Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR115C2512319861e-136
KLLA0C17754g2272016082e-79
CAGL0L11902g2512025876e-76
Scas_681.182482045469e-70
YER170W (ADK2)2251945361e-68
Kwal_56.234892252015171e-65
CAGL0K11418g2221852831e-30
KLLA0F13376g2271812812e-30
YDR226W (ADK1)2221812786e-30
Scas_721.822211852752e-29
Sklu_2123.22281852657e-28
AGR187W2771812661e-27
Kwal_27.116072271852482e-25
ACR170C2892041317e-09
KLLA0E08030g3021811282e-08
Sklu_2380.52892051221e-07
Scas_685.92001951156e-07
CAGL0L09867g2602061104e-06
Kwal_14.8682822041061e-05
Kwal_14.253723740670.97
ACR020C100252652.6
YJR059W (PTK2)818105653.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR115C
         (247 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH] (959464..96...   384   e-136
KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces...   238   2e-79
CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces...   230   6e-76
Scas_681.18                                                           214   9e-70
YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase (GT...   211   1e-68
Kwal_56.23489                                                         203   1e-65
CAGL0K11418g complement(1109653..1110321) highly similar to sp|P...   113   1e-30
KLLA0F13376g 1234589..1235272 highly similar to sp|P07170 Saccha...   112   2e-30
YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase (GT...   111   6e-30
Scas_721.82                                                           110   2e-29
Sklu_2123.2 YDR226W, Contig c2123 4210-4896                           106   7e-28
AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH] complement(...   107   1e-27
Kwal_27.11607                                                         100   2e-25
ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH] (653511..65...    55   7e-09
KLLA0E08030g complement(724562..725470) some similarities with s...    54   2e-08
Sklu_2380.5 YKL024C, Contig c2380 11212-12081                          52   1e-07
Scas_685.9                                                             49   6e-07
CAGL0L09867g 1054344..1055126 some similarities with sp|P15700 S...    47   4e-06
Kwal_14.868                                                            45   1e-05
Kwal_14.2537                                                           30   0.97 
ACR020C [1068] [Homologous to ScYEL055C (POL5) - SH] (391573..39...    30   2.6  
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    30   3.0  

>AGR115C [4426] [Homologous to ScYER170W (ADK2) - SH]
           (959464..960219) [756 bp, 251 aa]
          Length = 251

 Score =  384 bits (986), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 196/231 (84%), Positives = 196/231 (84%)

Query: 17  PPGVGQSVMXXXXXXXXXXXXXXXXXXXTQMGRLLQRFPGLQAVASGDLLRREIAAGSPL 76
           PPGVGQSVM                   TQMGRLLQRFPGLQAVASGDLLRREIAAGSPL
Sbjct: 17  PPGVGQSVMAGAGAIRLLLLGAPGAGKGTQMGRLLQRFPGLQAVASGDLLRREIAAGSPL 76

Query: 77  GEQAAAHIAAGRLLPDALVSSAILDELARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXX 136
           GEQAAAHIAAGRLLPDALVSSAILDELARRRWLHGGASWLLDGFPRTV            
Sbjct: 77  GEQAAAHIAAGRLLPDALVSSAILDELARRRWLHGGASWLLDGFPRTVAQAQELDAALER 136

Query: 137 XXXXLTLVVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPD 196
               LTLVVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPD
Sbjct: 137 ADAALTLVVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPD 196

Query: 197 DTPEVFYKRMQEYAATAGPLKEHYARQGILRTVRGPTSDIVFPQLERLVQA 247
           DTPEVFYKRMQEYAATAGPLKEHYARQGILRTVRGPTSDIVFPQLERLVQA
Sbjct: 197 DTPEVFYKRMQEYAATAGPLKEHYARQGILRTVRGPTSDIVFPQLERLVQA 247

>KLLA0C17754g 1576357..1577040 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w ADK2 adenylate kinase, mitochondrial,
           start by similarity
          Length = 227

 Score =  238 bits (608), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 145/201 (72%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ  +LL+ F  ++A++SGDLLR++I  G+PLG  A+++I  G+LLPD L++  + DEL 
Sbjct: 21  TQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLITGVVCDELK 80

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
            R WL+  A+WLLDGFPRTV                L LVVE+ VP +VIL+RI+ R+VH
Sbjct: 81  SRGWLNPNATWLLDGFPRTVGQAEVLDKSLLEHDASLNLVVELDVPHEVILERIENRYVH 140

