair involving microsatellite (short repeat)
            sequences [3144 bp, 1047 aa]
          Length = 1047

 Score =  249 bits (635), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 237/968 (24%), Positives = 425/968 (43%), Gaps = 162/968 (16%)

Query: 238  ARFTPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGG--------- 288
            A+ TP +KQ   +K    D ++  + G  ++ + +DA   +++  +K+  G         
Sbjct: 159  AKLTPLDKQVKDLKMHHRDKVLVIRVGYKYKCFAEDAVTVSRILHIKLVPGKLTIDESNP 218

Query: 289  ---GRANMQLAGIPEMSFDYWASQFIQHGYKVAKVDQKESMLAKEMREG--NKGIVEREL 343
                         P++  +    + + H  KVA V+Q E+   K+   G     + ER++
Sbjct: 219  QDCNHRQFAYCSFPDVRLNVHLERLVHHNLKVAVVEQAETSAIKKHDPGASKSSVFERKI 278

Query: 344  QCVLSGGT--------LTDLKMLHSDQSTYCLS--IHEAPLALYAMERGEAVPPEAQQQG 393
              V +  T        L   ++L    S + LS  +H+  +A Y++              
Sbjct: 279  SNVFTKATFGVNSTFVLRGKRILGDTNSIWALSRDVHQGKVAKYSL-------------- 324

Query: 394  RLFGTAFIDTATGRICLLEFEDDSECTQ-LDTLMAQVRPKEVVMEKRNLSVIAHKIVKFN 452
                   ++   G +   EFE+ +   + L   +  ++P EV++   +L +    + KF 
Sbjct: 325  -----ISVNLNNGEVVYDEFEEPNLADEKLQIRIKYLQPIEVLVNTDDLPL---HVAKFF 376

Query: 453  SQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGLL 512
                C   ++   +  D+     +V N      +   P++++                L 
Sbjct: 377  KDISCPLIHKQEYDLEDHVVQAIKVMN----EKIQLSPSLIR------------LVSKLY 420

Query: 513  SYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDKGTLFKLVN 572
            S++     ++ +L   +   Y+P  ++  ++LD  +LQ+L+IF +  DG  KG+LF L++
Sbjct: 421  SHMVEYNNEQVMLIPSI---YSPFASKIHMLLDPNSLQSLDIFTH--DG-GKGSLFWLLD 474

Query: 573  RAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRDLWES---SLTGLPDLER 629
               T  G R +R W++ PL+    IEERLD+++ + +E+     +ES    L   PDL R
Sbjct: 475  HTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFESLNQMLNHTPDLLR 534

Query: 630  LLARVHSGNLPIKD---FDKVICGFEN--------------------------IVRLISS 660
             L R+  G    K+   + K I  F +                          + RL S 
Sbjct: 535  TLNRIMYGTTSRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSE 594

Query: 661  LNEYELSGSLSRFLHDIPSTLKSDVESWTTLYD----RNMAVSEGKVVPNAGVEPDFDVS 716
            LNE   +  L  FL  I  +   +  S   + D     N   SEG +      E      
Sbjct: 595  LNELLSTTQLPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGIIKIQRESE------ 648

Query: 717  LSKMRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANK 776
                 ++  +L   L+E ++  K   + ++D     Y IE+  S  K +P +W ++   K
Sbjct: 649  -----SVRSQLKEELAEIRKYLKRPYLNFRDEVD--YLIEVKNSQIKDLPDDWIKVNNTK 701

Query: 777  STKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNI--- 833
               R+ +P+ QKL + +   ++L  I E  L+   Y++F    +  +    K   N+   
Sbjct: 702  MVSRFTTPRTQKLTQKLEYYKDL-LIRESELQ---YKEFLNKITAEYTELRKITLNLAQY 757

Query: 834  DCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSF--KELRHPCYNAGVNGATEF 891
            DCILSLA TS ++ +   RP F           +NG  +   K  R+P   +       +
Sbjct: 758  DCILSLAATSCNVNY--VRPTF-----------VNGQQAIIAKNARNPIIESL---DVHY 801

Query: 892  IPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMT 951
            +PND+ +     +I ++TG N  GKS+ +R   +  IMAQ+G +VP E+  LS  + ++T
Sbjct: 802  VPNDIMMSPENGKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLT 861

Query: 952  RLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHI 1011
            R+GA+D+I+ G STF VE+ +   IL     R+L++LDE+GRG  + DG AI+  ++ + 
Sbjct: 862  RIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYF 921

Query: 1012 STHVQS-LGFFATHYGTLGQSFTHHPMVKPLQMAILVDEGSKK----VTFLYKLIEGQSE 1066
            S      L  F TH+  LG+     P+++   M  + ++ + +    V FLYKL +G + 
Sbjct: 922  SELSDCPLILFTTHFPMLGE--IKSPLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTY 979

Query: 1067 GSFGMHVAAMCGIPRSVVENAERAAESFEHTSRILKERKRYINDEHVVPLGLQSDFVRLV 1126
             S+GM+VA +  + + ++  A   +E           RK  IN++    L L S   R++
Sbjct: 980  NSYGMNVAKLARLDKDIINRAFSISEEL---------RKESINED---ALKLFSSLKRIL 1027

Query: 1127 FGDGLKKT 1134
              D +  T
Sbjct: 1028 KSDNITAT 1035

>Kwal_56.22613
          Length = 956

 Score =  239 bits (610), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 212/786 (26%), Positives = 376/786 (47%), Gaps = 113/786 (14%)

Query: 387  PEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVM-EKRNLSVIA 445
            P AQ+   + G +FID+++ +I +L+  D+   + L++ + Q+  +E ++ E R+   +A
Sbjct: 148  PNAQEGNCVLGVSFIDSSSYKIGMLDIVDNEVYSNLESFLIQMGVRECLLPELRSNENVA 207

Query: 446  HKIVKFNSQPD---CIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKK 502
             ++ K  S  D   C+  +  ++EF       D +   G     D     L ++ +    
Sbjct: 208  SELKKMVSVLDRCGCVSTFVKNSEFAPKDVEQDLIKLVG-----DELSMSLMKFSN---- 258

Query: 503  VGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIF------- 555
            +   +   LL+YLQ +  +  L    +V+          + LD   L+ L IF       
Sbjct: 259  LALGSCNALLNYLQLMNSESQLGRYELVQH----SLTEFMKLDASALKALNIFPVGPATT 314

Query: 556  -------ANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLL 608
                    N+       ++F+L+N+  T  G R +  W+  PL   E I++R D V+ L+
Sbjct: 315  SGPPVAHGNTSSTGKISSIFQLLNKCKTNAGIRLLNEWLKQPLTDLEAIQKRHDLVEFLI 374

Query: 609  NEMPIRDLWESS-LTGLPDLERLLARVH-SGNLPIKDFDKVICGFENIVRLISSLNEY-E 665
            +++ +R + ++  L  +PD+ RL  +++ +GNL            E+++++     +  E
Sbjct: 375  DQLELRQVLQTDYLPAVPDVRRLTKKLNKNGNL------------EDVLKIYQFAQKVPE 422

Query: 666  LSGSLSRFLHDIP--STLKSDV-ESWTTLYDRNMA-------VSEGKVVPNA-------G 708
            +S  L  +L D+   S +KS V E+W    + ++A       + E  V  +A        
Sbjct: 423  VSKVLEEYLKDVSDDSHIKSLVMETWHQPLNAHIAPLDKFQEMVETTVDLDAYEDTNEFM 482

Query: 709  VEPDFDVSLSKMRALEEELDAVLSEYKRSFKC-----------SKIQYKDSGKELYTIEL 757
            ++ DF+  L+K+R    ELD VL E  +S               K++ ++     + + L
Sbjct: 483  IKVDFNEDLAKIRG---ELD-VLKENIKSIHLDAAEDLGFDPEKKLKLENHHMHGWCMRL 538

Query: 758  PISIAKSVPSN--WTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKF 815
              +  K++  +  + +L   K+   + + +++++A   A  ++ +  L+  L   + Q  
Sbjct: 539  TRNDGKALRQHKKYLELSTVKAGIYFSTKELKQIAEQTAALQKEYDRLQSDLVKEIVQ-- 596

Query: 816  DQNFSTTWFPTIKAIS----NIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYL 871
                + T+ P ++ +S    N+D + S A  S     P  RP           H L G  
Sbjct: 597  ---ITLTYTPVLEKLSIVLANLDVLSSFAHVSSYAPIPYVRPLM---------HGL-GTQ 643

Query: 872  SFKEL---RHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVI 928
               EL   RHP     V     FI NDV L K   +  ++TG N  GKST +R   +  +
Sbjct: 644  RKTELIGSRHPVLE--VLDDVTFISNDVKLEKGKNEFLIITGPNMGGKSTYIRQVGVISL 701

Query: 929  MAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVL 988
            MAQ+GC+VPC+ AE++ +D ++ R+GA D+ ++G STF VE+ ET  IL  AT  +LI++
Sbjct: 702  MAQIGCFVPCDTAEIAVVDAVLCRVGAGDSQLKGVSTFMVEMLETASILKNATENSLIIV 761

Query: 989  DELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVD 1048
            DELGRG S+ DGF +A  +  HI++ ++    FATH+  L       P VK + +   ++
Sbjct: 762  DELGRGTSTYDGFGLAWSISEHIASKIKCFALFATHFHELTSLADQIPTVKNMHVIAHIE 821

Query: 1049 EGSKK------VTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA---ESFEHTSR 1099
            +  K       +T LYK+  G S+ SFG+HVA +   PR +V  A+R A   E  +H S+
Sbjct: 822  DAEKSNHNSEDITLLYKVEPGISDQSFGIHVAEVVQFPRKIVSMAKRKAAELEELKHDSQ 881

Query: 1100 ILKERK 1105
             LK++K
Sbjct: 882  TLKKQK 887

>Scas_720.102
          Length = 1038

 Score =  237 bits (604), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 240/942 (25%), Positives = 421/942 (44%), Gaps = 134/942 (14%)

Query: 218  RPPSDPEYDPRTLHIPAQAWARFTPFEKQYWQIKSKMWDCIVFFKKGKFFELYEKDAHLA 277
            R P + +  P        + ++ TP ++Q  ++KS   + ++  + G  ++ + +DA +A
Sbjct: 131  RVPENDDVRPSRKKKAKISKSKLTPLDQQIQELKSIHKNKLLVVRVGYKYKCFAEDAIIA 190

Query: 278  NQLFDLKIAGG----------GRANMQLA--GIPEMSFDYWASQFIQHGYKVAKVDQKE- 324
            +++  +K+  G           + + Q A    P+   +    + I +  KV  V+Q E 
Sbjct: 191  SKILKIKLVPGKLTIDESNPADKDHKQFAYCSFPDTRLNVHLERLIYNNCKVGVVEQAET 250

Query: 325  SMLAKEMREGNKG-IVERELQCVLSGGTL-----TDLK----MLHSDQSTYCLSIHEAPL 374
            S + K  +  NK  + ER++  + S  T       DLK    +L + +S + L+I E+  
Sbjct: 251  SAIKKNSQTSNKSQVFERKITGIFSKATYGVNSPHDLKGGNNLLGNTKSIWALNIDES-- 308

Query: 375  ALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEF-EDDSECTQLDTLMAQVRPKE 433
                            QQ R +    ++  +G +   EF E       L   +  + P E
Sbjct: 309  --------------LAQQKRFYSLLSVNLNSGEVIYDEFFEPLHTLYSLKERIKYLEPVE 354

Query: 434  VVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAIL 493
            +V  K                 D +FN            T +E+ N           AI 
Sbjct: 355  IVTLK-----------PLPRYVDILFNESNCK------VTINEIENTN--------EAIQ 389

Query: 494  KQYYDQGKKVGFSA-----FGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGIT 548
                    K+ FS         L  YLQ    ++ L    +   +    A   + L   T
Sbjct: 390  SSLKIVANKLKFSLELSKLLETLYIYLQEYNNERILF---ISTNFAKFLANQHMTLSDST 446

