Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
AGR039C58657527900.0
CAGL0K05753g66057615940.0
CAGL0B01012g62356615510.0
YBR068C (BAP2)60955615390.0
YDR046C (BAP3)60454315140.0
YDR508C (GNP1)66358715180.0
Scas_569.559354115110.0
Scas_718.4259554715100.0
Kwal_27.1053860254815020.0
YCL025C (AGP1)59554014880.0
Kwal_33.1320460754914880.0
CAGL0L07546g63459314760.0
KLLA0C01606g62055614620.0
CAGL0H08393g61254314570.0
Kwal_33.1321559854714480.0
Scas_517.267956814460.0
AGR038C58054214350.0
AFR698C60955014190.0
AGR040C57354114110.0
YBR069C (TAT1)61954213021e-174
Scas_718.4161452912131e-160
Kwal_27.1268159354611671e-154
YKR039W (GAP1)60254811201e-146
Sklu_2029.259853111091e-145
CAGL0L03267g59754211071e-144
AFR230C60454810971e-143
Sklu_2390.160554110871e-141
ADL272W56449510751e-140
KLLA0A06886g58753910661e-138
AGR319W62656710611e-137
Kwal_33.1540758757310571e-137
Kwal_33.1427659654910321e-133
KLLA0A06930g58753910301e-133
CAGL0B03773g60553410111e-130
KLLA0A11770g58151410041e-129
YGR191W (HIP1)6035219951e-128
KLLA0F01012g5565299841e-127
Scas_479.15955449651e-123
Scas_607.45995579611e-123
Scas_507.15925199591e-122
AEL030W7395369491e-119
KLLA0A10813g5845549031e-114
YOL020W (TAT2)5925539021e-114
CAGL0D02178g5775528991e-114
Kwal_34.162544814578091e-101
KLLA0B06776g5885868101e-100
Kwal_56.229515965458008e-99
Scas_536.13723597642e-96
YPL274W (SAM3)5875467753e-95
YLL061W (MMP1)5835547734e-95
AER405C4974907342e-90
Scas_706.375445376991e-84
CAGL0J08162g5975066691e-79
YNL268W (LYP1)6115416631e-78
KLLA0C02343g5815436592e-78
Scas_706.36d6075056603e-78
Kwal_33.134115605166531e-77
Kwal_33.134015595346512e-77
KLLA0E16335g6055556533e-77
YNL270C (ALP1)5735436489e-77
CAGL0J08184g5725096452e-76
CAGL0A01199g6135536421e-75
Scas_377.24904696234e-74
YEL063C (CAN1)5905196297e-74
KLLA0C02365g5795416252e-73
Scas_520.2*3723566074e-73
YPL265W (DIP5)6085476237e-73
AFR668W5564436137e-72
AFR667C5635156051e-70
Scas_486.25975366028e-70
YOR348C (PUT4)6275535872e-67
Kwal_33.155455765205666e-65
AFR156W5585465517e-63
CAGL0E05632g5985385511e-62
KLLA0F23419g5735305473e-62
Kwal_8.5906295645443e-61
KLLA0B14685g5715245394e-61
Kwal_26.69405705295385e-61
ACL135W5885425343e-60
Sklu_2438.145585365281e-59
Scas_84.12132074932e-58
Kwal_23.28175805545099e-57
CAGL0M00154g5505374948e-55
Kwal_26.96125434964939e-55
Kwal_26.80975445424735e-52
KLLA0F27093g5635024729e-52
Scas_377.11481374392e-51
Scas_552.35585344651e-50
Scas_460.35844994389e-47
Kwal_23.40265345324351e-46
YBR132C (AGP2)5965104231e-44
YFL055W (AGP3)5585204202e-44
AAR038W5665534132e-43
CAGL0C00539g5724493869e-40
KLLA0C15873g5685193832e-39
Kwal_23.38475795083612e-36
Scas_619.2*4714453492e-35
Sklu_2365.98055803271e-31
KLLA0D16830g8325873219e-31
CAGL0E01089g8535513041e-28
Kwal_53.194615655622948e-28
Kwal_27.119007265112913e-27
KLLA0B09922g7976062871e-26
YDR160W (SSY1)8525492872e-26
AGL171W8515362488e-22
Scas_476.42371902251e-20
Scas_485.4*2371902251e-20
Scas_642.222371902215e-20
Scas_682.308453041641e-11
YKL209C (STE6)1290115674.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR039C
         (575 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...  1079   0.0  
CAGL0K05753g 564282..566264 highly similar to sp|P48813 Saccharo...   618   0.0  
CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces cer...   602   0.0  
YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-ch...   597   0.0  
YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched ch...   587   0.0  
YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High aff...   589   0.0  
Scas_569.5                                                            586   0.0  
Scas_718.42                                                           586   0.0  
Kwal_27.10538                                                         583   0.0  
YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substra...   577   0.0  
Kwal_33.13204                                                         577   0.0  
CAGL0L07546g complement(831824..833728) highly similar to sp|P38...   573   0.0  
KLLA0C01606g complement(123485..125347) similar to sp|P48813 Sac...   567   0.0  
CAGL0H08393g 821998..823836 highly similar to sp|P41815 Saccharo...   565   0.0  
Kwal_33.13215                                                         562   0.0  
Scas_517.2                                                            561   0.0  
AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C (...   557   0.0  
AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C (...   551   0.0  
AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH] (782289..78...   548   0.0  
YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid ...   506   e-174
Scas_718.41                                                           471   e-160
Kwal_27.12681                                                         454   e-154
YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid ...   436   e-146
Sklu_2029.2 , Contig c2029 2095-3891                                  431   e-145
CAGL0L03267g 372787..374580 highly similar to sp|P19145 Saccharo...   431   e-144
AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH] (855416..8...   427   e-143
Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement        423   e-141
ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH] complement...   418   e-140
KLLA0A06886g complement(621646..623409) similar to sp|P19145 Sac...   415   e-138
AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH] complement(...   413   e-137
Kwal_33.15407                                                         411   e-137
Kwal_33.14276                                                         402   e-133
KLLA0A06930g complement(625498..627261) similar to sp|P19145 Sac...   401   e-133
CAGL0B03773g 373956..375773 highly similar to sp|P06775 Saccharo...   394   e-130
KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces...   391   e-129
YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease, ...   387   e-128
KLLA0F01012g complement(90772..92442) similar to sp|P48813 Sacch...   383   e-127
Scas_479.1                                                            376   e-123
Scas_607.4                                                            374   e-123
Scas_507.1                                                            374   e-122
AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH] complement(...   370   e-119
KLLA0A10813g complement(936126..937880) similar to sp|P38967 Sac...   352   e-114
YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity trypt...   352   e-114
CAGL0D02178g 222597..224330 highly similar to sp|P38967 Saccharo...   350   e-114
Kwal_34.16254                                                         316   e-101
KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyce...   316   e-100
Kwal_56.22951                                                         312   8e-99
Scas_536.1                                                            298   2e-96
YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity S-adeno...   303   3e-95
YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity S-methy...   302   4e-95
AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH] (1413790.....   287   2e-90
Scas_706.37                                                           273   1e-84
CAGL0J08162g complement(801555..803348) Highly similar to sp|P32...   262   1e-79
YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysin...   259   1e-78
KLLA0C02343g complement(203552..205297) similar to sp|P04817 Sac...   258   2e-78
Scas_706.36d                                                          258   3e-78
Kwal_33.13411                                                         256   1e-77
Kwal_33.13401                                                         255   2e-77
KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1 Kluyvero...   256   3e-77
YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine ...   254   9e-77
CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces c...   253   2e-76
CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces c...   251   1e-75
Scas_377.2                                                            244   4e-74
YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for...   246   7e-74
KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces c...   245   2e-73
Scas_520.2*                                                           238   4e-73
YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino ac...   244   7e-73
AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C (...   240   7e-72
AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH] (1657064..1...   237   1e-70
Scas_486.2                                                            236   8e-70
YOR348C (PUT4) [5125] chr15 complement(986894..988777) High affi...   230   2e-67
Kwal_33.15545                                                         222   6e-65
AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH] complement...   216   7e-63
CAGL0E05632g complement(556619..558415) similar to sp|P15380 Sac...   216   1e-62
KLLA0F23419g complement(2187386..2189107) similar to sp|P15380 S...   215   3e-62
Kwal_8.590                                                            214   3e-61
KLLA0B14685g complement(1289025..1290740) similar to sp|P15380 S...   212   4e-61
Kwal_26.6940                                                          211   5e-61
ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH] complement(...   210   3e-60
Sklu_2438.14 YOR348C, Contig c2438 29357-31033                        207   1e-59
Scas_84.1                                                             194   2e-58
Kwal_23.2817                                                          200   9e-57
CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces cer...   194   8e-55
Kwal_26.9612                                                          194   9e-55
Kwal_26.8097                                                          186   5e-52
KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces...   186   9e-52
Scas_377.1                                                            173   2e-51
Scas_552.3                                                            183   1e-50
Scas_460.3                                                            173   9e-47
Kwal_23.4026                                                          172   1e-46
YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma memb...   167   1e-44
YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease fo...   166   2e-44
AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH] complement(4...   163   2e-43
CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomy...   153   9e-40
KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces...   152   2e-39
Kwal_23.3847                                                          143   2e-36
Scas_619.2*                                                           139   2e-35
Sklu_2365.9 YDR160W, Contig c2365 13522-15939                         130   1e-31
KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces...   128   9e-31
CAGL0E01089g complement(96582..99143) similar to sp|Q03770 Sacch...   121   1e-28
Kwal_53.19461                                                         117   8e-28
Kwal_27.11900                                                         116   3e-27
KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03...   115   1e-26
YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an extr...   115   2e-26
AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH] complement(...   100   8e-22
Scas_476.4                                                             91   1e-20
Scas_485.4*                                                            91   1e-20
Scas_642.22                                                            90   5e-20
Scas_682.30                                                            68   1e-11
YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane tr...    30   4.7  