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
           VPSGRVYNL YNPP   G+DD+TGEPL++RPDDT EVF KR+++Y  T  PLKEHY +QG
Sbjct: 141 VPSGRVYNLQYNPPKVDGKDDITGEPLTKRPDDTAEVFGKRLEQYNKTVTPLKEHYLKQG 200

Query: 225 ILRTVRGPTSDIVFPQLERLV 245
           IL T+ G TSDI++P+L  L+
Sbjct: 201 ILSTISGNTSDIIYPKLVSLI 221

>CAGL0L11902g 1276048..1276803 similar to sp|P26364 Saccharomyces
           cerevisiae YER170w KAD2, hypothetical start
          Length = 251

 Score =  230 bits (587), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 143/202 (70%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ  +LL+  P L++V+SGD+LR E+ +G+ LG  AA +IA G+L+PD +++  ++  L+
Sbjct: 23  TQTSKLLKVLPELKSVSSGDILRHELKSGTELGVLAAKYIAQGKLIPDKVITQVLIAHLS 82

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
           + +WL+  +SWLLDGFPRT                 L LVVE+ VPE+VIL+RI  R++H
Sbjct: 83  KEKWLNPQSSWLLDGFPRTERQAFSLDSTLGENNAKLNLVVELDVPEEVILERIDNRYIH 142

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
           V SGRVYNL YNPP  AG+DDVTGEPL +R DD  +VF KRM+EY  T GP+KEHYA+QG
Sbjct: 143 VGSGRVYNLQYNPPKVAGKDDVTGEPLVKRSDDNVQVFKKRMKEYKKTLGPIKEHYAKQG 202

Query: 225 ILRTVRGPTSDIVFPQLERLVQ 246
           IL T+ G TSDI+FP+L  L+ 
Sbjct: 203 ILATISGDTSDIIFPKLCALIN 224

>Scas_681.18
          Length = 248

 Score =  214 bits (546), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 98/204 (48%), Positives = 139/204 (68%), Gaps = 2/204 (0%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ+ RL+Q  P +  ++SGD+LR+EI A + LG+ A+  IA G+L+PD L+   ++ +L 
Sbjct: 22  TQISRLIQLLPTVNRISSGDILRQEIQAETKLGQLASQFIAQGKLIPDDLIDKLLISKLQ 81

Query: 105 RRRWLHG--GASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRF 162
            + WL G   +SW+LDGFPRT+                L LVVE+ VP +VIL+RI+ R+
Sbjct: 82  EQNWLAGRSKSSWVLDGFPRTITQAQKFDETLDKYNKNLNLVVELDVPTEVILERIENRY 141

Query: 163 VHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYAR 222
           VH+PSGR+YNL +NPP   G+DD+TGEPL +R DD+   F KR+QEY  T GPLKE+Y  
Sbjct: 142 VHIPSGRIYNLQFNPPRVPGKDDITGEPLVKRSDDSAATFKKRLQEYHETLGPLKEYYQS 201

Query: 223 QGILRTVRGPTSDIVFPQLERLVQ 246
           QG+L+T+ G TSDI+FP+L  ++ 
Sbjct: 202 QGLLQTISGETSDIIFPKLLNMIH 225

>YER170W (ADK2) [1598] chr5 (525969..526646) Adenylate kinase
           (GTP:AMP phosphotransferase), mitochondrial [678 bp, 225
           aa]
          Length = 225

 Score =  211 bits (536), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 102/194 (52%), Positives = 129/194 (66%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ  RLL++ P L +++SGD+LR+EI + S LG +A  +IA G+LLPD L++  I   L+
Sbjct: 29  TQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLS 88

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
              WL   A WLLDGFPRT                 L LVVE+ VPE  IL+RI+ R+VH
Sbjct: 89  ALGWLKPSAMWLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVH 148

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
           VPSGRVYNL YNPP   G DD+TGEPL++R DDT EVF KR++EY  T  PLK++Y + G
Sbjct: 149 VPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSG 208

Query: 225 ILRTVRGPTSDIVF 238
           I  TV G TSDI+F
Sbjct: 209 IFGTVSGETSDIIF 222

>Kwal_56.23489
          Length = 225

 Score =  203 bits (517), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 138/201 (68%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ  +LL  F  +++++SGDLLR+EI   + LG  A+ +I+ G+LLPD+LV+  + +EL 
Sbjct: 18  TQTSKLLSHFKYIRSISSGDLLRQEIQKKTHLGSLASEYISQGKLLPDSLVTELVTNELT 77