Query: 549  LQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLL 608
            L+ L+I  N  DG +KG+L  L++   T  G R++R WV+HPL   + IEERLD+++ +L
Sbjct: 447  LEGLDILRN--DG-EKGSLLWLLDHTRTSFGLRKLRDWVLHPLRTIDKIEERLDAIECIL 503

Query: 609  NEMPIRDL--WESSLTGLPDLERLLARVHSGNLPIKD---FDKVICGFENIVRLISS-LN 662
             E+    L  +   L GLPDL R L R+  G+   K+   F K +C   +  +  SS + 
Sbjct: 504  KEINCIFLESFNQLLKGLPDLLRTLNRIAYGHTSKKEVYFFLKQMCSIGDHFKTHSSYIK 563

Query: 663  EYELS--GSLSRFLHDIPSTLKSDVES------WTTLYDR-NMAVSEGKVVPNAGVE--- 710
            E  LS  G +++    + S LK D+E+         L+   N+A    K + N   E   
Sbjct: 564  EQVLSPDGRINKQSQLLTSILK-DIENNYQETHLPQLFAMINVAAVMNKNLENQKTEFFN 622

Query: 711  ------PDFDVSLSK-MRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAK 763
                  PD  + + + +  ++ +L A L   ++      + YKD  +  Y IE+  +   
Sbjct: 623  LNNYDNPDGIIKIQRDIEDVKSDLSAELKHIRKVLGRPYLNYKDEIE--YLIEVKNTQVT 680

Query: 764  SVPSNWTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTW 823
            ++PS+W ++       R+ +P   KL     E  + HK L      + YQ+F    +  +
Sbjct: 681  NLPSDWIKINNTLKISRFATPTTTKLV----EKLQFHKDLLVQEVEKEYQRFLSKINDEY 736

Query: 824  FPTIKAISNI---DCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPC 880
                  I NI   DC+LSL+  S ++ +   RP F +E            +  K  R+P 
Sbjct: 737  IRLRNIIENIATYDCLLSLSAVSCNIKY--TRPIFSNE---------KQVIKLKGARNPI 785

Query: 881  YNA-GVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCE 939
              +  +N    ++PND  + +    I +++G N  GKS+ +R   + +I+AQ+G +VP +
Sbjct: 786  IESLDIN----YVPNDTDMNRKDGLINIISGPNMGGKSSYIRQVALLIILAQIGSFVPAD 841

Query: 940  DAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSD 999
              E+S  D I+TR+GA+D++++G+STF  E+ +  ++L+  T  +L++LDE+GRG  + D
Sbjct: 842  YMEVSIFDNILTRIGAHDDLLRGESTFKKEMLDVLQVLENCTKDSLVLLDEVGRGTGTLD 901

Query: 1000 GFAIAEGVLHHISTHVQS-LGFFATHYGTLGQSFTHHPMVKPLQMAILVD----EGSKKV 1054
            G AI+  ++++        L  F +H+  LG      P+VK   M  + +    E    V
Sbjct: 902  GKAISYSLINYFMEETDCPLILFTSHFPILGT--IKSPLVKCYHMDYVEEKRPGENWSSV 959

Query: 1055 TFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAAESFEH 1096
            TFLYKL  G +  S+G++VA +  I + ++  A   +ES ++
Sbjct: 960  TFLYKLKSGFTTNSYGLNVAKLASIDKDIINEAYEISESMKN 1001

>Scas_628.3
          Length = 959

 Score =  226 bits (576), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 210/797 (26%), Positives = 372/797 (46%), Gaps = 83/797 (10%)

Query: 389  AQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVME----KRNLSVI 444
            +++   + G AFIDT+  +I +L+  D+   + L++ + Q+  +E +++      N S  
Sbjct: 150  SKEGNSVLGVAFIDTSNYKIGMLDIVDNEVYSNLESFLIQLGVRECIVQDLTNNENTSRE 209

Query: 445  AHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVG 504
              KI+    +   +     ++EF +     D           +   ++ K+Y +    + 
Sbjct: 210  FKKIIGVIDRCGSVVTLVKNSEFSEKDVEMDLTK----LINNELSLSLPKKYSN----LA 261

Query: 505  FSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFAN------- 557
              A   LL YL+ L     L    ++E       Q  + LD   ++ L +F         
Sbjct: 262  MGACNALLGYLELLNEQDQLGKFELIEH----SLQEFMKLDASAIKALNLFPQGPVQPFG 317

Query: 558  -----SFDGTDKG----TLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLL 608
                 SF GT  G    +LF+L+N   T  G R +  W+  PL     IE+R D VD L+
Sbjct: 318  PTPTASF-GTASGGKIASLFQLLNNCKTNAGIRLLNEWLKQPLTDLARIEQRHDLVDYLI 376

Query: 609  NEMPIRDLWES-SLTGLPDLERLLARVH-SGNLPIKDFDKVICGFENI---VRLISSLNE 663
            +++ +R + ++ +L  +PDL RL  +++ +GNL  +D  K+    + I    +L+ S  E
Sbjct: 377  DQLELRQMLQTDTLPMIPDLRRLTKKLNKNGNL--EDVLKIFQFSQKIPEVAQLLESFLE 434

Query: 664  YELSGSLSRFLHDI----PSTLKSD-VESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLS 718
             + S S  + L  +    P T   D +  +  + +  + +   +      ++ +F+  L+
Sbjct: 435  DDNSNSKVKSLIKMVWLDPLTSHLDPLSKFQEMVETTVDLEAFETNNQFMIKVEFNEELA 494

Query: 719  KMR----ALEEELDAVLSEYKRSFKCS---KIQYKDSGKELYTIELPISIAKSVPS--NW 769
            K+R    +L E+++A+              K++ ++     + + L  + AK +    N+
Sbjct: 495  KIREQLDSLREQINAIHLNAADDLGFDPDKKLKLENHHLHGWCMRLTRNDAKELRKHRNY 554

Query: 770  TQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKA 829
             +L   K+   + + +++++A+   + ++ +  L+  L   +        + T+ P ++ 
Sbjct: 555  LELSTVKAGIFFSTKELKEIAQETIKLQKDYDRLQSALVKEIV-----GITVTYTPVLEK 609

Query: 830  ISNI----DCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGV 885
            +S +    D + S A  S     P  RP      D T    L G       RHP     +
Sbjct: 610  LSQVLAHLDVLCSFAHVSSYAPIPYVRPKMH-PFDSTRRTHLVGS------RHPVLE--M 660

Query: 886  NGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSP 945
                 FI NDV L        ++TG N  GKST +R   +  +MAQ+GC+VPCE+AE++ 
Sbjct: 661  QDDLTFISNDVDLVDGEGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAI 720

Query: 946  MDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAE 1005
            +D I+ R+GA D+ ++G STF VE+ ET  IL  AT  +LI++DELGRG S+ DGF +A 
Sbjct: 721  VDAILCRVGAGDSQLKGVSTFMVEMLETASILKNATKNSLIIVDELGRGTSTYDGFGLAW 780

Query: 1006 GVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVDEG-----SKKVTFLYKL 1060
             +  HI++ +     FATH+  L         VK + +   +++G     S  +T LYK+
Sbjct: 781  AIAEHIASKIGCFALFATHFHELTSLSDKFSNVKNMHVVAYIEKGTDQLESDDITLLYKV 840

Query: 1061 IEGQSEGSFGMHVAAMCGIPRSVVENAERAAESFEHTSR---ILKERK---RYINDEHVV 1114
              G S+ SFG+HVA +   P  +V+ A+R A   E   +    LK+ K   R IND +  
Sbjct: 841  EPGISDQSFGIHVAEVVQFPDKIVKMAKRKASELEDLKKGNEDLKKAKLTVREINDGNKH 900

Query: 1115 PLGLQSDFVRLVFGDGL 1131
               L  D+V+ V  +GL
Sbjct: 901  LKTLLKDWVKKVKEEGL 917

>CAGL0I07733g 742340..745213 highly similar to sp|P25847 Saccharomyces
            cerevisiae YOL090w MSH2 DNA mismatch repair protein,
            start by similarity
          Length = 957

 Score =  226 bits (576), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 202/779 (25%), Positives = 358/779 (45%), Gaps = 114/779 (14%)

Query: 395  LFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQ 454
            + G  FIDT+  +I +++  D+   + L++ + Q+  +E ++                  
Sbjct: 156  ILGLTFIDTSNYKIGMMDIIDNEAYSNLESFLIQLGIRECLV------------------ 197

Query: 455  PDCIFNYRTSAEFYDYARTFD------------EVSNGGYFAGM-----DSWPAILKQYY 497
            PD   N  T+ E        D            E SN      +     +     L Q  
Sbjct: 198  PDLSQNGSTNPELKKITNVIDRCGSVVTIVPNSEFSNKDVEVDLAKLLGNDLTLTLPQNV 257

Query: 498  DQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIF-- 555
             Q   +   A   LL+YLQ L   + L    +++       ++ + LD   ++ L +F  
Sbjct: 258  SQ---LALGACNALLNYLQLLSEQEMLGKYELIQH----SLESIMKLDSSAIKALNLFPQ 310

Query: 556  -------------ANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLD 602
                           S  GT   +LF+L+N   T  G R +  W+  PL     I+ R +
Sbjct: 311  NNATFFTPMQSGTVGSNGGTKVASLFQLLNNCKTNSGVRLLNEWLKQPLTDFSGIQVRHN 370

Query: 603  SVDQLLNEMPIRDLWESS-LTGLPDLERLLARVHSGNLPIKDFDKVI---CGFENIVRLI 658
             V+ L++++ +R + ++  L G+PD+ RL+ +++  N  ++D  KV        +I+ +I
Sbjct: 371  LVEFLIDQLELRQILQTEYLPGVPDIRRLVKKLNK-NGTLEDVLKVYQFSLKVPDIINII 429

Query: 659  SSLNEYELSGS----LSRF-----LHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGV 709
             S  E +++ +    L R      L +    LK   E   T  D +      + +    +
Sbjct: 430  ESFLEDDITTTDIKELVRKTWCDPLKEFMEPLKKFDEMVQTTVDLDAYEENNEFM----I 485

Query: 710  EPDFDVSLSKMR----ALEEELDAVLSEYKRSF---KCSKIQYKDSGKELYTIELPISIA 762
              +F+  L+K+R    A+ +E++A+  E           K++ ++     + + L  + A
Sbjct: 486  RVEFNEELAKVREQLTAMRDEINAIHLEAAEDLGFDPNKKLKLENHHIHGWCMRLTRNDA 545

Query: 763  KSVPSN--WTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFS 820
            K++ ++  + +L   K+   + + K++++A+     ++ ++ L+  L   +      + +
Sbjct: 546  KALRNHKQYIELSTVKAGIFFSTRKMKEIAQETVVLQKDYERLQSSLVKEIV-----SIT 600

Query: 821  TTWFPTIK----AISNIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKEL 876
             T+ P  +     I+++D + S A  S     P  RP         T H L+     K +
Sbjct: 601  LTYTPIFEKLSLVIAHLDVLCSFAHASSYAPIPYVRP---------TMHPLSSDRRTKLM 651

Query: 877  --RHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGC 934
              RHP     V     FI NDV + K  ++  ++TG N  GKST +R   +  +MAQ+GC
Sbjct: 652  NSRHPVLE--VQDDVTFIANDVDMAKDVSEFQIITGPNMGGKSTYIRQVGVITLMAQIGC 709

Query: 935  YVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRG 994
            +VPC++AE+S +D I+ R+GA D+ ++G STF VE+ ET  IL  AT+ +LI++DELGRG
Sbjct: 710  FVPCDNAEISIVDAILCRVGAGDSQLKGVSTFMVEMLETASILKNATSNSLIIVDELGRG 769

Query: 995  GSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVDE----- 1049
             S+ DGF +A  +  HI+  ++    FATH+  L       P VK + +   +DE     
Sbjct: 770  TSTYDGFGLAWAIAEHIAKEIRCFALFATHFHELTNLSEQLPNVKNMHVIAHIDESEKAL 829