>AGR039C [4349] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (779726..781486) [1761 bp, 586 aa]
          Length = 586

 Score = 1079 bits (2790), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/575 (92%), Positives = 534/575 (92%)

Query: 1   MSGFVSDKPAVPKATXXXXXXXXXIEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNG 60
           MSGFVSDKPAVPKAT         IEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNG
Sbjct: 1   MSGFVSDKPAVPKATSDSSSSAVSIEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNG 60

Query: 61  LNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCV 120
           LNKTQQTLKHNIKTRH               VASGKALHFGGPAGLVIGYVTTSTMLYCV
Sbjct: 61  LNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCV 120

Query: 121 VQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYW 180
           VQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYW
Sbjct: 121 VQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYW 180

Query: 181 TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQ 240
           TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQ
Sbjct: 181 TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQ 240

Query: 241 GYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA 300
           GYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA
Sbjct: 241 GYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA 300

Query: 301 TKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHII 360
           TKRWLYR                 HNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHII
Sbjct: 301 TKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHII 360

Query: 361 NFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAF 420
           NFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAF
Sbjct: 361 NFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAF 420

Query: 421 VAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALG 480
           VAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALG
Sbjct: 421 VAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALG 480

Query: 481 SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL 540
           SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL
Sbjct: 481 SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL 540

Query: 541 VIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNS 575
           VIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNS
Sbjct: 541 VIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRNS 575

>CAGL0K05753g 564282..566264 highly similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1, start by
           similarity
          Length = 660

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/576 (54%), Positives = 390/576 (67%), Gaps = 28/576 (4%)

Query: 26  EYAGN---RNAWTRFTDSFKRA------QVDTAVDLEG----------------KDADNG 60
           E+ G+   R    RF DSFKRA      Q + A DLE                 K   NG
Sbjct: 74  EFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTGNG 133

Query: 61  LNK-TQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYC 119
             K  ++ LK +IK RH               V + KALH  GPAGLVIGY    + +YC
Sbjct: 134 QMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYC 193

Query: 120 VVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKY 179
           ++QA  E+ V Y+ L G +N YP+ LVD GFGFAVA VY LQW  V PLELVT S+T+KY
Sbjct: 194 IIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKY 253

Query: 180 WTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAG-AS 238
           WT++VNPD FV IFYV ++FI  FG+RGYAEAEF FN  K+L++ GF I+ I + AG A 
Sbjct: 254 WTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAG 313

Query: 239 EQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVP 298
             GY+G +YWHDPGAF G   I RFKGI + +V AAFA+G +EFIALTAAEQ+NPR+++P
Sbjct: 314 NDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIP 373

Query: 299 KATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPH 358
            A K+ LYR                  +SDQL+ A GGS ++ASP+V+A ++HGVRVVPH
Sbjct: 374 SAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGA-GGSATKASPYVLAISIHGVRVVPH 432

Query: 359 IINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLI 418
            IN +IL SV SV NSA YS+ R+LL LA+ G  PK F YVDRQGRP   +   +LFG+I
Sbjct: 433 FINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVI 492

Query: 419 AFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGA 478
           AF AAS +E+ VFTWL AI+GLSQLFTW AI VSH+RFRRAM VQGRSLGE+G++A  G 
Sbjct: 493 AFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGV 552

Query: 479 LGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDF 538
            GSYYA    V+ LIAQFW+AIAPI  +G+LD E FF+NYLA P+L+ FY GYKLWKRD+
Sbjct: 553 YGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDW 612

Query: 539 RLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           RL I + ++DL S+RQ+FDEE+L QE+ E KE+L+N
Sbjct: 613 RLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKN 648

>CAGL0B01012g 91330..93201 similar to sp|P25376 Saccharomyces
           cerevisiae YCL025c AGP1 Asparagine/glutamine permease or
           sp|P48813 Saccharomyces cerevisiae YDR508c GNP1,
           hypothetical start
          Length = 623

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/566 (52%), Positives = 389/566 (68%), Gaps = 29/566 (5%)

Query: 36  RFTDSFKRAQVDTA---------------VDLEGKDA------DNGL-----NKTQQTLK 69
           RF DSFKRA+                   +D +GK+       +N +     N+  + LK
Sbjct: 48  RFVDSFKRAEQQNNSEITSAASCDGSSENLDKDGKEVADLEVQENQVLTEKSNQKNKELK 107

Query: 70  HNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGV 129
             IK RH               V + KALH  GPAGL+IGY    T LYC++QA  EL V
Sbjct: 108 QTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAV 167

Query: 130 AYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVF 189
           +Y++L G +N YP+FLVD  FGF+VA VY +QW  V PLELVTASMT+KYWT++VN D+F
Sbjct: 168 SYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTTVNADIF 227

Query: 190 VAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGGQYW 248
           V IFYV ++ I+ FG+RGYAEAEF FN  K+L+M GF I+ I + T GA   GYIG +YW
Sbjct: 228 VGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYW 287

Query: 249 HDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRX 308
           H PGAF GDR ID FKGI +  V AAFA+G +EFIALTAAEQ+NPR+++P A K+ LYR 
Sbjct: 288 HTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRI 347

Query: 309 XXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSV 368
                           ++SDQL+ + GGS ++ASP+V+A + HGV+VVPH IN +IL SV
Sbjct: 348 LFIFLGSITLVGFLVPYDSDQLMGS-GGSATKASPYVLAVSTHGVKVVPHFINAVILLSV 406

Query: 369 ISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEE 428
           +SVGNSA YS+ R+L SLA+ G  PK F YVDR+GRP   ++   +F +I+F AAS +EE
Sbjct: 407 LSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEE 466

Query: 429 NVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFN 488
            VFTWL AI+GLSQ+FTW AI +SH+RFR+AM VQ RSLGE+G++A TG  GSYY  F  
Sbjct: 467 QVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFML 526

Query: 489 VIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVD 548
           V++LIAQFW+AIAPI   G+LD + FF+NYLA P+L++FY+GYK+WK+D+ L I ++ +D
Sbjct: 527 VMILIAQFWVAIAPI-GEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNID 585

Query: 549 LLSHRQIFDEEVLLQEEAERKERLRN 574
           L  HRQIFDEE+L QE+ E +E+L+N
Sbjct: 586 LDKHRQIFDEELLKQEDEEYREKLKN 611