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
            R  L   +S+LLDGFPRT+                L LVVE+ VP  VIL+RI+ R+VH
Sbjct: 78  ARGLLSSDSSFLLDGFPRTLDQAKSLRSKLAPHGSPLNLVVELDVPSSVILERIENRYVH 137

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
           VPSGRVYNL YNPP  AG+DDVTGEPL++RPDDT EVF KR++ YA T  PLK+ YA  G
Sbjct: 138 VPSGRVYNLTYNPPLVAGKDDVTGEPLTKRPDDTAEVFGKRLENYAQTVEPLKQFYADLG 197

Query: 225 ILRTVRGPTSDIVFPQLERLV 245
           IL  V G TSDI+FPQL  LV
Sbjct: 198 ILHKVSGETSDIIFPQLLDLV 218

>CAGL0K11418g complement(1109653..1110321) highly similar to
           sp|P07170 Saccharomyces cerevisiae YDR226w ADK1
           adenylate kinase, start by similarity
          Length = 222

 Score =  113 bits (283), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 98/185 (52%), Gaps = 3/185 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L++RF     +A+GD+LR +I+ G+ LG QA   +  G L+ D ++ + I DEL 
Sbjct: 21  TQAPNLVERFHAAH-LATGDMLRSQISKGTELGLQAKKIMDQGGLVSDDIMVNMIKDELT 79

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   VE+ + +++++ RI  R +H
Sbjct: 80  NNPACKNG--FILDGFPRTIPQAEKLDNMLKERGTPLEKAVELKIDDELLVARITGRLIH 137

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP E  +DDVTGEPL +R DD  +   KR+  Y     P+ + Y + G
Sbjct: 138 PASGRSYHKLFNPPKEDMKDDVTGEPLVQRSDDNEDALKKRLGAYHDQTEPIVDFYKKTG 197

Query: 225 ILRTV 229
           I   V
Sbjct: 198 IWADV 202

>KLLA0F13376g 1234589..1235272 highly similar to sp|P07170
           Saccharomyces cerevisiae YDR226w ADK1 adenylate kinase,
           cytosolic, start by similarity
          Length = 227

 Score =  112 bits (281), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 3/181 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L +RF     +A+GD+LR ++A  +PLG +A   +  G+L+ D ++ + I DEL 
Sbjct: 26  TQAPNLTERFCACH-LATGDMLRSQVAKQTPLGIEAKKIMDDGKLVSDEIMINMIKDELT 84

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
             +    G  ++LDGFPRT+                L   VE+ + +++++ RI  R VH
Sbjct: 85  NNQDCKKG--FILDGFPRTIPQAEKLDEMLAQQGRPLEKAVELKIDDELLVSRITGRLVH 142

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP    +DD+TGE L +R DD  E   KR+  Y     P+ + Y + G
Sbjct: 143 PASGRSYHKVFNPPKTEMKDDITGEDLVQRSDDNVEALKKRLTSYHKQTEPIVDFYKKTG 202

Query: 225 I 225
           I
Sbjct: 203 I 203

>YDR226W (ADK1) [1062] chr4 (916478..917146) Adenylate kinase
           (GTP:AMP phosphotransferase), cytoplasmic and
           mitochondrial [669 bp, 222 aa]
          Length = 222

 Score =  111 bits (278), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 96/181 (53%), Gaps = 3/181 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L +RF     +A+GD+LR +IA G+ LG +A   +  G L+ D ++ + I DEL 
Sbjct: 21  TQAPNLQERFHAAH-LATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELT 79

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   +E+ V +++++ RI  R +H
Sbjct: 80  NNPACKNG--FILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIH 137

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP E  +DDVTGE L +R DD  +   KR+  Y A   P+ + Y + G
Sbjct: 138 PASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTG 197

Query: 225 I 225
           I
Sbjct: 198 I 198

>Scas_721.82
          Length = 221

 Score =  110 bits (275), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/185 (34%), Positives = 97/185 (52%), Gaps = 3/185 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L+++F     +++GD+LR +IA  + LG++A   +  G L+ D ++ + I DEL 
Sbjct: 20  TQAPNLVEKFHACH-LSTGDMLRSQIAKNTELGQEAKKIMDQGGLVSDEIMVNMIKDELT 78