Query: 1050 GSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA---ESFEHTSRILKERK 1105
             S  +T LYK+  G S+ SFG+HVA +   P+ +V  A+R A   E  ++TS  LK  K
Sbjct: 830  NSNDITLLYKVEPGISDRSFGIHVAEVVQFPKKIVSMAKRKANELEELKNTSNDLKRAK 888

>YOL090W (MSH2) [4730] chr15 (147381..150275) Component with Msh3p and
            Msh6p of DNA mismatch binding factor, involved in repair
            of single base mismatches and short insertions/deletions
            [2895 bp, 964 aa]
          Length = 964

 Score =  223 bits (569), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 210/811 (25%), Positives = 370/811 (45%), Gaps = 106/811 (13%)

Query: 389  AQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVME----KRNLSVI 444
            +Q    + G AFIDT   ++ +L+  D+   + L++ + Q+  KE +++      N +  
Sbjct: 150  SQDGNCIIGVAFIDTTAYKVGMLDIVDNEVYSNLESFLIQLGVKECLVQDLTSNSNSNAE 209

Query: 445  AHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVG 504
              K++    +  C+     ++EF +     D     G     D     L Q Y    K+ 
Sbjct: 210  MQKVINVIDRCGCVVTLLKNSEFSEKDVELDLTKLLG-----DDLALSLPQKYS---KLS 261

Query: 505  FSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIF----ANSFD 560
              A   L+ YLQ L     +    +VE     K +  + LD   ++ L +F     N F 
Sbjct: 262  MGACNALIGYLQLLSEQDQVGKYELVEH----KLKEFMKLDASAIKALNLFPQGPQNPFG 317

Query: 561  GTDKG--------------TLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQ 606
              +                +LF+L+N   T  G R +  W+  PL   + I +R D VD 
Sbjct: 318  SNNLAVSGFTSAGNSGKVTSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDY 377

Query: 607  LLNEMPIRDLWESS-LTGLPDLERLLARVHS-GNL----PIKDFDKVICGFENIVRLISS 660
            L++++ +R +  S  L  +PD+ RL  +++  GNL     I  F K I     IV++ +S
Sbjct: 378  LIDQIELRQMLTSEYLPMIPDIRRLTKKLNKRGNLEDVLKIYQFSKRI---PEIVQVFTS 434

Query: 661  ----------LNEYELSGSLSRFLHDIP--STLKSDVESWTTL--YDRNMAVSEGKVVPN 706
                      +NE   S  L+   H +   S  +  VE+   L  Y+ N           
Sbjct: 435  FLEDDSPTEPVNELVRSVWLAPLSHHVEPLSKFEEMVETTVDLDAYEENNEFM------- 487

Query: 707  AGVEPDFDVSLSKMRA----LEEELDAVLSEYKRSFKCS---KIQYKDSGKELYTIELPI 759
              ++ +F+  L K+R+    L +E+ ++  +           K++ ++     + + L  
Sbjct: 488  --IKVEFNEELGKIRSKLDTLRDEIHSIHLDSAEDLGFDPDKKLKLENHHLHGWCMRLTR 545

Query: 760  SIAKSVPSN--WTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQ 817
            + AK +  +  + +L   K+   + + +++ +A    E   L K  ++     + +    
Sbjct: 546  NDAKELRKHKKYIELSTVKAGIFFSTKQLKSIAN---ETNILQKEYDKQQSALVREII-- 600

Query: 818  NFSTTWFPTIKAIS----NIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSF 873
            N + T+ P  + +S    ++D I S A TS     P  RP    ++ P    +    +S 
Sbjct: 601  NITLTYTPVFEKLSLVLAHLDVIASFAHTSSYAPIPYIRP----KLHPMDSERRTHLISS 656

Query: 874  KELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLG 933
               RHP     +     FI NDV L        ++TG N  GKST +R   +  +MAQ+G
Sbjct: 657  ---RHPVLE--MQDDISFISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIG 711

Query: 934  CYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGR 993
            C+VPCE+AE++ +D I+ R+GA D+ ++G STF VE+ ET  IL  A+  +LI++DELGR
Sbjct: 712  CFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGR 771

Query: 994  GGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVDEGSKK 1053
            G S+ DGF +A  +  HI++ +     FATH+  L +     P VK + +   +++  K+
Sbjct: 772  GTSTYDGFGLAWAIAEHIASKIGCFALFATHFHELTELSEKLPNVKNMHVVAHIEKNLKE 831

Query: 1054 -------VTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA---ESFEHTSRILKE 1103
                   +T LYK+  G S+ SFG+HVA +   P  +V+ A+R A   +  +  +  LK+
Sbjct: 832  QKHDDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMAKRKANELDDLKTNNEDLKK 891

Query: 1104 RK---RYINDEHVVPLGLQSDFVRLVFGDGL 1131
             K   + +N+ ++    L  +++R V  +GL
Sbjct: 892  AKLSLQEVNEGNIRLKALLKEWIRKVKEEGL 922

>KLLA0F02706g 245783..248653 gi|14348673|gb|AAK61336.1|AF332582_1
            Kluyveromyces lactis mismatch repair protein Msh2p, start
            by similarity
          Length = 956

 Score =  202 bits (514), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 194/756 (25%), Positives = 340/756 (44%), Gaps = 100/756 (13%)

Query: 396  FGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVM-EKRNLSVIAHKIVKFNSQ 454
             G +F+D    RI L +  D+   + L++ + Q+  KE ++ + R+   +A+ + K  S 
Sbjct: 160  IGVSFVDNTNYRIGLFDLLDNEVFSNLESCLIQLGIKECLIPDLRDNPSMANDLKKILSV 219

Query: 455  PD---CIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQ----GKKVGFSA 507
             D   C+ ++   ++F                 G D    + K   D+      K   + 
Sbjct: 220  IDRCSCVASFVKPSDF----------------NGKDVEADLAKLCGDELSLSVSKFSANC 263

Query: 508  FGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDK--- 564
             G     L +L +  +  ++G  E  +   +Q  + LD   ++ L +F     G      
Sbjct: 264  LGACSVLLNYLNIMNNEANVGNFEVVDHSLSQF-VKLDASAIKALNVFPTGSQGNTALLS 322

Query: 565  -------GTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRD-L 616
                    +LF+L+NR  T  G R +  W+  PL   + I +R D V+  ++++ +R  L
Sbjct: 323  VGSPQKCSSLFQLLNRCKTNSGVRLLNEWLKQPLTDIDQITKRHDLVEFFMDQLELRSSL 382

Query: 617  WESSLTGLPDLERLLARVH-SGNLPIKDFDKVICGFENIVRLISSL--------NEYELS 667
             E  L  +PD+ RL  ++  +GNL  +D  K I  F  +V +IS L        +  +L 
Sbjct: 383  QEECLPSVPDIRRLTKKLQKNGNL--EDVLK-IYQFAQMVPVISDLLKQKTEEVDSNDLM 439

Query: 668  GSLSRFLHDIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRA-LEEE 726
              +   L D      + +E    L +  + +   +      ++ +F+  LS +R  L+E 
Sbjct: 440  ILVKEVLLDPMLENANPLEKLKELVETTVDLEAYEETNEFMIKVEFNEQLSIIRTHLDEL 499

Query: 727  LDAVLSEYKRSFKCSKIQYKDSGKEL-YTIELPISIAKSVPSNWT-QLGANKSTKRYYSP 784
             DA+           +  + D+  +L +  E  + +       W  +L  N +       
Sbjct: 500  KDAI-----------RTIHLDTADDLGFDPEKKLKLENHHLHGWCMRLTRNDAKALRQHK 548

Query: 785  KVQKLARSMA----EARELHKILEEGLKGRLYQKFDQ----------NFSTTWFPTIKAI 830
            K  +L+   A      +EL  I EE     L +K++Q          + + ++ P ++ +
Sbjct: 549  KYIELSTVKAGIFFSTKELKNIAEET--SELQKKYEQQQASLVKEIVSITLSYTPVLEKL 606

Query: 831  S----NIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKEL---RHPCYNA 883
            S     +D + S A+ S     P  RP           + LN      EL   RHP    
Sbjct: 607  SVVTAQLDILCSFAQVSSYAPIPYVRPKM---------YPLNDQNRTTELIASRHPI--V 655

Query: 884  GVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAEL 943
             +     FI NDV L +  ++  ++TG N  GKST +R   +  +MAQ+GC+VPC++A++
Sbjct: 656  EMQDDVTFISNDVKLVQGDSEFIVITGPNMGGKSTYIRQIGVICLMAQIGCFVPCDEAKI 715

Query: 944  SPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAI 1003
            + +D I+ R+GA D+ ++G STF +E+ ET  IL  AT+ +L+++DELGRG S+ DGF +
Sbjct: 716  AAVDAILCRVGAGDSQLKGVSTFMMEMLETASILKNATHNSLVIVDELGRGTSTYDGFGL 775

Query: 1004 AEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVDE----GSKKVTFLYK 1059
            A  +  HI+T++     FATH+  L         V  + +   +++     S  +T LYK
Sbjct: 776  AWSISEHIATNINCFTLFATHFHELTTLADKLDNVSNMHVVAHIEDNGSHNSDDITLLYK 835

Query: 1060 LIEGQSEGSFGMHVAAMCGIPRSVVENAERAAESFE 1095
            +  G S+ SFG+HVA +   P  +V  A+R A   E
Sbjct: 836  VEAGSSDQSFGIHVAEVVQFPSKIVNMAKRKAAELE 871

>AFR603C [3795] [Homologous to ScYOL090W (MSH2) - SH]
            (1524851..1527721) [2871 bp, 956 aa]
          Length = 956

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/304 (34%), Positives = 157/304 (51%), Gaps = 25/304 (8%)

Query: 809  GRLYQKFDQ----------NFSTTWFPTIKAIS----NIDCILSLARTSESLGFPACRPN 854
            G L Q +D+            + ++ P ++ +S    N+D + S A  S     P  RP 
Sbjct: 576  GTLQQDYDRKQSALVKEIVTITLSYSPVLEKLSLVLANLDVLCSFAHVSSYAPIPYVRPV 635

Query: 855  FKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAA 914
              D       H     +     RHP   A       FI NDV L   ++  A++TG N  
Sbjct: 636  MYD------MHAGQRKMELLASRHPLVEA--QDEVTFISNDVVLEADSSGFAIITGPNMG 687

Query: 915  GKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETR 974
            GKST +R   +  ++AQ+GC+VPC+ AE++ +D I+ R+GA D+ ++G STF  E+ ET 
Sbjct: 688  GKSTYIRQVGVICLLAQIGCFVPCDAAEITIVDAILCRVGAGDSQLKGVSTFMAEMLETA 747

Query: 975  KILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTH 1034
             IL  AT  +LI++DELGRG S+ DGF +A  +  HI+ ++     FATH+  L      
Sbjct: 748  SILRNATKNSLIIIDELGRGTSTYDGFGLAWSISEHIAKNIGCFALFATHFHELTALADD 807

Query: 1035 HPMVKPLQMAILVDEGSKK---VTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERAA 1091
             P V  L +   V+E S K   +T LYK+  G S+ SFG+HVA +   P  +V+ A+R A
Sbjct: 808  CPNVTNLHVVAHVEEKSHKSDDITLLYKVEPGISDQSFGIHVAEVVQFPSKIVKMAKRKA 867

Query: 1092 ESFE 1095
               +
Sbjct: 868  TELD 871

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 122/267 (45%), Gaps = 24/267 (8%)

Query: 395 LFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVM-EKRN---LSVIAHKIVK 450
           + G +++D+ + +I +L+  D+   +  ++ + Q+  KE ++ + RN    S    K+  
Sbjct: 156 VLGVSYVDSNSYKIGMLDIVDNEVYSNFESFLIQLGVKECLLPDLRNNESFSAELKKVTG 215