>YBR068C (BAP2) [258] chr2 complement(373821..375650) Branched-chain
           amino acid permease, also transports alanine and
           aromatic and sulfur containing amino acids [1830 bp, 609
           aa]
          Length = 609

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/556 (50%), Positives = 383/556 (68%), Gaps = 8/556 (1%)

Query: 26  EYAGNRNAWTRFTDSFKRAQVDTA----VDLEGKDADNGLNK--TQQTLKHNIKTRHXXX 79
           + +G+     RF DSFKRA+  T     ++    D ++G+    +   LK ++K+RH   
Sbjct: 43  QKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVM 102

Query: 80  XXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYN 139
                       VA+ K LH+GGPA L+IGY+  S   Y ++QA  E+ V Y TLP N+N
Sbjct: 103 MSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFETYFMIQAAGEMAVTYPTLPANFN 162

Query: 140 AYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLF 199
           AY +  + K FGFA   +Y  QW TVLPLEL+TASMT+++    +NPD+++ IFYVFL+F
Sbjct: 163 AYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFGNDKINPDIYILIFYVFLVF 222

Query: 200 IHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDR 258
           IHFFG + Y E EFIFN  K+L++AGFII++I +  G A   GYIG  YWH+PGAF GD 
Sbjct: 223 IHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAGDT 282

Query: 259 AIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXX 318
           +I RFK +C + V A F++GG E  AL+  EQ+NPR+S P A KR +YR           
Sbjct: 283 SIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMIL 342

Query: 319 XXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYS 378
                 +N DQL+ A GGS + ASP+V+AA++HGV++VPHIIN +IL SV+SV NS++Y+
Sbjct: 343 IGFNVPYNDDQLMGA-GGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYA 401

Query: 379 APRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIA 438
            PR++ SLA+ G  PK   YVDR+GRPL  LI   +FG+IAFVAAS++EE VFTWL+AIA
Sbjct: 402 GPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIA 461

Query: 439 GLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWI 498
           GLS+LFTWT+I +SH+RFR+AM+VQGRSL ELGY+A TG  GS Y +FFN++V +AQFW+
Sbjct: 462 GLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWV 521

Query: 499 AIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDE 558
           A+AP+   G+ D E FFQNYLAFP+ + FY GY ++ RDF L+ P  ++DL  HR+I+D 
Sbjct: 522 ALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDP 581

Query: 559 EVLLQEEAERKERLRN 574
           E++ QE+ E KE+LRN
Sbjct: 582 ELMRQEDEENKEKLRN 597

>YDR046C (BAP3) [899] chr4 complement(548758..550572) Branched chain
           amino acid permease, also transports threonine, alanine
           and aromatic and sulfur containing amino acids [1815 bp,
           604 aa]
          Length = 604

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/543 (51%), Positives = 374/543 (68%), Gaps = 6/543 (1%)

Query: 36  RFTDSFKRAQVDTAVDLEGKDADNGLN--KTQQTLKHNIKTRHXXXXXXXXXXXXXXXVA 93
           RF DSF+RA+       E  D ++G    K+   LK ++K+RH               VA
Sbjct: 54  RFVDSFRRAESQRLE--EDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVA 111

Query: 94  SGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFA 153
           + K L   GP  LVIGYV  S + Y +VQA  E+GV Y TLPGN+NAY +  + K FGFA
Sbjct: 112 NAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFA 171

Query: 154 VALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEF 213
              ++ +QW TVLPLEL+T+SMTVKYW  ++N DVF+ IFYVFLLFIHFFG + Y E EF
Sbjct: 172 TTWLFCIQWLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEF 231

Query: 214 IFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQ 272
           IFNS K+L++AGFII+++ +  G A   GYIGG+YW DPG+F       RFKGIC + V 
Sbjct: 232 IFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVS 291

Query: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLS 332
           A F++GG E   L+  EQ+NPR+S P A KR +YR                 HN+DQL+ 
Sbjct: 292 AYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMG 351

Query: 333 AEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMC 392
           + GGS + ASP+V+AA++H VRV+PHIIN +IL SVISV NSA+Y+APR++ SLA+ G  
Sbjct: 352 S-GGSATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYA 410

Query: 393 PKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVS 452
           PK   Y+DR+GRPL  L+  SL G++ FVA S QEE  FTWL+AIAGLS+LFTW+ I +S
Sbjct: 411 PKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLS 470

Query: 453 HVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE 512
           H+RFR+AM+VQGRSL E+GY+ANTG  GSYY +FFN++V +AQFW+A++PI   G+ D +
Sbjct: 471 HIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQ 530

Query: 513 FFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572
            FF++YLA P+ +  Y+GY ++KRDF  + P  ++DL  HR+++D E++ QE+ E KERL
Sbjct: 531 AFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERL 590

Query: 573 RNS 575
           +NS
Sbjct: 591 KNS 593

>YDR508C (GNP1) [1322] chr4 complement(1466441..1468432) High
           affinity glutamine permease, may also transports
           leucine, cysteine, methionine, serine, threonine and
           asparagine, member of the amino acid-polyamine-choline
           (APC) family of membrane transporters [1992 bp, 663 aa]
          Length = 663

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/587 (50%), Positives = 387/587 (65%), Gaps = 38/587 (6%)

Query: 25  IEYAGNRNA--WTRFTDSFKRAQVDTA-----------VDLEGKDA----DNGLNKT--- 64
           +EY G  +A    RF DSF+RA+   A             +  KD+    DN LN+    
Sbjct: 66  MEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELNRKSSY 125

Query: 65  ----------------QQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVI 108
                           Q+ LK +IK RH               V + K L+  GP GL+I
Sbjct: 126 ITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLII 185

Query: 109 GYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPL 168
           GY    + +YC++QAC EL V Y+ L G +N YP FLVD   GF+VA ++ LQW  V PL
Sbjct: 186 GYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPL 245

Query: 169 ELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFII 228
           ELVTASMT+KYWT+SVNPDVFV IFYV ++ I+ FG++GYAEA+F FN  K+L++ GF I
Sbjct: 246 ELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFI 305

Query: 229 MAISL-TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTA 287
           +AI +   GA   GYIG +YW DPGAF GD  I RFKG+ + +V AAFA+G SE +A+TA
Sbjct: 306 LAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTA 365

Query: 288 AEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIA 347
           +EQ+NPR+++P A K+ +YR                 + SDQLL A  GS ++ASP+VIA
Sbjct: 366 SEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGA-AGSATKASPYVIA 424

Query: 348 AALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLV 407
            + HGVRVVPH IN +IL SV+SV N A Y++ RIL+SLA+ G  PK F Y+DR+GRP  
Sbjct: 425 VSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAA 484

Query: 408 TLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSL 467
            ++  +LFG+IAF A+S +EE+VFTWL AI+GLSQLFTW  I +SH+RFRRAM+VQGRSL
Sbjct: 485 AMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSL 544

Query: 468 GELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVF 527
           GE+GY++  G  GS YA+   V+ LIAQFW+AIAPI   G+L  + FF+NYLA P+ +  
Sbjct: 545 GEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIAL 604

Query: 528 YLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           Y+ YK+WK+D+ L IP+ +VDL+SHR IFDEE+L QE+ E KERLRN
Sbjct: 605 YIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRN 651

>Scas_569.5
          Length = 593

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/541 (52%), Positives = 377/541 (69%), Gaps = 5/541 (0%)

Query: 36  RFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASG 95
           RF DSFKRAQ  T  DLE  D    L      LK  +K+RH               VA+ 
Sbjct: 46  RFVDSFKRAQDSTENDLE--DGTKPLGDASH-LKKAMKSRHVIMMCVGTGIGTGLLVANA 102

Query: 96  KALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVA 155
             L +GGP  LVIGYV  S + Y ++QA  E+ VAY TLPGN+N+Y +  + K FGFA  
Sbjct: 103 SGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATV 162

Query: 156 LVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIF 215
            ++ +QW TV PLEL+TAS+T+KYW   +N DVF+ IFYVFLLFIHFFG + Y EAEFIF
Sbjct: 163 WLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFLLFIHFFGVKAYGEAEFIF 222

Query: 216 NSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAA 274
           NS KVL++AGFII++I +  G A + GYIG +YW DPG+F    ++++FKGIC + V A 
Sbjct: 223 NSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAEGDSVEKFKGICYILVTAY 282