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   VE+ V +D+++ RI  R +H
Sbjct: 79  NNPACKNG--FILDGFPRTIPQAEKLDQMLAERGTPLQRAVELQVDDDLLVARITGRLIH 136

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP     DDVTGEPL +R DD  +   KR+  Y A   P+ + Y + G
Sbjct: 137 PASGRSYHKLFNPPKVDMVDDVTGEPLIQRSDDNADALKKRLAGYHAQTEPIVDFYKKTG 196

Query: 225 ILRTV 229
           I   V
Sbjct: 197 IWSGV 201

>Sklu_2123.2 YDR226W, Contig c2123 4210-4896
          Length = 228

 Score =  106 bits (265), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 62/185 (33%), Positives = 96/185 (51%), Gaps = 3/185 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L +RF     +A+GD+LR ++A  + LG +A   +  G L+ D ++ + I +ELA
Sbjct: 27  TQAPNLKERFCACH-LATGDMLRSQVAKKTALGLEAKKIMDQGGLVSDDIMVNMIKEELA 85

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   +E+ + +++++ RI  R VH
Sbjct: 86  TNPECKNG--FILDGFPRTIPQAEKLDEMLAEQGKPLERAIELKIDDELLVARITGRLVH 143

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP    +DDVTGEPL +R DD  +   KR+  Y     P+ + Y + G
Sbjct: 144 PASGRSYHKLFNPPKVDMKDDVTGEPLVQRSDDNADALKKRLNAYHQQTEPIVDFYKKTG 203

Query: 225 ILRTV 229
           I   V
Sbjct: 204 IWSGV 208

>AGR187W [4498] [Homologous to ScYDR226W (ADK1) - SH]
           complement(1102660..1103493) [834 bp, 277 aa]
          Length = 277

 Score =  107 bits (266), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 97/181 (53%), Gaps = 3/181 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ  +L ++F  +  +A+GD+LR ++A  + LG QA   +  G L+ D ++ + I DEL 
Sbjct: 77  TQAPKLKEKF-CVCHLATGDMLRSQVAKQTALGVQAKKIMDQGGLVSDEIMVNMIKDELR 135

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   VE+ + +++++ RI  R VH
Sbjct: 136 SNPECANG--FILDGFPRTIPQAQKLDEMLVAQGKPLDRAVELKIDDELLVARITGRLVH 193

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP  A  DDVTG+PL +R DD  +   KR+  Y A   P+ + Y + G
Sbjct: 194 PASGRSYHKLFNPPKVAMTDDVTGDPLVQRSDDNADALKKRLDAYHAQTEPIVDFYKKTG 253

Query: 225 I 225
           I
Sbjct: 254 I 254

>Kwal_27.11607
          Length = 227

 Score =  100 bits (248), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 92/185 (49%), Gaps = 3/185 (1%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSSAILDELA 104
           TQ   L +RF     +A+GD+LR ++A  + LG +A   +  G L+ D ++   I  EL 
Sbjct: 26  TQAPNLKERFCACH-LATGDMLRSQVAQKTELGLEAKKIMDQGGLVSDDIMVKMIKHELI 84

Query: 105 RRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFVH 164
                  G  ++LDGFPRT+                L   +E+ + +++++ RI  R VH
Sbjct: 85  TNPECKSG--FILDGFPRTIPQAEKLDQMLTEQGRPLEKAIELKIDDELLVSRITGRLVH 142

Query: 165 VPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQG 224
             SGR Y+  +NPP +   DDVTGE L +R DD  +   KR+  Y     P+ + Y + G
Sbjct: 143 PASGRSYHKIFNPPKKEMTDDVTGEALVQRSDDNADALKKRLGAYHQQTEPIVDFYKKTG 202

Query: 225 ILRTV 229
           I   V
Sbjct: 203 IWSGV 207

>ACR170C [1217] [Homologous to ScYKL024C (URA6) - SH]
           (653511..654380) [870 bp, 289 aa]
          Length = 289

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 84/204 (41%), Gaps = 35/204 (17%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIAA-GSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ  RL++R   +  V +GDLLR E    GS  GE    HI  G ++P   V+ A+L   
Sbjct: 113 TQCSRLVERMQFVH-VGAGDLLRDEQNRPGSQYGELIKHHIKEGLIVPQE-VTVALLRRA 170