Query: 451 FNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGG 510
              +  C+  +  ++EF +     D     G     D     L ++     K+  ++   
Sbjct: 216 VIERCGCVVTFVKNSEFNNKDVEADLAKLCG-----DELATSLPRF----SKLALASCNA 266

Query: 511 LLSYLQWLKLDKSLLSMGMVE----EYNPLKAQT----SLVLDGITLQNLEIFANSFDGT 562
           L+ Y Q L    +  S  +VE    E+  L A      S+   G + Q+    +  F G 
Sbjct: 267 LIGYQQLLNNAGNEGSYQIVEYSLSEFMKLDASAVKALSIFPQGPSTQSGMATSGKFGGN 326

Query: 563 DKGT-LFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRD-LWESS 620
            K T L +L+N+  T  G R +  W+  PL  K  IE+R + VD L++++ +R  L +  
Sbjct: 327 GKITSLLQLLNKCKTNAGVRLLNEWLKQPLSDKGSIEKRHNLVDYLVDQLELRSILRDDY 386

Query: 621 LTGLPDLERLLARVHSGNLPIKDFDKV 647
           L  +PD+ RL  +++  N  ++D  KV
Sbjct: 387 LPLVPDVRRLTKKLNR-NGSLEDVLKV 412

>KLLA0F24156g 2251454..2254276 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1 DNA mismatch repair protein,
            mitochondrial, hypothetical start
          Length = 940

 Score =  157 bits (398), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 214/931 (22%), Positives = 378/931 (40%), Gaps = 175/931 (18%)

Query: 258  IVFFKKGKFFELYEKDAHLANQLFDLKIAGGG--RANMQLAGIPEMSFDYWASQFI-QHG 314
            +V  + G F+ELY + A +   + ++ +         +  AG P    +      + Q+G
Sbjct: 87   VVLTQIGSFYELYFEHATIYAPILNITLTSKSIVSGKVPFAGFPLNQLNRHLKVLVKQYG 146

Query: 315  YKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEAPL 374
            Y VA  DQ +    + + + +K    R +  +++ GT  D    +  ++ Y L++H    
Sbjct: 147  YSVAVCDQFKH---ETLVDNDKNKFMRRVTRIVTPGTFIDEAFENFQENQYLLTVH---F 200

Query: 375  ALYAMERGE--AVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432
            +   M+R     +P          G ++ D +TG I    F        L + + ++RP 
Sbjct: 201  SENCMKRAADLNIP---------VGLSWCDISTGEI----FVQQVYLKDLVSSITRIRPM 247

Query: 433  EVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAI 492
            EV++++  + V                   T+ E+Y   +   E+    YF      P+ 
Sbjct: 248  EVLLDEEIMPVEI-----------------TNGEWY---KELTELKK--YFIKYQKMPSK 285

Query: 493  ---LKQYY--------DQGKKVG------FSAFGGLLSYLQWLKLDKSLLSMGMVEEYNP 535
               ++ ++        D G+ +G       +A   LL Y+     ++ L  +    E   
Sbjct: 286  HRPIQSFFKLFSNAEGDIGRSLGNFTQKEIAALRNLLLYI-----EEHLPDINTNLELPQ 340

Query: 536  LKAQTSLV-LDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRK 594
             +  T ++ +D  T   LE+ +       KG+L   + R +T  G R +  W+  P +  
Sbjct: 341  KQLITDIMQIDSRTSTALELHSTMRKHHKKGSLLSTIRRTVTTSGTRLLTQWLSAPSMDI 400

Query: 595  EHIEERL-------DSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGN---LPIKDF 644
              I+ R        D+ D    E  IR L E++     D+ R++ R   G    L +   
Sbjct: 401  NEIKNRQSLVLLFKDNFD--YTESLIRYLKETA-----DMSRIIQRFSFGRGDPLELIQI 453

Query: 645  DKVICGFENIVRLISSLNEYELSGSLSRFLHDIPSTL----------------KSDVESW 688
             K +   + I   + + N +  +    + + +I   L                +S ++ W
Sbjct: 454  AKSLRKCKEISEYLQT-NVHPSTKKTEKLIKNITKQLNFEDPIVEKVISSLNEESLIKQW 512

Query: 689  TTLYDR-----------NMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVLSEYK-- 735
            +  Y+R           N       ++                  L +E +++L  YK  
Sbjct: 513  SEKYERDDEEKFDASEENQERKSLVMIMKPSASQKLKEYYKSYNILIKEKESLLQWYKDW 572

Query: 736  --RSFKCSKIQYKDSGKELYTIELPISIAKSVP---------------SNWTQLGANKST 778
                FK   +  K      + I L  SIA  V                S +  L  ++ T
Sbjct: 573  FLERFKLKNVSLKQKNSGEFCIHLSGSIANVVEFDKYIEQQKDSSQAHSGFHVLQKSRQT 632

Query: 779  KRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISN----ID 834
            +     K + L+R +     L K  EE    RL  +F ++F  +  P I+++S     +D
Sbjct: 633  RWIIHDKWETLSREIEVVGALIKNEEE----RLINQFQKDF-ISLSPMIRSLSQTLDYMD 687

Query: 835  CILSLARTS--ESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGAT--E 890
             + S A+ +  + L  P            T G +LN     K  RH    A ++  +   
Sbjct: 688  VLTSFAKLAIEQRLVLPKV----------TQGTELN----IKGGRHLVVEASISQKSLES 733

Query: 891  FIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIM 950
            F PND  +  ++ ++ ++TG N  GKST LR   I VI+AQ+G +VPCE A +  +D+I 
Sbjct: 734  FTPNDCQI--NSGELWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCESAVIGLVDKIF 791

Query: 951  TRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHH 1010
            +R+G+ D++    STF VE+ ET  IL  ATNR++ +LDE+GRG S S+G AIA   L +
Sbjct: 792  SRVGSADDLYNEMSTFMVEMIETSYILKGATNRSMAILDEIGRGTSRSEGVAIAYATLKY 851

Query: 1011 ISTHVQSLGFFATHYG---------TLGQSFTHHPMVKPLQMAILVDEGSKKVTFLYKLI 1061
            ++T+      FATH+G         T  + F ++  +   +  I+ D  +    + +KL 
Sbjct: 852  LTTNNACRALFATHFGTELASTINSTSNEEFINN--ISFFKTGIIGDNSN--FYYDHKLK 907

Query: 1062 EGQSEGSFGMHVAAMCGIPRSVVENAERAAE 1092
             G    S  + VA + G P   +E A    E
Sbjct: 908  PGICSKSDAIKVAKLAGFPEEALEIASTLLE 938

>Scas_544.2
          Length = 874

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 153/625 (24%), Positives = 271/625 (43%), Gaps = 128/625 (20%)

Query: 548  TLQNLEIFANSFDGTDKG------TLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERL 601
            +LQ L IF  +  GTDK       ++ +L+N       K  +++W++ PL +K+ IE R 
Sbjct: 220  SLQILPIFKKT--GTDKTIGKRDMSILELLNHVSNGYSKNILKSWLLAPLRKKKEIETRY 277

Query: 602  DSVDQLL---NEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVRLI 658
            D VD  L   N +   ++ E    G PDL  +L ++  GN  +  +  ++   E  +RL 
Sbjct: 278  DVVDIFLGKNNSLFFEEIQEI-FKGFPDLFNILKQLQHGNESVTIWTNLVQFLERAIRLT 336

Query: 659  SSLNEYELSGSLSRFLHDIPSTL------------KSDVESWTTLYDRNMAVSEGKVVPN 706
              L++ ++  +    +  I S +            K  ++  T+ Y++ + + EG     
Sbjct: 337  DCLSKLDIVSTSENLIRRIISNVDLTVFKTLLRKVKQTIDFETSKYNKEIVLIEG----- 391

Query: 707  AGVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCSKIQ--------------------YK 746
                   +  L + + +  EL+ +L+E  +  +    Q                    Y 
Sbjct: 392  ------INERLDQHKLIYNELEVILTEIAKQAENDLFQNLMERNVSPDMTRDKIVNAVYI 445

Query: 747  DSGKELYTIELPISIAKSVPSNWTQLGANK----STKRYYSPKV-----QKLARSMA--- 794
                 L T++   S+ + +    TQLG N+    +T  +Y  +      QK     A   
Sbjct: 446  PQLGYLVTVD---SVIQELSDITTQLGWNEVFRTNTDLFYKNEAVLQLDQKYGDIYASIS 502

Query: 795  --EARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCILSLARTSESLGFPACR 852
              E   LH + E  +K RL  K  + F        +  + ++ ++S A  S+  G+   R
Sbjct: 503  DLEVEVLHSLQECVIKERL--KLMEYF--------QLFAQLEVLVSFAYISQRNGY--VR 550

Query: 853  PNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHL-----------GKS 901
            P   ++            L  K  RHP Y    N    +IPND+ L            + 
Sbjct: 551  PELSED---------ECVLDIKSGRHPLYE---NIVDTYIPNDLELLGGSFDDTSWSREG 598

Query: 902  TAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQ 961
              +I ++TGANA+GKS  L  T + V +A +GC+VPC+ A +  +DRI+TR    D +  
Sbjct: 599  NKRIGIITGANASGKSVFLIQTGLIVYLAHIGCFVPCDSARIGLVDRILTRTRTQDTVSL 658

Query: 962  GKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFF 1021
             KS+F ++  +  + L   + ++LI++DE G+G    DG ++   ++  ++         
Sbjct: 659  LKSSFELDSLQMARCLSQMSKKSLILIDEFGKGTDIIDGPSLFGAIIQQLAESKDCPRVL 718

Query: 1022 A-THY------GTLGQSFTHHPMVKPLQMAILVDEG-----------SKKVTFLYKLIEG 1063
            A TH+        L ++F   P V      +L+++            +  +TFLY++ EG
Sbjct: 719  ACTHFHELFNTDVLDEAF---PGVNYYMTQVLLNQAHISSSRDTLCKNVGITFLYRIKEG 775

Query: 1064 QSEGSFGMHVAAMCGIPRSVVENAE 1088
             S  SFG++ A +CGI  S+V+ AE
Sbjct: 776  ISRQSFGVYCAKICGIKESIVKRAE 800

>KLLA0F11022g complement(1016214..1018880) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 888

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 133/531 (25%), Positives = 243/531 (45%), Gaps = 42/531 (7%)

Query: 541  SLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER 600
            ++++D  T+Q+LE+  N+ + ++  TL K++++ +T MG R +R  ++ PL     ++ R
Sbjct: 273  TMLIDMKTVQSLELIENTLE-SNGMTLLKVIDKTVTKMGHRALRNDILQPLTDINSLKLR 331

Query: 601  LDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGN----LPIKDFDKVICGFENIVR 656
            + +V +L N     + +   L  L DL+ L +++ S N    LP +  + VI   E+I  
Sbjct: 332  VSAVQELQNNPDFLNSFRMELKVLHDLDALFSKLLSFNHTVILPDQKLNYVILLKESIES 391

Query: 657  LISSLNEYELSGSLSRFLHDIPSTLKSD-VESWTTLYDRNM------------AVSEGKV 703
              +    +E S   S+ L +I +   SD + S   L +R +              ++   
Sbjct: 392  ATTLKRLFEESKFESKLLSEIMAIFSSDDISSIFDLINRYLNEDTRWASTPIDLQNQKAY 451

Query: 704  VPNAGVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELP---IS 760
                G     DV     ++L +++   +   +  F  +     D  ++ Y ++L    I+
Sbjct: 452  AIKRGSNGLLDVLRQLYKSLTDDIMREVDSLRDKFGLNFSHGHDVNRQFY-LKLKKKDIN 510

Query: 761  IAKSVPSNWTQLGANKSTKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFS 820
                + S +      K+   + +  + K+   ++E       L E     L      + +
Sbjct: 511  QLSDLDSCFINRVTKKTAYEFTTLNLMKMNTRLSELTCEMIALSEQTVSELLSNISSHIA 570