Query: 275 FAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAE 334
           F+YGG+E  +L+  EQ NPR+S P+A K+ +YR                 HN+DQL+ + 
Sbjct: 283 FSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGS- 341

Query: 335 GGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPK 394
           GGS + ASP+V+AA++HGV+VVPH IN +IL SVISV NSA+Y++PR++ SLAE G  PK
Sbjct: 342 GGSATHASPYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPK 401

Query: 395 IFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHV 454
              YVDR+GRPL  LI  ++FG+I FV+AS++EE VFTWL+AIAGLS+LFTW+ I +SHV
Sbjct: 402 FLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHV 461

Query: 455 RFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFF 514
           RFR+ M++ GRS  E+G+RA TG  GS Y I FN++V IAQFW+A+AP   HG++D E F
Sbjct: 462 RFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESF 521

Query: 515 FQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           FQ+YLA P+ + FY GY L+KRDF  ++P  ++DL  HR+I+D E++ QE+ E KE+++N
Sbjct: 522 FQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQEDEENKEKIKN 581

Query: 575 S 575
           S
Sbjct: 582 S 582

>Scas_718.42
          Length = 595

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/547 (53%), Positives = 371/547 (67%), Gaps = 6/547 (1%)

Query: 30  NRNAWTRFTDSFKRAQVD-TAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           +R  + RF DSFKRA+V+   +DLE  D  N + ++   LK  +K+RH            
Sbjct: 41  HRTHFNRFVDSFKRAEVNHNGIDLE--DGTNSI-QSDDNLKKAMKSRHVIMMSLGTGIGT 97

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              VA+ K L+  GPA LVIGY   S + Y V+QA  E+ V Y TLPG +N Y +  V K
Sbjct: 98  GLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSK 157

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
            FGFA   ++ +QW TVLPLEL+TASMT+KYW   +N DVFV I YVFLLFIHFFG R Y
Sbjct: 158 PFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAY 217

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            EAEFIFNS K+L++ GF+I++I +  G A   GYIGG+YW DPGAF  D A  RFKG+ 
Sbjct: 218 GEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVA 277

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
            V V A F+YGG E  AL+  EQ NPR S P A K+ +YR                 HNS
Sbjct: 278 FVLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNS 337

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
           DQL+ A GGS + ASP+V+A ++HGV+VVPHIIN +IL SV SV NSA+Y++PR+L SLA
Sbjct: 338 DQLMGA-GGSATHASPYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           E G  PK F YVDR+GRPL  LI  S+FG+IAF A S+QEE +FTWL+AIAGLS+LFTW+
Sbjct: 397 EQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWS 456

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
           +I +SHVRFR AM+ QG+SL ELGY + TG  GS Y  FFNV+V IAQFW+A++P    G
Sbjct: 457 SILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKG 516

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567
               E FF++YLAFPV + FYLGY L+ RDF  +    ++DL +HR+++D E+L QE+ E
Sbjct: 517 VYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEE 576

Query: 568 RKERLRN 574
            KER+RN
Sbjct: 577 TKERIRN 583

>Kwal_27.10538
          Length = 602

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/548 (52%), Positives = 379/548 (69%), Gaps = 2/548 (0%)

Query: 30  NRNAWTRFTDSFKRAQV-DTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           NRNAW RF +SFKRA+   T  + + + A      +   LK +IK RH            
Sbjct: 44  NRNAWGRFVNSFKRAEKHSTPSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGT 103

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              VA+GK+L FGGPAGL+IGY   S + Y ++QA  E+ VAY +LPGN+NAY + L+ +
Sbjct: 104 GLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISR 163

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
            FGFA   +Y +QW TVLPLEL+TAS+T+KYW  S+N DVF+AIFYVF+LFIHFFGSRGY
Sbjct: 164 PFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGY 223

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            E+EFIF   KVL++ GF+I++I +  G A ++ YIG +YW+DPGAF       +FKG+ 
Sbjct: 224 GESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGVA 283

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
            V V   F+YGG+E  A+T  EQ+NPR ++   TK+ +YR                 H S
Sbjct: 284 YVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTS 343

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
            +L+ + G S + ASP+V+A +LHGV++VPHIIN +IL +VISVGNSAMYS PRIL +LA
Sbjct: 344 SELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLA 403

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           E G  P+   YVDR GRPLV LI  S+FGL+AFVAAS+ EE+VFTWL+AIAGLS+LFTW+
Sbjct: 404 EQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWS 463

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
           AI +SHVRFR+AMR   R L ELGY+ANTG LGS   + FN++V IAQFW++IAP  K G
Sbjct: 464 AIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKDG 523

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567
           +LDV  FFQ+YLAFP+ VV + GY +  R++ ++ P  ++DL  +R I+D++ L QE+ E
Sbjct: 524 KLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDLE 583

Query: 568 RKERLRNS 575
            K  ++NS
Sbjct: 584 HKILIQNS 591

>YCL025C (AGP1) [519] chr3 complement(76131..77918) Broad substrate
           range amino acid permease with high affinity for
           asparagine and glutamine [1788 bp, 595 aa]
          Length = 595

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/540 (53%), Positives = 371/540 (68%), Gaps = 29/540 (5%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEG-----------------------KDADN-GLNKTQ 65
           N +A  RF DSFKRA      ++E                        + +DN G N   
Sbjct: 52  NTSAVRRFFDSFKRADQGPQDEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGH 111

Query: 66  QT--LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQA 123
           ++  LK  I+ RH               V +G AL   GPAGL+IGY    ++LYC++QA
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 124 CCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSS 183
           C E+ + Y+ L G YNAYP+FLVD GFGFAVA VY LQW  V PLELVTASMT+KYWT+S
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 184 VNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGY 242
           VNPDVFV IFYV ++ I+ FG+RGYAEAEF FN  K+L+M GF I+ I +   GA   G+
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 243 IGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATK 302
           IGG+YWHDPGAF G  AIDRFKG+ +  V AAFA+GGSEFIA+T AEQ+NPR+++P A K
Sbjct: 292 IGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAK 351

Query: 303 RWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINF 362
           + +YR                 +NSDQLL + GG G++ASP+VIA A HGVRVVPH IN 
Sbjct: 352 QMIYRILFLFLATIILLGFLVPYNSDQLLGSTGG-GTKASPYVIAVASHGVRVVPHFINA 410

Query: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422
           +IL SV+S+ NS+ YS+ R+ L+L+E G  PK+F+Y+DR GRPL+ +   +LF +IAF A
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCA 470

Query: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSY 482
           AS +EE VFTWL AI+GLSQLFTWTAI +SH+RFRRAM+VQGRSLGELG+++ TG  GS 
Sbjct: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSA 530

Query: 483 YAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVI 542
           YA    +++LIAQFW+AIAPI + G+LD + FF+NYLA P+L+  Y+GYK+W +D++L I
Sbjct: 531 YACIMMILILIAQFWVAIAPIGE-GKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFI 589

>Kwal_33.13204
          Length = 607

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/549 (53%), Positives = 380/549 (69%), Gaps = 7/549 (1%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQT---LKHNIKTRHXXXXXXXXXX 86
           +++ + RF  +F RA         G D + G    +QT   LK  I  RH          
Sbjct: 50  SKSRFRRFARTFHRAD-GLGDGASGNDVEFGAEVARQTETKLKQTITFRHVFMMSLGTGI 108

Query: 87  XXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLV 146
                V +GKALH GGPAGLVIGY    + LYC++QA  EL V+Y++L GN+NAYP+ L+
Sbjct: 109 GTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNFNAYPSMLI 168

Query: 147 DKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSR 206
           ++ FGF+VA +Y LQW  VLPLELVTAS+T+KYWT+SVNPD+FVAIFYV ++ ++ FG+R
Sbjct: 169 EQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLIILVNMFGAR 228

Query: 207 GYAEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKG 265
           GYAEAEF FN  KVL++ GF I+ I +  G A   GYIGG+YW++PGAF G + I  FKG
Sbjct: 229 GYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGTKPIHHFKG 288

Query: 266 ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXH 325
           I S  V AAFA+G +EFIALTAAEQANPR ++P A K+ +YR                 H
Sbjct: 289 IISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPH 348