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
               +  G   +L+DGFPR +                   V+    PE V+L+R+     
Sbjct: 171 IEEHYRAGRRKFLVDGFPRKMDQAFTFEKTVVPS----KFVLFFDCPERVMLERL----- 221

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
                                 +T    S R DD  E   KR + Y  T+ P+ EH+A+Q
Sbjct: 222 ----------------------LTRGQTSGRSDDNIESIKKRFRTYVETSMPVVEHFAQQ 259

Query: 224 -GILRTVRGPTSDIVFPQLERLVQ 246
             ++R       + V+ Q+E  V+
Sbjct: 260 DKVVRLSCDQPVEEVYKQVEAAVK 283

>KLLA0E08030g complement(724562..725470) some similarities with
           sp|P15700 Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase singleton, hypothetical
           start
          Length = 302

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 75/181 (41%), Gaps = 34/181 (18%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ  +L++ F G   +++GDLLR E A  GS  GE     I  G ++P   V+ A+L   
Sbjct: 127 TQCAKLVKDF-GFVHLSAGDLLRAEQAREGSQYGELIKKCIKDGEIVPQE-VTVALLKNA 184

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
               +      +L+DGFPR +                 T+ +    PE ++L+R+ +R  
Sbjct: 185 ITSNYNSSNKKFLVDGFPRKMDQAITFEEEIVPS----TMTLFFDCPEKIMLERLLQR-- 238

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
              SGR+                         DD  E   KR + +  T+ P+ E++ +Q
Sbjct: 239 GKTSGRI-------------------------DDNIESIQKRFKTFVETSVPVVEYFEKQ 273

Query: 224 G 224
            
Sbjct: 274 N 274

>Sklu_2380.5 YKL024C, Contig c2380 11212-12081
          Length = 289

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 86/205 (41%), Gaps = 35/205 (17%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ  +L++ + G   +++GDLLR E    GS  G     +I  G ++P   V+ A+L   
Sbjct: 114 TQCTKLVKDY-GFVHLSAGDLLRAEQNRKGSEYGALIKHYIKEGLIVPQE-VTVALLQNA 171

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
            R  +  G   +L+DGFPR +                L        PE V+L+R+ +R  
Sbjct: 172 IRENFEDGKKRFLVDGFPRKMDQAITFEKQIVPSKFTLFF----DCPETVMLERLLER-- 225

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
               G+                      S R DD  E   KR + +  T+ P+ E++ +Q
Sbjct: 226 ----GKT---------------------SGRTDDNIESIKKRFRTFIETSMPVVEYFEKQ 260

Query: 224 G-ILRTVRGPTSDIVFPQLERLVQA 247
             +++       D V+ +++  V+A
Sbjct: 261 NKVIKVSCDQPIDEVYKKVQTAVEA 285

>Scas_685.9
          Length = 200

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 78/195 (40%), Gaps = 36/195 (18%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ  +L+  + G   +++GDLLR E    GS  G     +I  G ++P   ++ A+L   
Sbjct: 26  TQCAKLVADY-GFVHLSAGDLLRAEQNREGSEFGTLIKHYITEGLIVPQE-ITLALLKNA 83

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
            +  +  G   +L+DGFPR +                L        PEDV+L+R+  R  
Sbjct: 84  IQENYDKGMKKFLVDGFPRKMDQALSFEEQIVPSKFILFF----DCPEDVMLERLLDR-- 137

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
              SGRV                         DD  E   KR + +  T+ P+ +++  Q
Sbjct: 138 GKTSGRV-------------------------DDNIESIKKRFKTFEETSMPVVKYFEDQ 172

Query: 224 GILRTVR--GPTSDI 236
             +  +R   P  D+
Sbjct: 173 HKVIKIRCDSPVDDV 187

>CAGL0L09867g 1054344..1055126 some similarities with sp|P15700
           Saccharomyces cerevisiae YKL024c URA6
           uridine-monophosphate kinase, hypothetical start
          Length = 260

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 86/206 (41%), Gaps = 37/206 (17%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ  +L+  +  +  +++GDLLR E    GS  GE    +I  G ++P  +  S +L + 
Sbjct: 85  TQCAKLVNDYKFVH-LSAGDLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLS-LLQKA 142