Query: 821  TTWFPTIKAISNIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPC 880
            T  F   +AIS +D + SLA T    G         + I  + G+    +LS    RHP 
Sbjct: 571  T-LFMISEAISVLDLLCSLATT----GLE------NNWILASFGN----HLSLSGARHPI 615

Query: 881  YNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCED 940
                 N  T F+ NDV    + +   ++TG N +GKS  L+   +  I+AQ+GC VPC  
Sbjct: 616  LE---NTLTNFVANDVEAIPNLSSFQIVTGCNMSGKSIYLKQVAMLTILAQIGCPVPCTS 672

Query: 941  AELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDG 1000
            A      ++  R+  ND+I    STF  E+ +    +D  T++TL++LDELGRG S +DG
Sbjct: 673  ASFPLYQKLHARV-CNDDIEAYSSTFSAEMKDMAYFIDDITDKTLMILDELGRGSSIADG 731

Query: 1001 FAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAILVDEGS 1051
            F+IA  +  ++ +   ++ F +TH+  + +     P V  L+M   +D+ S
Sbjct: 732  FSIALAISEYLLSKNATV-FLSTHFRDIPKILAPKPRVLHLEMKTEIDQES 781

>KLLA0C16423g complement(1437001..1439805) similar to sp|Q12175
            Saccharomyces cerevisiae YDL154w MSH5 meiosis-specific
            protein, start by similarity
          Length = 934

 Score =  138 bits (347), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 145/618 (23%), Positives = 274/618 (44%), Gaps = 87/618 (14%)

Query: 536  LKAQTSLVLDGITLQNLEIFA--------NSFDGTDKGTLFKLVNRAITPMGKRQMRTWV 587
            L  +  L LD  TL  L IF              T   ++F L+N   + +GKR +++W+
Sbjct: 269  LMLKDRLFLDDDTLAALHIFKPIQIPGHFCEITKTGYSSVFDLLNHTTSELGKRLLKSWL 328

Query: 588  MHPLLRKEHIEERLDSVDQLL---NEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDF 644
              PL  K  IEER   +  L+   N +   DL  +SL  +P++  ++  +  G + +  +
Sbjct: 329  ASPLSNKILIEERQKVIRSLIDGKNAILFDDL-SNSLKYMPNIFSIVNEMSKGAVKLSVW 387

Query: 645  DKVICGFENIVRLISSLNEYELSGSLSRFLHDIPSTLKSD-----VESWTTLYDRNMAVS 699
             K I      V +I+ ++    S    R  + I + L        ++   ++ D   +++
Sbjct: 388  RKYISFCTKTVEIINLIHILYDSSDNCRLFNTIKNDLDKSMMLKILKKTESVLDLEGSLN 447

Query: 700  EGKVVPNAGVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCS------KIQYKDSGKE-- 751
            +  +V    V  + D +      LE  L+ V +E   +   +      K+  K +G+   
Sbjct: 448  QDAIVIKDKVRIELDEARGTYFELEGVLNLVANEANNTLISTLQSNEEKLFKKLNGRNAL 507

Query: 752  LYTIELP-----ISIAKSVPS-------NWTQLGANKSTKRYYSPKVQKLARSMAEAREL 799
            +  I LP     + +  S+          WT++   ++   Y +   + +     +   L
Sbjct: 508  INAIYLPQLGYLLCVDASIEDMFDPAVLYWTEIFREQNVIYYKNDDTKVMDEHYGD---L 564

Query: 800  HKILEEGLKGRLYQKFDQNFSTTWFPTI----KAISNIDCILSLARTSESLGFPACRPNF 855
            H I+ +     L +   QN      P I    K  + ++ ++S A+T+ S  +       
Sbjct: 565  HGIISDLELEILLEL--QNAVLNTKPAILLSGKCFAELEVLVSFAKTAISQNY------- 615

Query: 856  KDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHL----------GKSTAQI 905
               + P    K    +  +  RHP Y   V+    +IPND+ +            +  +I
Sbjct: 616  ---VQPVIEEK-ECVIEIENGRHPLYETLVDT---YIPNDLRMLGGTFDNDTWNNNFKRI 668

Query: 906  ALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKST 965
            +++TGANA+GKS  L    + V +A +GC+VP ++A +  +D+I+TR+   +++ + +ST
Sbjct: 669  SVITGANASGKSVFLTQNGLIVFLAHIGCFVPADNARIGLVDKILTRVVTRESVAKTQST 728

Query: 966  FFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFA-TH 1024
            F ++ ++  K L +AT R+L+++DE G+G    DG ++   ++   S         A TH
Sbjct: 729  FEIDANQMSKCLSLATPRSLLLIDEFGKGTDVIDGLSMFGAIIKDFSRSSSCPRVIASTH 788

Query: 1025 YGTL-----------GQSFTHHPMVKPLQMAILVDEGSKK---VTFLYKLIEGQSEGSFG 1070
            Y  +           G  F    ++  LQ+    ++G+ +   +TFLYKL  G +  SFG
Sbjct: 789  YNEVFSPNILTSEINGVVFYKTEIL--LQVMEKENKGNARDEMITFLYKLSTGIATNSFG 846

Query: 1071 MHVAAMCGIPRSVVENAE 1088
            +  A  CG+ +S+V+ A+
Sbjct: 847  IFCAKNCGLRQSIVQRAQ 864

>Sklu_1903.3 YFL003C, Contig c1903 4902-7601
          Length = 899

 Score =  137 bits (346), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 175/732 (23%), Positives = 316/732 (43%), Gaps = 83/732 (11%)

Query: 396  FGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVMEKR----NLSVIAHKIVKF 451
             G   I+ +TG + + +F D     +    +   +P E+++       N+S +A  I+KF
Sbjct: 140  IGLCVINYSTGEMIISDFMDSQIFIRTVHKIQIHQPTEILLPSSSFLPNISKLA-TIIKF 198

Query: 452  NSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGL 511
            N     +     S + Y+       +   G F G +    + +++ D  KK    A    
Sbjct: 199  NVSGS-VKVIEASLKHYNSQEGLTAIEEYGLFIGNEKNLTV-EKFVD--KKFALCAVSAA 254

Query: 512  LSYLQWLKL----DKSLLSMGMVEEYNPLKAQTSLVLDGITLQNLEIFANSFDGTDKG-T 566
            + + + +      ++S     +  +Y     + ++++D  T + LE+  N+ +   KG +
Sbjct: 255  IKHTKRISTSRISNESYSFQNLRIKYEG--TENTMLIDPRTSKGLELVENALE--KKGMS 310

Query: 567  LFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRDLWESSLTGLPD 626
            LFK ++  +T MGKR +R  ++ PL +++ I  RL  V +L +   +     + +    D
Sbjct: 311  LFKFLDSTVTKMGKRALRNNILQPLTQEDGIIMRLQCVVELQDNSQLLGDLRAEMRSCQD 370

Query: 627  LE----RLLARVHSGNLPIKDFDKVICGFENIVRLISSLNEY-ELSGSLSRFLHDIPSTL 681
            L+    +LL+  H+   P +  + VI   ++ + L S L    E +   SR L ++    
Sbjct: 371  LDALYSKLLSADHAAIRPDQKLNYVIL-LKDSIELASKLGSLLENNKVESRLLKEVKEIC 429

Query: 682  KSD------------VESWTTLYDRNMAV-SEGKVVPNAGVEPDFDVS-----------L 717
            ++D            +    T    N+ + ++      +G     DVS           +
Sbjct: 430  QNDAIEDIRELISTYINDDCTWASTNLDLQNQRSYAVKSGANGLLDVSRQIYKGIIDDII 489

Query: 718  SKMRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKS 777
            +++ +L +     L     S +   ++ K  G    +   P+ I K V  N+ +      
Sbjct: 490  NEIESLSQRHSLNLQHSYDSTRGFFVKLKRQGITDISKLAPVFINKVVKKNYVE------ 543

Query: 778  TKRYYSPKVQKLARSMAEARELHKILEEGLKGRLYQKFDQNFSTTWFPTIKAISNIDCIL 837
               + + ++ KL   + E      ++ E +   L +   +  S   F   +A+S +D + 
Sbjct: 544  ---FTTLQITKLNARLDEVMSEIMLISEQIVQELLKAIVKKISV-LFMIAEAVSILDLLS 599

Query: 838  SLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVH 897
              A  S    +  C P F ++            + FK  RHP     +    +FIPND  
Sbjct: 600  CFAYNSAENNY--CIPEFSNK------------MVFKSARHPILEKFLK---KFIPNDTV 642

Query: 898  LGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGAND 957
              K ++ I ++TG NA+GKS  L+   I  IMAQ+G  VP + A     +R+  R+  ND
Sbjct: 643  SIKESSAIQIITGCNASGKSVYLKQIAILNIMAQMGSPVPADYACFPIFNRLHARV-CND 701

Query: 958  NIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQS 1017
             I    STF  E+ E    L    + TL+VLDELGRG S  DGFA++  +  H+ +  + 
Sbjct: 702  TIEVNSSTFSSEMKEMAYFLHDIDSNTLMVLDELGRGSSIGDGFAVSLAITEHLVS-TKC 760

Query: 1018 LGFFATHYGTLGQSFTHHPMVKPLQM-AILVDEGSKKVTFLYKLIEGQSE-GSFGMHVAA 1075
              F +TH+  + +  T  P V  LQM A +VD   K +T  YK+    S   ++G+ V  
Sbjct: 761  TAFISTHFRDIPEILTSKPSVVHLQMTAEVVD---KSLTMHYKVSRTTSGIKNYGLRVVQ 817

Query: 1076 MCGIPRSVVENA 1087
                PR +++NA
Sbjct: 818  NL-FPREIMDNA 828

>CAGL0L13002g 1388045..1390894 similar to sp|P25846 Saccharomyces
            cerevisiae YHR120w MSH1, hypothetical start
          Length = 949

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 112/206 (54%), Gaps = 8/206 (3%)

Query: 891  FIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIM 950
            F  N+  L  S+  I +++G N  GKST LR   I  I+AQ+GC+VPC  A +  +D+I 
Sbjct: 736  FTANNCDL--SSNDIWVISGPNMGGKSTFLRQNAIIAILAQIGCFVPCRKAHIGLVDKIY 793

Query: 951  TRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHH 1010
            +R+G+ D++    STF VE+ ET  IL+ AT+R+L +LDE+GRG S  +G A+A G L H
Sbjct: 794  SRVGSADDLYNDMSTFMVEMVETSLILNGATDRSLAILDEIGRGTSGKEGVAVAYGTLKH 853

Query: 1011 ISTHVQSLGFFATHYGTLGQSFTHHPM------VKPLQMAILVDEGSKKVTFLYKLIEGQ 1064
            +  + +    FATHY    +      +      +   Q +I       K  + +K+  G 
Sbjct: 854  LLQNNKCRSLFATHYAQELKQVADQDLSEDTHRIHYFQTSIRETNDPNKFYYDHKMRPGI 913

Query: 1065 SEGSFGMHVAAMCGIPRSVVENAERA 1090
            S+ S  + VA + G P+  + +A  A
Sbjct: 914  SQKSDALKVARIAGFPQDALNDASTA 939

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/400 (22%), Positives = 164/400 (41%), Gaps = 40/400 (10%)

Query: 249 QIKSKMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGG--RANMQLAGIPEMSFDYW 306
           ++ S+  D +V  + G FFELY   A     L ++ +         +  AG P       
Sbjct: 70  KLISQYPDHVVLTQMGSFFELYFDHASTYAPLLNIALTQRTYTHGKVPFAGFPVPQLSRH 129

Query: 307 ASQFIQ-HGYKVAKVDQ-KESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQST 364
               +Q +GY V   +Q K+   A    E N+    R +  +++ GT  D  + +  ++T
Sbjct: 130 LKALVQDYGYSVVVAEQFKKDGYATN--ENNR--FYRRVTRIVTPGTFIDEALDNYSENT 185