Query: 326 NSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
           NS +L+ + G S + ASP+VIA A HGVRVVPH IN +IL SV+SVGNSA YS+ R+LL+
Sbjct: 349 NSPELMGS-GSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLA 407

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           LA+    P    ++DR GRP+  ++   +FGLI+FVAAS +EE VFTWL AI+GLSQLFT
Sbjct: 408 LADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFT 467

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPK 505
           W +I VSH+RFR+A+ VQG+ +GELGY++ TG  GSYYA F    +LI QFW+AIAP+  
Sbjct: 468 WISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGS 527

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEE 565
             +LD   FF+NYLA P+ VV Y G+K+WKRD+RL IP  ++DL SHR+ FDEE+L QE+
Sbjct: 528 -AKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEELLKQED 586

Query: 566 AERKERLRN 574
           AE +E +RN
Sbjct: 587 AEYEENIRN 595

>CAGL0L07546g complement(831824..833728) highly similar to sp|P38084
           Saccharomyces cerevisiae YBR068c BAP2 or sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, start by
           similarity
          Length = 634

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/593 (49%), Positives = 379/593 (63%), Gaps = 47/593 (7%)

Query: 26  EYAGNRNAWT-------------------RFTDSFKRAQ--------------------- 45
           +YAGN N ++                   RF DSFKRAQ                     
Sbjct: 33  KYAGNSNDYSQRDSDNTSIESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKG 92

Query: 46  --VDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGP 103
              + ++DLEG D D+ +  T   LK  +K+RH               VA+ K LHFGGP
Sbjct: 93  GFEEDSLDLEGSDHDSIITNTH--LKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGP 150

Query: 104 AGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA 163
           A LVIGYV  S + Y ++QA  E+ V Y TLPGN+NAY +  V   FGFA   ++ +QW 
Sbjct: 151 AALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWL 210

Query: 164 TVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSR-GYAEAEFIFNSLKVLL 222
           TVLPLEL+TAS+T+KYW   +N DVF+ IFYVFLL IH FG    Y E EF+FN  K+L+
Sbjct: 211 TVLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILM 270

Query: 223 MAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSE 281
           + GFIIM+I + AG A  + YIGG++WHDPGAF G  A  RFKGIC V V   F+YGG+E
Sbjct: 271 VIGFIIMSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTE 330

Query: 282 FIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRA 341
             AL+  EQ+NPR S P+A+K  LYR                 ++SD+L+ + GGS + A
Sbjct: 331 LFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGS-GGSATHA 389

Query: 342 SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDR 401
           SP+V+AA+L+GV++ PH IN +IL SVISV NS++Y+APR++ SLA+ G  PK   YVDR
Sbjct: 390 SPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDR 449

Query: 402 QGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMR 461
           QGRPL+ LI   L G+I FVAAS +EE VFTWL+AIAGLS+LFTW++I +SHVRFR AM+
Sbjct: 450 QGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMK 509

Query: 462 VQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAF 521
           +Q RSL ELGY+A TG  GS Y + FN++V  AQFW A+ P    G+ +   FF NYLA 
Sbjct: 510 LQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAM 569

Query: 522 PVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           P+ +VFY GY LW RDF+L+ P  ++DL  HR+I+D E++ QE+ E KERLRN
Sbjct: 570 PIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRN 622

>KLLA0C01606g complement(123485..125347) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, start by similarity
          Length = 620

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/556 (50%), Positives = 376/556 (67%), Gaps = 7/556 (1%)

Query: 26  EYAGNRNAWTRFTDSFKRA-QVDTAV----DLEGKDADNGLNKTQQTLKHNIKTRHXXXX 80
           EYA   + W RF DSFKRA  ++T +    +LE   + + L +   +LK +IK RH    
Sbjct: 55  EYAAKSSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVVMM 114

Query: 81  XXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNA 140
                      V +GKAL  GGPAGL IGY    + LY ++QA  EL VAY TL GN+N 
Sbjct: 115 SLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNN 174

Query: 141 YPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFI 200
           YP+FLVD    FA A +Y +QW  V PLE+++A++T+KYW +S+NP+V+  IFYV ++ I
Sbjct: 175 YPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVIFYVMIIGI 234

Query: 201 HFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRA 259
           +  GS GYAEA+F FN+ K+L+ AGF I+ I +  G A +  YIGG+YW+DPGAF GD  
Sbjct: 235 NMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFNGDTG 294

Query: 260 IDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXX 319
           I RFK I S  V AAFA+G SE +ALTA+EQANPR+++P A K+ LYR            
Sbjct: 295 ISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASIILV 354

Query: 320 XXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSA 379
                +NS +L+ +   S   +SP+VIA A HGV+VVP  IN +IL SV+SVGN + YS+
Sbjct: 355 GFLVPYNSPELMGSGSSS-VHSSPYVIAVASHGVKVVPSFINAVILISVLSVGNFSFYSS 413

Query: 380 PRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAG 439
            RILL L+E G  PK F YVDRQGRPL  +I  +L G I FV+AS+ EE+VFTWL A++G
Sbjct: 414 SRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMAVSG 473

Query: 440 LSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIA 499
           LSQLFTWT I +SHVRFR+AM+VQ RS+GELG+R+  G  GSYY IF  ++V I QFW+A
Sbjct: 474 LSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVFIGQFWVA 533

Query: 500 IAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEE 559
           + P+      D E FF NYLA PV +  Y G+K+WK+D+RL IP+SE+DL+SHR+IFDEE
Sbjct: 534 LFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKIFDEE 593

Query: 560 VLLQEEAERKERLRNS 575
           +L QE+ E K +++++
Sbjct: 594 ILKQEDEEYKIKMKHA 609

>CAGL0H08393g 821998..823836 highly similar to sp|P41815
           Saccharomyces cerevisiae YDR046c PAP1, hypothetical
           start
          Length = 612

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/543 (50%), Positives = 364/543 (67%), Gaps = 12/543 (2%)

Query: 37  FTDSFKRAQVDTAVDLEGKDADNGLNKT---QQTLKHNIKTRHXXXXXXXXXXXXXXXVA 93
           F DSFKRA  D + D       N L KT    Q  K  +K+RH               V+
Sbjct: 67  FIDSFKRA--DDSPD------HNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVS 118

Query: 94  SGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFA 153
           +GK L   GPA LVI Y   S + Y ++QA  E+ V Y TLPG++NAY +F + K FGFA
Sbjct: 119 NGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFA 178

Query: 154 VALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEF 213
              ++ +QW TVLPLEL+TA+MT+KYW +S++PDVFV IFYVFL+FIHFFG + Y E EF
Sbjct: 179 TTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEF 238

Query: 214 IFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQ 272
           IFN+ K+L++ GFII AI +  G A + GYIGG+YWHDPGAF       RFKGIC   V 
Sbjct: 239 IFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVN 298

Query: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLS 332
           A F+YGG+E   L+  +Q NPR+S P A K  +YR                 HNS +LL 
Sbjct: 299 AYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLG 358

Query: 333 AEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMC 392
           A GG+G  ASP+V+AA++HG++VVPHIIN +IL ++ISV NS++Y+ PR+L SLA+ G  
Sbjct: 359 ASGGNGLHASPYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYA 418

Query: 393 PKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVS 452
           P+  +YVDR+GRPL  L+  +L G+I F A S +EE VFTWL+AI+GLS+LFTWT+I  S
Sbjct: 419 PRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFS 478

Query: 453 HVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE 512
           H+RFRRAM++Q +SL  LGY+ANTG  GSY+ + FN++V  AQFW+A++P    G+ D  
Sbjct: 479 HIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDAN 538

Query: 513 FFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572
            FF +YLA P+ +VFY GY  W +DF ++   ++VDL +HR+++D E L QE+ E KERL
Sbjct: 539 SFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERL 598

Query: 573 RNS 575
           RNS
Sbjct: 599 RNS 601

>Kwal_33.13215
          Length = 598

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/547 (54%), Positives = 382/547 (69%), Gaps = 9/547 (1%)