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
            +  +      +L+DGFPR +                 TL  E   PE V+L+R+ +R  
Sbjct: 143 IKENYEKNYTKFLVDGFPRKM--DQALSFEKQIVPSKFTLFFE--CPEQVMLERLLER-- 196

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
               G+                      S R DD  E   KR + +  T+ P+  ++  Q
Sbjct: 197 ----GKT---------------------SGRADDNIESIKKRFRTFEETSMPVVRYFDSQ 231

Query: 224 GILRTVRG--PTSDIVFPQLERLVQA 247
             +  VR   P  D V+ Q+++ + A
Sbjct: 232 DKVVKVRCDHPVED-VYNQVKQALTA 256

>Kwal_14.868
          Length = 282

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 85/204 (41%), Gaps = 35/204 (17%)

Query: 45  TQMGRLLQRFPGLQAVASGDLLRREIA-AGSPLGEQAAAHIAAGRLLPDALVSSAILDEL 103
           TQ   L++ +  +  +++GDLLR E    GS  G     +I  G ++P   V+ A+L + 
Sbjct: 108 TQCANLVRDYQFVH-LSAGDLLRAEQNREGSKYGALIKHYIKEGLIVPQE-VTVALLQQA 165

Query: 104 ARRRWLHGGASWLLDGFPRTVXXXXXXXXXXXXXXXXLTLVVEVAVPEDVILDRIQKRFV 163
            +  +  G   +L+DGFPR +                L        PE V+L R+ +R  
Sbjct: 166 IQDNYDQGHKRFLVDGFPRKMDQAITFEEQIVPSKFTLFF----DCPEKVMLQRLLER-- 219

Query: 164 HVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDDTPEVFYKRMQEYAATAGPLKEHYARQ 223
               G+                      S R DD  E   KR + +  T+ P+ E++ +Q
Sbjct: 220 ----GKT---------------------SGRSDDNVESIKKRFKTFIETSMPVVEYFEKQ 254

Query: 224 GILRTVRGPTS-DIVFPQLERLVQ 246
             + +V    S + V+ Q++  V+
Sbjct: 255 DKVVSVSCDHSVEKVYEQVKAAVK 278

>Kwal_14.2537
          Length = 237

 Score = 30.4 bits (67), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 3/40 (7%)

Query: 144 VVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGR 183
           +++VA   + ++D+IQK    VP GR +NL++N   + G+
Sbjct: 201 IIQVATTAEEVIDKIQKYV--VPDGR-FNLNWNDEHKGGK 237

>ACR020C [1068] [Homologous to ScYEL055C (POL5) - SH]
           (391573..394581) [3009 bp, 1002 aa]
          Length = 1002

 Score = 29.6 bits (65), Expect = 2.6,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 26/52 (50%)

Query: 46  QMGRLLQRFPGLQAVASGDLLRREIAAGSPLGEQAAAHIAAGRLLPDALVSS 97
           + G+L  R  GLQA+ +  L  R   AG    +QA AH    RL+  AL  +
Sbjct: 108 ERGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKA 159

>YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine
           protein kinase required for high-affinity polyamine
           transport [2457 bp, 818 aa]
          Length = 818

 Score = 29.6 bits (65), Expect = 3.0,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 41/105 (39%), Gaps = 13/105 (12%)

Query: 143 LVVEVAVPEDVILDRIQKRFVHVPSGRVYNLDYNPPCEAGRDDVTGEPLSRRPDD----- 197
           L + +A P D + + +++  VH+    V++ D  P    G  +V     S R  D     
Sbjct: 226 LPLPIANPNDFLPEDMKQYSVHLTDNFVFDTDNKPIGSGGSSEVRKVKSSYRQKDVYALK 285

Query: 198 --------TPEVFYKRMQEYAATAGPLKEHYARQGILRTVRGPTS 234
                   +PE FYKR  +    A  L  +         ++ PT+
Sbjct: 286 KLNMIYHESPEKFYKRCSKEFIIAKHLSHNVHITNTFYLLKVPTT 330

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.139    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 6,196,678
Number of extensions: 229125
Number of successful extensions: 455
Number of sequences better than 10.0: 23
Number of HSP's gapped: 433
Number of HSP's successfully gapped: 23
Length of query: 247
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 148
Effective length of database: 13,168,927
Effective search space: 1949001196
Effective search space used: 1949001196
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)