Query: 365 YCLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDT 424
           + L+I E P         E       +     G ++ D +TG I + E         L  
Sbjct: 186 FLLTI-EFP---------ENFTNYVAEDNLRIGISWCDISTGEIYIQELP----LKDLMN 231

Query: 425 LMAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDC------IFNYRTSAEFYDYARTFDEVS 478
            + +++PKE+++  R LS     I+  N  P          NY T+   Y    T+ ++ 
Sbjct: 232 AITRIKPKEILLNARELS---DDIISGNWYPQLAELKRYFINYYTTTTRYRTLDTYFDMF 288

Query: 479 NGGYFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKA 538
                +GM      L+   ++      +A   LLSY+      + L    +  ++   + 
Sbjct: 289 AATRASGMRQR---LRMELNEYSIKETAALRNLLSYVA-----EHLPECAINFQFPKRQI 340

Query: 539 QTSLV-LDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHI 597
            T ++ +D  T + LE+ +   D + +GTL   + R +TPMG R +  W+  P +  + I
Sbjct: 341 TTDILQIDSRTTKALELHSTIRDNSKRGTLLNTMRRTVTPMGTRLLSQWLSGPSMNIKEI 400

Query: 598 EERLDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSG 637
           + R   V   L +    D   S L  + D+ +LL + + G
Sbjct: 401 KLRQSIVSLFLADKRSHDKIISELKKIQDIVKLLQKFNFG 440

>ABR137W [729] [Homologous to ScYHR120W (MSH1) - SH]
            complement(653115..655982) [2868 bp, 955 aa]
          Length = 955

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 109/205 (53%), Gaps = 7/205 (3%)

Query: 891  FIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIM 950
            F  ND  L      I ++TG N  GKST LR T I VI+AQ+GCYVPC  A +  +D+I 
Sbjct: 748  FTANDCSL--QNGDIWIVTGPNMGGKSTFLRQTAIIVILAQIGCYVPCASAHIGLVDKIF 805

Query: 951  TRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHH 1010
            +R+G+ D++    STF VE+ E+  +L  AT R+L +LDE+GRG ++ DG  IA   LHH
Sbjct: 806  SRVGSADDLYNDMSTFMVEMLESSFMLKGATKRSLAILDEIGRGTNAEDGVGIAYTTLHH 865

Query: 1011 ISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAIL-----VDEGSKKVTFLYKLIEGQS 1065
            + T  +    FA+H+G          +    +  +      V E + +  + +K+  G  
Sbjct: 866  MLTKNRCRALFASHFGRELSELVEQHLPPGARKRVHFYRTNVREHNGRSFYDHKITPGIC 925

Query: 1066 EGSFGMHVAAMCGIPRSVVENAERA 1090
              S  + VA M G P+  ++ A R 
Sbjct: 926  LSSDAIRVAQMAGFPQEALDVARRV 950

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 83/393 (21%), Positives = 166/393 (42%), Gaps = 42/393 (10%)

Query: 253 KMWDCIVFFKKGKFFELY----EKDAHLANQLFDLKIAGGGRANMQLAGIPEMSFDYWAS 308
           K  D ++  + G F+ELY    EK A   N     +    G+  +  AG P         
Sbjct: 86  KYPDYVLLTQMGSFYELYYEHAEKYAPKLNITLTRREYSHGK--VPFAGFPLEQLSRHLK 143

Query: 309 QFI-QHGYKVAKVDQ--KESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTY 365
             + ++GY VA V+Q  K+ +   E  + N+ +       V++ GT  D    +  ++ +
Sbjct: 144 VLVKEYGYSVAVVEQFRKDDIADNERYKFNRRVTR-----VVTPGTFIDEAFENLQENQF 198

Query: 366 CLSIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTL 425
            LS+ E P     ME+     P  +      G ++ D +TG +    F    +   L + 
Sbjct: 199 LLSV-EFPDR--CMEK--LSDPSIK-----VGLSWCDISTGEL----FVQQVQLKGLISA 244

Query: 426 MAQVRPKEVVMEKRNLSVIAHKIVKFNSQPDCIFNYRTSAEFYDYA---RTFDEVSNGGY 482
           + +++P+E+++ +    ++A++I   N  P+ +   +   ++Y      RT +  S+   
Sbjct: 245 ITKIKPREILLSE---DLLAYQIQNGNWYPELVEFKKYFIKYYKTPSRHRTMETFSHLFA 301

Query: 483 FAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQT-- 540
           F   ++    L        +   +A    L+Y++   L + L ++       P ++ T  
Sbjct: 302 FGANNASKRNLDIVLHSLSQKETAALRANLTYIEQ-HLPEMLANLAF-----PKRSLTTD 355

Query: 541 SLVLDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER 600
           S+ +D  T   LE+     D   +G+L   + R +TP G R +  W+  P +  + I++R
Sbjct: 356 SMQIDSRTSAALELHNTFRDNLKRGSLLSAIRRTVTPSGTRLLTQWLSAPSMHLDEIKQR 415

Query: 601 LDSVDQLLNEMPIRDLWESSLTGLPDLERLLAR 633
            + V   +    + D   + L    D+ R+L +
Sbjct: 416 QNLVRLFMQNPFVTDNLIAQLKATADMTRILQK 448

>YFL003C (MSH4) [1678] chr6 complement(134516..137152)
            Meiosis-specific protein homologous to E. coli MutS [2637
            bp, 878 aa]
          Length = 878

 Score =  128 bits (322), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 156/715 (21%), Positives = 294/715 (41%), Gaps = 109/715 (15%)

Query: 396  FGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEVVMEKRNLSVIAHKIVKFNSQP 455
             G   I+  TG++ L +F D     ++   +   +P E+++   +L+    K+       
Sbjct: 120  IGLCIINCNTGQMYLSDFMDSQIYIRVVHKLQIYQPTEILIPSSSLAPTVSKLATMIK-- 177

Query: 456  DCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQGKK-----------VG 504
               FN   + +  + +R          F   D   AI K   D  KK             
Sbjct: 178  ---FNVAETVKIEEGSR--------KCFNSQDGLAAITKYLMDDTKKDLKIEEIIDKTFA 226

Query: 505  FSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQ-----TSLVLDGITLQNLEIFANSF 559
              A    +SY++ + + KS  ++     +  L+ Q      ++++D  T++ LE+  N  
Sbjct: 227  LCAASAAISYMEEI-ISKSSRNLN---AFRKLRIQFEGTENTMLIDSKTVRGLELVENKL 282

Query: 560  DGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPIRDLWES 619
            D  +  +L+K ++   T MG+R +R  ++ PL  +  IE RL+++++L     +      
Sbjct: 283  DK-NGISLWKFLDTTSTKMGQRSLRNSILQPLTDRGSIEMRLEALEELKANDDLLQKLRL 341

Query: 620  SLTGLPDLERLLARV----HSGNLPIKDFDKVICGFENIVRLISSLNEYELSGSLSRFLH 675
             +  LPDL++L +R+    HS   P +  + V+   E +  +           SL   L+
Sbjct: 342  EMKSLPDLDKLFSRLLCINHSAIKPDQRINYVLLLKETLQSV----------KSLKDALN 391

Query: 676  DIPSTLKSDVESWTTLYDRNMAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVLSEYK 735
            D    ++S + S T     N A+ E + + N+ +  D   + S ++ L +   AV S+  
Sbjct: 392  D--QLIQSRLISETKKIFNNDAIMEIEKLINSCINEDCVWASSAIQLLNQRSYAVKSDSN 449

Query: 736  RSFKCSKIQYKDSGKELYTIELPISIAKSVPSNWTQLGANKSTKRYYSPKVQK------- 788
                 S+  YK+  +E +       +      N   L  N  + R +  ++++       
Sbjct: 450  GLLDVSRQIYKEVKEEFFR-----EVEDLTAKNKINLDHNYDSARGFYLRIKRQEFTDDV 504

Query: 789  -------LARS-------------------MAEARELHKILEEGLKGRLYQKFDQNFSTT 822
                   ++R+                   + E  E   +L E     L  K   + S  
Sbjct: 505  ATLPDVFISRTIKKNYIECTTLNIIKKNARLKEVMEEILLLSEETVDELLDKIATHISE- 563

Query: 823  WFPTIKAISNIDCILSLARTSESLGFPACRPNFKDEIDPTTGHKLNGYLSFKELRHPCYN 882
             F   +A++ +D + S     +   +    P F +             L  ++ RHP   
Sbjct: 564  LFMIAEAVAILDLVCSFTYNLKENNYTI--PIFTNN------------LLIRDSRHPLLE 609

Query: 883  AGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAE 942
              +     F+PN +   K ++ + ++TG N +GKS  L+   +  IMAQ+G  +P     
Sbjct: 610  KVLKN---FVPNTISSTKHSSSLQIITGCNMSGKSVYLKQVALICIMAQMGSGIPALYGS 666

Query: 943  LSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFA 1002
                 R+  R+  ND++    S F  E+ E    LD     TL++LDELGRG S +DGF 
Sbjct: 667  FPVFKRLHARV-CNDSMELTSSNFGFEMKEMAYFLDDINTETLLILDELGRGSSIADGFC 725

Query: 1003 IAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQM-AILVDEGSKKVTF 1056
            ++  V  H+    ++  F +TH+  + +  +  P V  L M A+L+++ S K+ +
Sbjct: 726  VSLAVTEHL-LRTEATVFLSTHFQDIPKIMSKKPAVSHLHMDAVLLNDNSVKMNY 779

>YHR120W (MSH1) [2408] chr8 (349576..352455) Protein involved in
            mitochondrial DNA repair, homolog of E. coli MutS [2880
            bp, 959 aa]
          Length = 959

 Score =  127 bits (320), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 113/219 (51%), Gaps = 10/219 (4%)

Query: 877  RHPCYNAGVNGAT--EFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGC 934
            RH     G++  +   F  N+  L K    + ++TG N  GKST LR   I VI+AQ+GC
Sbjct: 738  RHLMVEEGLSARSLETFTANNCELAKD--NLWVITGPNMGGKSTFLRQNAIIVILAQIGC 795

Query: 935  YVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRG 994
            +VPC  A +  +D++ +R+G+ D++    STF VE+ ET  IL  AT R+L +LDE+GRG
Sbjct: 796  FVPCSKARVGIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRG 855

Query: 995  GSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAI------LVD 1048
             S  +G +IA   L ++  + Q    FATH+G   +    +   K +   +      + D
Sbjct: 856  TSGKEGISIAYATLKYLLENNQCRTLFATHFGQELKQIIDNKCSKGMSEKVKFYQSGITD 915

Query: 1049 EGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENA 1087
             G     + +KL  G    S  + VA + G P   ++ A
Sbjct: 916  LGGNNFCYNHKLKPGICTKSDAIRVAELAGFPMEALKEA 954

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 93/454 (20%), Positives = 170/454 (37%), Gaps = 69/454 (15%)

Query: 256 DCIVFFKKGKFFELY-EKDAHLANQL-FDLKIAGGGRANMQLAGIPEMSFDYWASQFIQH 313
           D +V  + G F+ELY E+    A +L   L         +  AG P           + +
Sbjct: 95  DHVVLTQMGSFYELYFEQAIRYAPELNISLTNRAYSHGKVPFAGFPVHQLSRHLKMLVNN 154

Query: 314 -GYKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEA 372
            GY V   +Q +    K++ +       R +  +++ GT  D    +  ++TY L+I E 
Sbjct: 155 CGYSVTIAEQFKK---KDVADNEANKFYRRVTRIVTPGTFIDEAFENLRENTYLLNI-EF 210

Query: 373 PLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPK 432
           P         E    +        G  + D +TG I    F        L + + +++PK
Sbjct: 211 P---------ENCMSQVADTSLKVGICWCDVSTGEI----FVQQVYLRDLVSAITRIQPK 257

Query: 433 EVVMEKRNLSV-------------IAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSN 479
           E+++++R L               +    +K+   P     +RT   FY           
Sbjct: 258 EILLDERLLEFHIESGTWYPELVELKKFFIKYQKMPS---QHRTIESFY----------- 303