Query: 36  RFTDSFKRAQVDTAVDLEGKDADNGL------NKTQQTLKHNIKTRHXXXXXXXXXXXXX 89
           RF DSF+R +       +G D D+            +TLK NI+ RH             
Sbjct: 43  RFADSFRRHEAHNGGGGDGDDEDHEGLTPIESASKHKTLKQNIRPRHVLMISLATGIGTG 102

Query: 90  XXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149
             V +GK+LH GGPA LVIGY   S+MLYCV+Q+  EL + Y +L G +NAYP+ LVDK 
Sbjct: 103 MLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQSASELAIIYTSLAGGFNAYPSLLVDKA 162

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209
           FGF+V+ VY LQW  VLPLELVTASMT+KYW  ++NPD FV IFYV L+ I+F G+ GYA
Sbjct: 163 FGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQTINPDAFVTIFYVVLVAINFVGAAGYA 222

Query: 210 EAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICS 268
           EAEF FN  KVL++ GF I+ I +  G A   GY+G +YWHDPGAF G  +I+RFKGI +
Sbjct: 223 EAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGYLGARYWHDPGAFRGSDSINRFKGIVA 282

Query: 269 VWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSD 328
           V V AAFAYGG+EF  LTAAEQ NP++S+  A+K+ +YR                  NSD
Sbjct: 283 VLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSD 342

Query: 329 QLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAE 388
           +LL + GGS + ASPFVIA A HGVRVVPH IN +IL SV+SV NSA+YS+ RILLSL+E
Sbjct: 343 ELLGS-GGSATHASPFVIAVASHGVRVVPHFINAVILLSVLSVANSALYSSSRILLSLSE 401

Query: 389 HGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTA 448
            G  P+   YVDR GRP++ L+   +FGL++FVAAS +EE VFTWL AI+GLS+LFTW +
Sbjct: 402 QGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFS 461

Query: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGE 508
           I++SHVR RRAM VQGRS  ELGY A TG  G+YYA+   V +L+ QFW+AI+P+  + +
Sbjct: 462 ISLSHVRLRRAMTVQGRSADELGYVAWTGVWGAYYAMAMIVAILVGQFWVAISPVGSN-K 520

Query: 509 LDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568
           LD   FF+NYLA P+L+  YLGYK+W RD+RL+IPSSEVDL++HR+IFD EVL  E+ E 
Sbjct: 521 LDANNFFENYLAMPILIFLYLGYKIWTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEE 580

Query: 569 KERLRNS 575
           KE+LR++
Sbjct: 581 KEQLRHA 587

>Scas_517.2
          Length = 679

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/568 (50%), Positives = 376/568 (66%), Gaps = 31/568 (5%)

Query: 36  RFTDSFKRAQ----------VDTAVDLEG----------------KDADNGLNKTQQTLK 69
            F DSFKRA+           ++  DLE                  DA    N     LK
Sbjct: 100 NFMDSFKRAEQHPTNVNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDNSKSDELK 159

Query: 70  HNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGV 129
             IK RH               V  G +L   GPAGL+IG+    + LYC++QA  EL V
Sbjct: 160 KTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGELAV 219

Query: 130 AYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVF 189
           AY+ L G +NAYP+FLVD+ F FAVA +Y +QW  V PLELVTASMT+KYWT+ V+PD+F
Sbjct: 220 AYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDPDIF 279

Query: 190 VAIFYVFLLFIHFFG-SRGYAEAEFIFNSLKVLLMAGFIIMAIS-LTAGASEQGYIGGQY 247
           V IFY+ ++ I+  G + GYAEAEFIFNS K+++M GF I+ I+ +  GA   GYIG +Y
Sbjct: 280 VIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIGAKY 339

Query: 248 WHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYR 307
           WHDPGA  GD +I RFKG  +  V AAFA+G SEFI +TA+EQ+NPR+++P A K+ +YR
Sbjct: 340 WHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMIYR 399

Query: 308 XXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTS 367
                            +NSDQLL + G SG +ASP+V+A + HGVRVVPH IN +IL S
Sbjct: 400 ILCMFLSSITIVGFLVPYNSDQLLGSTG-SGVKASPYVLAISTHGVRVVPHFINAVILIS 458

Query: 368 VISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQE 427
           V+SV NSA YS+ R+LLSLAE G  PKI++Y+DR+GRPLV +   ++FG+IAF A S +E
Sbjct: 459 VLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAFCATSPKE 518

Query: 428 ENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFF 487
           + VF WL AI+GLSQLFTW AI +SH+RFRRAM VQGRS+GELG+R+  G  GS YA   
Sbjct: 519 DEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIM 578

Query: 488 NVIVLIAQFWIAIAPIPKHG--ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSS 545
             ++LIAQFW+A+ PI      +LD + FF+NYLA P+L+ FY GYK+WK+D++L I + 
Sbjct: 579 MFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKKDWKLFIRAK 638

Query: 546 EVDLLSHRQIFDEEVLLQEEAERKERLR 573
            +DL+SHR IFDEE++ QEE E +ERLR
Sbjct: 639 NIDLISHRNIFDEELIKQEEDEYRERLR 666

>AGR038C [4348] [Homologous to ScYDR046C (BAP3) - SH; ScYBR068C
           (BAP2) - SH] (777535..779277) [1743 bp, 580 aa]
          Length = 580

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/542 (49%), Positives = 373/542 (68%), Gaps = 8/542 (1%)

Query: 36  RFTDSFKRAQVDTAVDLEGKDADNGLNKTQQT-LKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           RF DSF+R     + DLE    D  +N T  T L+  ++TRH               VA+
Sbjct: 34  RFVDSFRREDTSRSGDLE----DGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
             +LH+GGPAGL+IGY+  S + Y ++ A  E+ VAY TLPGN+NAY +  + K FGFA 
Sbjct: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
             ++ LQW TV PLEL+TA++ +KYW  SVN +VFV IFY+F++ IHFFG+RGY E EFI
Sbjct: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209

Query: 215 FNSLKVLLMAGFIIMAISLTAGA-SEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQA 273
           FN  KVL++ GF+I+ I +  GA  + GYIG +YW +PG+F     +D+ KG   V V A
Sbjct: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTA 269

Query: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA 333
            F++GG E  AL+  E  NP+ ++P A K+ +YR                 H+SD+L+ +
Sbjct: 270 YFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329

Query: 334 EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393
            G +    SP+V+A  +HGV+V+PHI+N +IL SVISVGNSAMYSAPR+L +LA+ G  P
Sbjct: 330 -GSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAP 388

Query: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453
           K   Y+DR+GRPL++LI  ++FGLIAF AAS+ +E +F WL+AIAGLS+LFTWT+I +SH
Sbjct: 389 KQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSH 448

Query: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEF 513
            RFR+AM++QGRSL  LGYRA TG  GS YA+FFN++V IAQFW+A+ PI K  ++DV  
Sbjct: 449 FRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKK-KVDVLS 507

Query: 514 FFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLR 573
           FFQNY+AFP+ ++ +LGY ++ R++ L+ P  ++DL +HR+++D EVL QEE E KER+R
Sbjct: 508 FFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMR 567

Query: 574 NS 575
           NS
Sbjct: 568 NS 569

>AFR698C [3891] [Homologous to ScYDR508C (GNP1) - SH; ScYCL025C
           (AGP1) - SH] (1725946..1727775) [1830 bp, 609 aa]
          Length = 609

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/550 (51%), Positives = 360/550 (65%), Gaps = 8/550 (1%)

Query: 29  GNRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           G+   + RF  SFKRA      D EG    N      + LK  IK+RH            
Sbjct: 54  GDDTRFKRFLSSFKRAHGSGGTDTEGGGGQNA---KHENLKQTIKSRHMIMISLGTGIGT 110

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V SG ALH GGPAG  IG++     +YCV+QA  EL V Y +L G +NAYP+FL+D 
Sbjct: 111 GLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGELAVCYTSLAGGFNAYPSFLIDP 170

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYW--TSSVNPDVFVAIFYVFLLFIHFFGSR 206
             GFA A VY LQW  V PLELVTAS+T+K+W  + SVNPD++VAIFYV ++ I+FFG+R
Sbjct: 171 ALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVNPDIYVAIFYVLIIVINFFGAR 230