Query: 480 GGYF--AGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLK 537
            G F   G ++    LK  +    +   +A    L Y+        L    +  +    +
Sbjct: 304 -GLFNLGGKEATERQLKIQFQTFTQKELAALRNTLIYV-----SNHLPDFSINFQIPQRQ 357

Query: 538 AQTSLV-LDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEH 596
             T+++ +D  T   LE+ +   D   KG+L   + R +TP G R +  W+  P L  + 
Sbjct: 358 LATAIMQIDSRTSTALELHSTVRDNNKKGSLLSSIRRTVTPSGTRLLSQWLSGPSLDLKE 417

Query: 597 IEERLDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGFENIVR 656
           I++R   V    +   I +   + L  + DL R+L +   G                 + 
Sbjct: 418 IKKRQKIVAFFKDNRDITETLRTMLKKVNDLSRILQKFSFGR-------------GEALE 464

Query: 657 LISSLNEYELSGSLSRFLHDIPSTLKSDVESWTT 690
           LI      E+S  + ++L +  S +K+ ++S  T
Sbjct: 465 LIQMARSLEVSREIRKYLLNNTSLMKATLKSQIT 498

>Scas_697.27
          Length = 948

 Score =  125 bits (313), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 113/203 (55%), Gaps = 8/203 (3%)

Query: 884  GVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAEL 943
             +N   +F+ ND +L   + ++ ++TG N  GKST LR   I VI+AQ+G +VPC+ A +
Sbjct: 736  AINSLEKFVGNDCNL--ESGKLWVITGPNMGGKSTFLRQNAIIVILAQIGSFVPCDSARI 793

Query: 944  SPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAI 1003
              +D+I +R+G+ D++    STF VE+ ET  IL  AT+R+L +LDE+GRG S  +G +I
Sbjct: 794  GLVDKIFSRVGSADDLYNEMSTFMVEMVETSCILRGATDRSLAILDEIGRGTSGKEGISI 853

Query: 1004 AEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQMAI------LVDEGSKKVTFL 1057
            A   L ++    +    FATH+G   Q   +    +  +  I      +++ G++   + 
Sbjct: 854  AFATLKYLIKRNRCRSLFATHFGQELQVIVNEKDEQEAKDNIEFYQSGIIELGNENFVYD 913

Query: 1058 YKLIEGQSEGSFGMHVAAMCGIP 1080
            +KL  G  + S  + VA   G P
Sbjct: 914  HKLKPGICKSSDAIKVARTAGFP 936

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/386 (20%), Positives = 150/386 (38%), Gaps = 38/386 (9%)

Query: 258 IVFFKKGKFFELYEKDAHLANQLFDLKIAGGGRAN--MQLAGIPEMSFDYWASQFIQ-HG 314
           +V  + G F+ELY + A     + ++ +     A+  +  AG P           +   G
Sbjct: 91  VVLTQIGSFYELYFEQAVKYAPILNISLTNRTYAHGKVPFAGFPVPQLGRHLKILVNDFG 150

Query: 315 YKVAKVDQKESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCLSIHEAPL 374
           Y V   +Q +     ++ E  +    R +  +++ GT  D    +  +++Y LSI     
Sbjct: 151 YNVVIAEQFKK---NDVAENEQYKFIRRVTRIVTPGTFIDEAFENFQENSYLLSIEFPEN 207

Query: 375 ALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMAQVRPKEV 434
            +  +  G+             G ++ D +TG +    F        L + + ++RPKE+
Sbjct: 208 CMKRIALGDLK----------LGLSWCDVSTGEV----FVQQMFLKDLISSITRIRPKEI 253

Query: 435 VMEKRNLSVIAHKIVKFNSQPDCI------FNYRTSAEFYDYARTFDEVSNGGYFAGMDS 488
           ++   N  +  + IV     P+ +       NY+     +    +F ++   G     DS
Sbjct: 254 IL---NEDLYKNNIVSGEWYPELVALKKYFLNYQRMPSQHRTIESFYDLFTSG---NTDS 307

Query: 489 WPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTSLV-LDGI 547
               LK  +    +   +A   +L Y+        L ++    +    +  TS++ +D  
Sbjct: 308 VIRQLKLQFQTFTQKELAALRNILIYI-----SDHLPNISTNLQIPQREITTSIMQIDSR 362

Query: 548 TLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQL 607
           T   LE+ +   + + KGTL   + R ITP G R +  W+  P L  + I  R   V   
Sbjct: 363 TSSALELHSTVRNNSKKGTLLSSIRRTITPSGTRLLTQWLSGPSLDLKEIRNRQKLVSYF 422

Query: 608 LNEMPIRDLWESSLTGLPDLERLLAR 633
           +    I +     L    D+ R+L +
Sbjct: 423 MENPDIMEHIIQILKDTCDITRVLQK 448

>Kwal_33.14738
          Length = 963

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 142/298 (47%), Gaps = 33/298 (11%)

Query: 804  EEGLKGRLYQKFDQNFSTTWFPTIKAISN----IDCILSLARTSESLGFPACRPNFKDEI 859
            E  L   L QKF QN      P++++++     +D + S A  S            K+ +
Sbjct: 678  ETALVNSLKQKFIQNS-----PSVRSVAQTLDYLDILTSFAELSVE----------KNLV 722

Query: 860  DPTTGHKLNGYLSFKELRHPCYNAGVNGAT--EFIPNDVHLGKSTAQIALLTGANAAGKS 917
             P     ++  L  +  RH     G+   +  +F  ND  L   T  + +++G N  GKS
Sbjct: 723  CPVVDTSVS--LDIRGGRHIVVEDGLMSKSLDKFTSNDCSLQGGT--LWVVSGPNMGGKS 778

Query: 918  TILRMTCIAVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKIL 977
            T LR   I VIMAQ+G +VPC  A +  +D+I +R+G+ D++    STF VE+ ET  IL
Sbjct: 779  TFLRQNAIIVIMAQVGSFVPCASARIGLVDKIFSRIGSADDLYNEMSTFMVEMIETSYIL 838

Query: 978  DMATNRTLIVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYG-------TLGQ 1030
              AT R+L +LDE+GRG S  +G +IA   L H+ +  +    FATH+         L  
Sbjct: 839  KGATERSLAILDEIGRGTSGKEGISIAYATLKHLVSRNRCRSLFATHFAKELEQLLNLQS 898

Query: 1031 SFTHHPMVKPLQMAILVDEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAE 1088
            + T    V   +  +  D G    T+ ++L  G    S  + VA+  G P   + +A+
Sbjct: 899  NCTFQRNVSYYKSGV-YDIGKGDYTYNHRLTPGICTKSDAIRVASKAGFPDEALSDAQ 955

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 78/397 (19%), Positives = 157/397 (39%), Gaps = 42/397 (10%)

Query: 253 KMWDCIVFFKKGKFFELYEKDAHLANQLFDLKIAGGG--RANMQLAGIPEMSFDYWASQF 310
           K  D +V  + G F+ELY + A +     +L +         +  AG P           
Sbjct: 96  KYQDYVVLTQMGSFYELYFEHAEIYAPKLNLTLTSREYVHGKVSFAGFPVPQISRHLKVL 155

Query: 311 IQ-HGYKVAKVDQ--KESMLAKEMREGNKGIVERELQCVLSGGTLTDLKMLHSDQSTYCL 367
           ++ +G+ VA  DQ  K+++++ +          R +  +++ GT  D    +  ++T+ L
Sbjct: 156 VKDYGHSVAIADQFKKDNIISNDTSR-----FLRRVTRIVTPGTFIDEAFENLQENTFLL 210

Query: 368 SIHEAPLALYAMERGEAVPPEAQQQGRLFGTAFIDTATGRICLLEFEDDSECTQLDTLMA 427
           S          +E  E    +        G  + D +TG I    F        + + + 
Sbjct: 211 S----------LEFPENCMRKVADIDTKVGLCWCDISTGEI----FVQQVLLKDVVSAIT 256

Query: 428 QVRPKEVVMEKRNLSVIAHKIVKFNSQPDCI------FNYRTSAEFYDYARTFDEVSNGG 481
           ++ P E+++++    ++A KI      P+ +        Y+     +   R+F  + +  
Sbjct: 257 RIAPCEILLDEE---ILAFKIESGEWYPEFVELKKFFIKYQKIPSSHRAIRSFHRLFSPA 313

Query: 482 YFAGMDSWPAILKQYYDQGKKVGFSAFGGLLSYLQWLKLDKSLLSMGMVEEYNPLKAQTS 541
              G  S   I    + Q +    +A    L YL+     + L  M +  +    +  +S
Sbjct: 314 DMEGKFSPFDIALHNFSQKET---AALRNTLLYLE-----EHLPDMEVNLQVPKRQITSS 365

Query: 542 LV-LDGITLQNLEIFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEER 600
           ++ +D  T   LE+ +     T KG+L   + R +TP G R +  W+  P +  + I++R
Sbjct: 366 IMQIDSRTCSALELSSTMRTNTRKGSLLSAIRRTVTPSGSRLLSQWLSAPSMDIKEIKQR 425

Query: 601 LDSVDQLLNEMPIRDLWESSLTGLPDLERLLARVHSG 637
            + V    N   + +    +L    D+ R+L +   G
Sbjct: 426 QELVTLFRNNPTLTESLVRTLKKTYDMPRILQKFSFG 462

>CAGL0I03586g 303943..306546 similar to sp|Q12175 Saccharomyces
            cerevisiae YDL154w MSH5 meiosis-specific protein,
            hypothetical start
          Length = 867

 Score =  115 bits (288), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 32/244 (13%)

Query: 877  RHPCYNAGVNGATEFIPNDVHL-----------GKSTAQIALLTGANAAGKSTILRMTCI 925
            RHP        +  FIPND+ L                +IA++TGANA+GK+  L    +
Sbjct: 563  RHPLLETL---SDNFIPNDIILDGGMLKDINWFSSGRQRIAVVTGANASGKTIFLEQIAL 619

Query: 926  AVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTL 985
             V MA +GCYVP + AE+  +D I+T+  + D+I    S+F  +  +  KI+ +AT R++
Sbjct: 620  IVYMAHIGCYVPADTAEIGLVDMILTKFKSFDSISTSMSSFERDSKQLSKIMSLATKRSI 679

Query: 986  IVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLG----FFATHYGTLGQS---FTHHPMV 1038
            I +DE G+G  +  G ++   ++   S   Q  G      +TH+  + Q      H   +
Sbjct: 680  IFIDEYGKGTDTISGPSLLAAIIQRYS---QLPGAPRLLISTHFYEIFQKSSLLKHRGSI 736

Query: 1039 KPLQMAILVDEG--------SKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENAERA 1090
            K L   I+++          ++ + F Y+++EG  + S G++ A +CGI + ++  AE  
Sbjct: 737  KFLTTKIVLNNCEVENLVTENEGIVFFYQIVEGICDSSLGIYCAKICGIKKEIINMAELV 796

Query: 1091 AESF 1094
             + F
Sbjct: 797  HKQF 800

>YDL154W (MSH5) [716] chr4 (178335..181040) Meiosis-specific protein
            involved in reciprocal recombination, not involved in
            mismatch repair [2706 bp, 901 aa]
          Length = 901

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 125/241 (51%), Gaps = 32/241 (13%)

Query: 877  RHPCYNAGVNGATEFIPNDVHLG-----------KSTAQIALLTGANAAGKSTILRMTCI 925
            RH  Y   ++    +IPN   +            ++  +I ++TGANA+GKS  L    +
Sbjct: 602  RHALYETFLDN---YIPNSTMIDGGLFSELSWCEQNKGRIIVVTGANASGKSVYLTQNGL 658

Query: 926  AVIMAQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTL 985
             V +AQ+GC+VP E A +   D+I+TR+   + + + +S+F ++  +  K L +AT ++L
Sbjct: 659  IVYLAQIGCFVPAERARIGIADKILTRIRTQETVYKTQSSFLLDSQQMAKSLSLATEKSL 718