Query: 207 GYAEAEFIFNSLKVLLMAGFIIMAISLTAGA-SEQGYIGGQYWHDPGAFGGDRAIDRFKG 265
           GYAEAEF FNS KVL+M GF I+ I +  GA    GYIGG+YW DPG+ GG    D FKG
Sbjct: 231 GYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIGGKYWRDPGSLGGRTHFDHFKG 290

Query: 266 ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXH 325
           I +  V AAF+ G SEF+ALTAAEQANPR+S+P A K+ +Y+                  
Sbjct: 291 IVATLVNAAFSLGCSEFVALTAAEQANPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPK 350

Query: 326 NSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
           +S +L+ +   S    SP+VIA  +HGV VVP  IN +IL SV+SVGNSA YS+ R+L S
Sbjct: 351 DSHELMGSND-SDLHVSPYVIAVRMHGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHS 409

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           LAE    PKIF Y+DR GRPL+ +I   LFG I FVAAS +EE VF WL AI+GLSQLFT
Sbjct: 410 LAEQNYAPKIFKYIDRAGRPLMAMIISILFGTICFVAASPKEEEVFKWLLAISGLSQLFT 469

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPK 505
           W+ I +SH+RFRRA+ VQG S  ELG++A TG +GSY +    V+ LI QFW+++ P+  
Sbjct: 470 WSTICLSHIRFRRALAVQGYSTDELGFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGA 529

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEE 565
             E D E FF  YLA P+ ++FY GYK+W +D+RL I + ++DL+SHR+IFD +VL QE+
Sbjct: 530 T-EPDAESFFTGYLAMPMFLLFYFGYKIWNKDWRLFIRADQIDLVSHRRIFDADVLKQED 588

Query: 566 AERKERLRNS 575
            E + +LRNS
Sbjct: 589 IEYRAKLRNS 598

>AGR040C [4350] [Homologous to ScYBR069C (TAT1) - SH]
           (782289..784010) [1722 bp, 573 aa]
          Length = 573

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/541 (50%), Positives = 372/541 (68%), Gaps = 19/541 (3%)

Query: 37  FTDSFKRAQVDTAVDLEGK-DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASG 95
           F DSF+R +    VDL  K DA++G   T   +K  IKTRH               V +G
Sbjct: 39  FIDSFRRGR---DVDLMCKADAEDG---TTAKMKKTIKTRHLLMITLGTGIGTGLLVGNG 92

Query: 96  KALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVA 155
            AL   GPAGL++GYV +S MLY +V+A  ELG+ Y+ + GNY AY + LVD   GF+V+
Sbjct: 93  SALAKAGPAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVS 152

Query: 156 LVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIF 215
            VY +QW TV PL+LVTA+M ++YWT  +NPD+FVAI Y  ++FI+ FG++GYAEAEF F
Sbjct: 153 WVYCIQWMTVFPLQLVTAAMIIQYWTD-INPDIFVAIIYAVIVFINLFGAKGYAEAEFFF 211

Query: 216 NSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAA 274
           N  KVL++ GF+I+ + +  G A   GYIG +YWH+P  F     ++ FKG+C V+  AA
Sbjct: 212 NLCKVLMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPF-----MNGFKGLCFVFCYAA 266

Query: 275 FAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAE 334
           FAYGG E + L+A+EQ NPR+S+  A K+ +YR                  +   L S  
Sbjct: 267 FAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLAS-- 324

Query: 335 GGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPK 394
              GSRASP VIA + HGV++VPHIIN +IL +V+SVGNS++YSAPR+LLSLAE G  PK
Sbjct: 325 --EGSRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPK 382

Query: 395 IFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHV 454
           IFTY+DRQGRPL       +FGL+AF+AAS  +++VF WL AI+GLSQ+F W +I +SH+
Sbjct: 383 IFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHI 442

Query: 455 RFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFF 514
           RFR AM+ QGRS+GE+GY+A TG  GS+ A+    ++LIAQFW+AI+P+   G +D   F
Sbjct: 443 RFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKG-VDARSF 501

Query: 515 FQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           FQ+YLAFP+L++ Y GYK++ +D+R+ IP+SEVDL+SHRQ+FDE+ L QE+ E K +L++
Sbjct: 502 FQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDEDELKQEDLEWKLKLKS 561

Query: 575 S 575
           S
Sbjct: 562 S 562

>YBR069C (TAT1) [259] chr2 complement(376534..378393) Amino acid
           permease that transports valine, leucine, isoleucine,
           tyrosine, tryptophan, and threonine, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1860 bp, 619 aa]
          Length = 619

 Score =  506 bits (1302), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 270/542 (49%), Positives = 362/542 (66%), Gaps = 17/542 (3%)

Query: 36  RFTDSFKRA-QVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
            F DSFKR    D   +LE ++ +N        L  +IK+RH               V +
Sbjct: 65  EFFDSFKRQLPPDRNSELESQEKNN--------LTKSIKSRHLVMISLGTGIGTGLLVGN 116

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
           G+ L   GPAGLV+GY   S MLYC++QA  ELG+ YA L GNY  YP+ LVD   GFAV
Sbjct: 117 GQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAV 176

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
           ++VY +QW TVLPL+LVTA+MTVKYWTS VN D+FVA+ +VF++ I+ FGSRGYAEAEFI
Sbjct: 177 SVVYTIQWLTVLPLQLVTAAMTVKYWTS-VNADIFVAVVFVFVIIINLFGSRGYAEAEFI 235

Query: 215 FNSLKVLLMAGFIIMAISLTAG-ASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQA 273
           FNS K+L++ GF+I+AI +  G A ++ YIG +YWH+PG F        FKG+C+V+  A
Sbjct: 236 FNSCKILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFA-----HGFKGVCTVFCYA 290

Query: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA 333
           AF+YGG E + L+AAEQ NP +S+P A K+ +YR                 +NSD+LL +
Sbjct: 291 AFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGS 350

Query: 334 EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393
              SGS ASPFVIA A HGV+VVPH IN +IL SVISV NS++YS PR+LLSLAE G+ P
Sbjct: 351 SDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLP 410

Query: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453
           K   YVDR GRPL+      +FG I FVA S+ EE VFTWL AI+ LSQLF W ++++SH
Sbjct: 411 KCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSH 470

Query: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEF 513
           +RFR AM  QGRS+ E+GY+A TG  GS+ A+   +  L+ QFW+AIAP+ +HG+L+V+ 
Sbjct: 471 IRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKV 530

Query: 514 FFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQ-EEAERKERL 572
           FFQNYLA P+++  Y G+K++ + +   IP+ ++DL SHR IF    L + ++ +  + L
Sbjct: 531 FFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDL 590

Query: 573 RN 574
           + 
Sbjct: 591 KE 592

>Scas_718.41
          Length = 614

 Score =  471 bits (1213), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 249/529 (47%), Positives = 344/529 (65%), Gaps = 20/529 (3%)

Query: 32  NAWTRFTD---SFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           NA T F D   SFKR   D   D+E +D           L   IK+RH            
Sbjct: 71  NAKTYFQDFCHSFKRKDSDLDSDVEAQDTQ---------LSKTIKSRHLLMISLGTGIAT 121

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V +G+ L   GPAGL+IGY  +S M+YC++ A  ELG+ Y  L GN+  YP+ L+D 
Sbjct: 122 GLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDP 181

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
             GFA++L+Y LQW TVLPL+LVTA++T+ +WT  VNPD+FV   ++ ++ ++ FG+RGY
Sbjct: 182 SLGFAISLLYTLQWLTVLPLQLVTAAITISFWTD-VNPDIFVLCVFIVVIIVNLFGARGY 240

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
           AE EF  N  K+L++ GFII++I + T GA + GYIG +YW  PG F        FKG+C
Sbjct: 241 AETEFFCNCCKILMITGFIILSIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVC 295

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           +V+  AAF+YGG E + L+  EQ +P  +VP A K+ +YR                 ++S
Sbjct: 296 TVFTYAAFSYGGIEVVVLSIDEQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDS 355

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
             LL +     S ASPFVIA   HGV+VVPH IN +IL SVISV NS++YS+ R+LLSL+
Sbjct: 356 PNLLGSSHSG-SHASPFVIAIESHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLS 414