Query: 986  IVLDELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFA-THYGTLGQSFTHHPMVKPLQ-- 1042
            I++DE G+G    DG ++   ++ ++S   +     A TH+  L         +K ++  
Sbjct: 719  ILIDEYGKGTDILDGPSLFGSIMLNMSKSEKCPRIIACTHFHELFNENVLTENIKGIKHY 778

Query: 1043 -MAILV--------------DEGSKKVTFLYKLIEGQSEGSFGMHVAAMCGIPRSVVENA 1087
               IL+              D  S+ +TFL+K+ EG S+ SFG++ A +CG+ R +VE A
Sbjct: 779  CTDILISQKYNLLETAHVGEDHESEGITFLFKVKEGISKQSFGIYCAKVCGLSRDIVERA 838

Query: 1088 E 1088
            E
Sbjct: 839  E 839

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 96/213 (45%), Gaps = 26/213 (12%)

Query: 542 LVLDGITLQNLEIFANSFD-GTDKG------TLFKLVNRAITPMGKRQMRTWVMHPLLRK 594
           +VLD  T+  L IF  +   G DK       ++F+L N+  +   +R +++W+++PL  K
Sbjct: 247 MVLDENTISALHIFPTAHKLGHDKMMRNGFFSVFELFNQVSSDYARRILKSWLINPLTNK 306

Query: 595 EHIEERLDSVDQLL---NEMPIRDLWESSLTGLPDLERLLARVHSGNLPIKDFDKVICGF 651
           + IE R   +  LL   N +   DL   S+   PD    + ++ SG   +  + KV    
Sbjct: 307 KRIETRYSIIRTLLDKQNAIIFSDL-SQSIKRCPDAFGFINQLRSGKSTLGTWSKVASFL 365

Query: 652 EN---IVRLISSLNEYELSGSLSRFLHDIP-----STLKSDVESWTTLYDRNMAVSEGKV 703
           E    I +L+SSL   +L    +  LHDI      S LK  +    T+ D + +     +
Sbjct: 366 EKGIAIFQLVSSL---KLGSDEANILHDIKNKVDISALKECLRKVETVIDFDTSRDTKTL 422

Query: 704 VPNAGVEPDFDVSLSKMRALEEELDAVLSEYKR 736
             N GV    D  L + R +   L+ +L +  R
Sbjct: 423 TINTGV----DNRLDECRNIYNHLEGILLDVAR 451

>Scas_707.28
          Length = 881

 Score =  108 bits (270), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 121/534 (22%), Positives = 232/534 (43%), Gaps = 58/534 (10%)

Query: 538  AQTSLVLDGITLQNLEIFANSFDGTDKGTLF-KLVNRAITPMGKRQMRTWVMHPLLRKEH 596
             + ++++D  T+  LE+  N  D   +G  F K +N   T MG+R +R  ++ PL  ++ 
Sbjct: 263  TENTMLIDPKTINGLELVENIIDK--RGMSFWKFLNTTCTKMGERSLRNNILQPLTDEKS 320

Query: 597  IEERLDSVDQLLNEMPIRDLWESSLTGLPDLER----LLARVHSGNLPIKDFDKVICGFE 652
            I  R ++V +L  +  + +     +    DL+R    LL+  H+     +  + VI   +
Sbjct: 321  IIMRQEAVKELQGDEKLLEQLRKHMKVYQDLDRIFVKLLSVNHNAIKAEQKINYVILLKD 380

Query: 653  NIV----------------RLISSLNEYELSGSLSRFLHDIPSTLKSD-VESWTTLYDRN 695
            +++                RL+  + +   + S++     I   +  D + + + L  +N
Sbjct: 381  SLITTQRLKAILEPIEFESRLLQEVKKIFFNESITEIEQCINKYINEDCIWASSNLELKN 440

Query: 696  MAVSEGKVVPNAGVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTI 755
                      N+ +E    +  + M  + EE++ +  E+      S     DS +  + +
Sbjct: 441  QQTYAVNDSANSLLEISRQLYKNLMNDIMEEIEGLSKEFDLPLDYSF----DSNRGFF-L 495

Query: 756  ELP---ISIAKSVPSNWTQLGANKSTKRYYSPKVQKLARSMAEA-RELHKILEEGLKGRL 811
            ++    I+   S+P+ +    + K+     +  + K+   + E   E+  I E+ +   L
Sbjct: 496  KIKKGEINDLNSLPNEFINKISKKNFIECCTLNIMKMNVRLKEIILEISSISEQVVLELL 555

Query: 812  YQKFDQNFSTTWFPTIKAISNIDCILSLARTS--ESLGFPACRPNFKDEIDPTTGHKLNG 869
             +     + +  F   +A+S +D + S A  S  E+  FP                K + 
Sbjct: 556  NEVV--KYLSILFMISEAVSILDLLCSFAFKSFKENYCFP----------------KFST 597

Query: 870  YLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIM 929
             L  ++ RHP     + G   F+PND+   K+++ + ++TG N +GKS  L+   +  IM
Sbjct: 598  NLFLRQSRHPILETLIKG---FVPNDIVSTKTSSAVQIITGCNRSGKSVYLKQLPLLCIM 654

Query: 930  AQLGCYVPCEDAELSPMDRIMTRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLD 989
            +Q+G  VP E A +    ++  R+  ND +    STF  E+ E    LD     TL+++D
Sbjct: 655  SQIGSPVPAESAIVPIYKKVHARV-CNDTMEMNSSTFSFEMKEMAYFLDDTDQDTLLIID 713

Query: 990  ELGRGGSSSDGFAIAEGVLHHISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQM 1043
            ELGRG S  DGF+I+  +  H+    +     +TH+  +       P V  L M
Sbjct: 714  ELGRGSSIGDGFSISLAITEHL-IGTKGTVLLSTHFEAIPSILVTRPNVLHLHM 766

>CAGL0F02167g complement(216080..218767) similar to sp|P40965
            Saccharomyces cerevisiae YFL003c MSH4 meiosis-specific
            protein, start by similarity
          Length = 895

 Score =  103 bits (257), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 89/153 (58%), Gaps = 2/153 (1%)

Query: 891  FIPNDVHLGKSTAQIALLTGANAAGKSTILRMTCIAVIMAQLGCYVPCEDAELSPMDRIM 950
            +I ND+     ++++ ++TGAN  GK+  LR   +  IMAQ+G  +P E+A L   + I 
Sbjct: 627  YIRNDISSTLYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPVYENIH 686

Query: 951  TRLGANDNIMQGKSTFFVELSETRKILDMATNRTLIVLDELGRGGSSSDGFAIAEGVLHH 1010
            TRL  ND++    S F  E+ E   IL+     +LI++DELGRG S  DGFAI+  +L++
Sbjct: 687  TRL-CNDSMEMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISLAILNY 745

Query: 1011 ISTHVQSLGFFATHYGTLGQSFTHHPMVKPLQM 1043
            +S  ++S  F +TH+  +     + P ++ L M
Sbjct: 746  LS-KLESTTFISTHFDVIPMILKNKPSIRHLHM 777

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/261 (24%), Positives = 107/261 (40%), Gaps = 40/261 (15%)

Query: 396 FGTAFIDTATGRICLLEFEDDS------------ECTQLDTLMAQVRP---KEVVMEKRN 440
            G + I+ +TG I L E+ D              E T +      VRP   K   + K N
Sbjct: 127 IGISLINFSTGEIILTEYVDSQLFIRTMNKIQLYEPTDILIPCHSVRPHMSKLATILKLN 186

Query: 441 LSVIAHKIVKFNSQPDCIFNYRTSAEFYDYARTFDEVSNGGYFAGMDSWPAILKQYYDQG 500
              I H+I    ++  C +N R S EF                   D    +L + Y+  
Sbjct: 187 ---INHEIKIHIAKSSC-YNNRRSIEFIK----------ASSINKADGIQILLAKLYE-- 230

Query: 501 KKVGFSAFGGLLSYLQWLKLDKSLL--SMGMVEEYNPLKA-----QTSLVLDGITLQNLE 553
           K+    +      +LQ     K L      ++ +Y+  +      + +L++D  T+ NLE
Sbjct: 231 KRHCLFSLAAATEFLQSKNSVKGLTPKKNKVLSDYSRFRIRYEAIENTLLIDSKTVTNLE 290

Query: 554 IFANSFDGTDKGTLFKLVNRAITPMGKRQMRTWVMHPLLRKEHIEERLDSVDQLLNEMPI 613
           +   + +G +K +LF  +N   T MG R +R  ++ PL     I  RL SV++ L E   
Sbjct: 291 LI-RTLEGDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGITNRLKSVEE-LTECEF 348

Query: 614 RDLWESSLTGLPDLERLLARV 634
            +     L  LPDL+ + +++
Sbjct: 349 LNGIRLVLRQLPDLDIVFSKL 369

>Scas_504.1
          Length = 3076

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 81/183 (44%), Gaps = 29/183 (15%)

Query: 597 IEERLDSVD---QLLNEMPIRDLWESSLTG-----LPDLERLLARVHSGNLPIKDFDKVI 648
           +++R+ +V    Q LN +P+ DL+  +L       LP +E  L R+ +   PIK F  ++
Sbjct: 225 LKQRIRTVQDDLQFLNSIPLNDLYSCTLPNQLLELLPRIEVALKRIKTKPYPIKQFLTLL 284

Query: 649 CGFE-NIVRLISSLNEYELSGSLSRFLHDIPSTLKSDVESW-TTLYDRNMAVSE------ 700
                +I++ + S +    S   S FL  I  T  S +  W  ++YD  + + E      
Sbjct: 285 QKVTVDIIKKMKSFSHNIFSSPYSDFLSLI-ETDNSILSKWEESIYDCLLLLRELSRKSS 343

Query: 701 -GKVVPNA---GVEPDFDVSLSKMRALEEELDAVLSEYKRSFKCSKIQYKDSGKELYTIE 756
               +P+     +EP     LS +R+  EE      + K +    KI Y +  ++L  I 
Sbjct: 344 INIAIPSPTSFTIEP--KELLSHIRSFREE------QNKFAMSLKKINYSNYKEDLEHIY 395

Query: 757 LPI 759
            PI
Sbjct: 396 DPI 398

>YBR002C (RER2) [195] chr2 complement(241672..242532)
           Cis-prenyltransferase (dehydrodolichyl diphosphate
           synthetase), involved in dolichol synthesis [861 bp, 286
           aa]
          Length = 286

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 856 KDEIDPTTGHKLNGYLSFKELRHPCYNAGVNGATEFIPNDVHLGKSTAQI-ALLTGA 911
           K E+D   GH+  G++S   +   CY AGV+ AT F  +  +  +S+ ++ +L+T A
Sbjct: 48  KKEMDVKEGHE-AGFVSMSRILELCYEAGVDTATVFAFSIENFKRSSREVESLMTLA 103

>YDR522C (SPS2) [1334] chr4 complement(1483783..1485291) Protein
           involved in middle/late stage of sporulation, expressed
           only during sporulation [1509 bp, 502 aa]
          Length = 502

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 6/67 (8%)

Query: 38  TSPAAGAEPQRGAAVETSTPCKAEQLQLFVEDASDEGETTFVTAHD-DGAVKEEGATQVD 96
           TSP AG    RG  +E ++  K++ L     +  +EG        D D   KE+G     
Sbjct: 411 TSPKAGRSIIRGGKIECTSGMKSKML-----NVDEEGNVLGKQETDNDNGKKEKGKNGAK 465

Query: 97  SQGSARR 103
           SQGS+++
Sbjct: 466 SQGSSKK 472

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,657,676
Number of extensions: 1591572
Number of successful extensions: 5199
Number of sequences better than 10.0: 53
Number of HSP's gapped: 5268
Number of HSP's successfully gapped: 83
Length of query: 1146
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1033
Effective length of database: 12,684,275
Effective search space: 13102856075
Effective search space used: 13102856075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)