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           E G  P+   ++D  GRP+   I   LFG+I FVAAS++ E+VFTWL AI+GLSQLF W 
Sbjct: 415 EQGSLPQWLNFIDMNGRPIRCFIISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWM 474

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
           ++++SH+R R AM+ QG+SL E+GY+A TG  GS+ A+F     L+ QFW+AIAP+ KHG
Sbjct: 475 SMSLSHIRLRDAMKSQGKSLDEIGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHG 534

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIF 556
           ELDV  FFQNYLAFP+++V YLG+K++ +++RL IP+ ++DL SHR+I+
Sbjct: 535 ELDVVNFFQNYLAFPIVLVAYLGHKIYYKNWRLWIPADKIDLDSHRRIY 583

>Kwal_27.12681
          Length = 593

 Score =  454 bits (1167), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 238/546 (43%), Positives = 344/546 (63%), Gaps = 8/546 (1%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGKDADN-GLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           +++ W  F D FKR +++  +D    +A+   +   Q  L+ ++K RH            
Sbjct: 39  SKSRWQDFKDGFKRVELEE-LDPNLTEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGT 97

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V SGKAL  GGPAG++IG+     M+YCVV +  EL V +  + G +  Y T  VD+
Sbjct: 98  GLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFP-VSGGFTTYATRFVDE 156

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYW-TSSVNPDVFVAIFYVFLLFIHFFGSRG 207
            FGFA+   Y LQW  VLPLE+V AS+TV +W T     D FVA+FY+ ++ I+FFG RG
Sbjct: 157 SFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRG 216

Query: 208 YAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGI 266
           Y EAEF+F+ +KV+ + GFII+ I L  G    G   G +YWH+PGAF GD A  RFKG+
Sbjct: 217 YGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGV 276

Query: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHN 326
           CSV+V AAF++ G+E + L +AE ANPR+++P+A K+  +R                 H 
Sbjct: 277 CSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHT 336

Query: 327 SDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSL 386
           S++L+       + ASPFV+A   HG++ +P +IN +IL SV+SVGNSA+Y+  R +++L
Sbjct: 337 SERLIGTSSVDAA-ASPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVAL 395

Query: 387 AEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTW 446
           AE G  P IF Y+DR+GRPLV +I   +FGL++F+A S +E +VF WL A++GLS LF+W
Sbjct: 396 AEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSW 455

Query: 447 TAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKH 506
            AI + H+RFRRA+  QGRS  EL + +  G  GSY+ +   ++VLIAQFW+A+ PI   
Sbjct: 456 GAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPI--G 513

Query: 507 GELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEA 566
           G  + E FF  YL+FPVL+ FY+ +K+WKR+++L   + ++D+ + R+  D E L QE A
Sbjct: 514 GSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIA 573

Query: 567 ERKERL 572
           E K  L
Sbjct: 574 EEKMLL 579

>YKR039W (GAP1) [3292] chr11 (514705..516513) General amino acid
           permease, proton symport transporter for all
           naturally-occurring L-amino acids, 4-aminobutyric acid
           (GABA), ornithine, citrulline, some D-amino acids, and
           some toxic analogs [1809 bp, 602 aa]
          Length = 602

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 240/548 (43%), Positives = 345/548 (62%), Gaps = 8/548 (1%)

Query: 25  IEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQT-LKHNIKTRHXXXXXXX 83
           I+  G+ + W  F DSFKR +    VD    +A+     T QT LKH++K RH       
Sbjct: 43  IDETGSGSKWQDFKDSFKRVK-PIEVDPNLSEAEKVAIITAQTPLKHHLKNRHLQMIAIG 101

Query: 84  XXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPT 143
                   V SG AL  GGPA L+IG+ +T TM+Y +V A  EL V +  + G +  Y T
Sbjct: 102 GAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFP-ISGGFTTYAT 160

Query: 144 FLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYW-TSSVNPDVFVAIFYVFLLFIHF 202
             +D+ FG+A    Y LQW  VLPLE+V+AS+TV +W T     D FVA+F++ ++ I+ 
Sbjct: 161 RFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWLAIVIINM 220

Query: 203 FGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAID 261
           FG +GY EAEF+F+ +KV+ + GFII+ I L  G    G   G +YWHDPGAF GD    
Sbjct: 221 FGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAFAGDTPGA 280

Query: 262 RFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXX 321
           +FKG+CSV+V AAF++ GSE + L A+E   PR+SVPKA K+  +R              
Sbjct: 281 KFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGL 340

Query: 322 XXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPR 381
              +N   L+ A     + ASPFVIA   HG++ +P ++N +IL +V+SVGNSA+Y+  R
Sbjct: 341 LVPYNDKSLIGASSVDAA-ASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSR 399

Query: 382 ILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLS 441
            +++LAE    P+IF+YVDR+GRPLV +   S FGLIAFVAAS +E  VF WL A++GLS
Sbjct: 400 TMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLS 459

Query: 442 QLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIA 501
            LFTW  I + H+RFR+A+  QGR L EL +++ TG  GSY+ +F  +I+ IAQF++A+ 
Sbjct: 460 SLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVF 519

Query: 502 PIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVL 561
           P+        E FF+ YL+FP+++V Y+G+K++KR+++L IP+ ++D+ + R+  D ++L
Sbjct: 520 PVGDSP--SAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLL 577

Query: 562 LQEEAERK 569
            QE AE K
Sbjct: 578 KQEIAEEK 585

>Sklu_2029.2 , Contig c2029 2095-3891
          Length = 598

 Score =  431 bits (1109), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 231/531 (43%), Positives = 323/531 (60%), Gaps = 16/531 (3%)

Query: 35  TRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           T  +DS +    D+     GK          + LK +IK  H               V +
Sbjct: 40  TLISDSSEDITNDSTT---GKTEKGHTGSENEKLKQSIKPYHVFMITMATGIGTGLLVGN 96

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
           GK++   G  G ++GY    +ML C +Q+  EL VA+ +L G +N+Y    VD  FGF V
Sbjct: 97  GKSISDAGVGGTLVGYFIIGSMLVCCMQSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTV 156

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
           A ++ LQW  VLPLELVTASMT+KYW +S+NP +FVAIFY  +L I FFG+RGYA+AEF+
Sbjct: 157 AWLFCLQWQIVLPLELVTASMTIKYWNNSLNPSIFVAIFYSLILGISFFGARGYADAEFL 216

Query: 215 FNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQA 273
           FN  KVL++ GFII+ I ++ GA+   GYIG +Y   PGAF      + FK ICS  V A
Sbjct: 217 FNLSKVLMITGFIILGIIISFGAAGTSGYIGIKYLKTPGAF---NTRNTFKSICSTLVNA 273

Query: 274 AFAYGGSEFIALTAAEQA--NPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL 331
            F+ GG EF+AL+AAEQA  N  +S+ +A  + L R                 +NS +L+
Sbjct: 274 CFSCGGVEFLALSAAEQARGNISKSIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELM 333

Query: 332 SAEGGSGSR---ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAE 388
               GS S    +SP+VIA A HGV+VVPH+IN +IL +V+SV NSAMYS+ R L +LAE
Sbjct: 334 ----GSSSEIIHSSPYVIAVASHGVKVVPHLINAVILIAVVSVANSAMYSSSRTLHALAE 389

Query: 389 HGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTA 448
            G  P  F  +D +GRP   L+   +FGL++F+A    +E+VF WL +I+GLS +FTWT 
Sbjct: 390 QGFAPSYFAKLDSKGRPFRCLVVSGVFGLLSFIAEYKDQESVFVWLLSISGLSTIFTWTM 449

Query: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGE 508
           I V+H+RFR AM+ Q  SL ELG+RA +G  GSYY I  N + L+ QFW+++ P+   G 
Sbjct: 450 ICVAHLRFRAAMKDQNHSLEELGHRAWSGIYGSYYVIAINSLTLVVQFWVSLFPLDGDGR 509

Query: 509 LDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEE 559
            D   FFQNY+A P  +  Y+G+K++ R ++ +IP+ ++D+ + R I+  E
Sbjct: 510 PDFVNFFQNYMAVPFALCLYVGHKIYTRSWQFIIPADKIDVDTSRDIYGVE 560

>CAGL0L03267g 372787..374580 highly similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 597

 Score =  431 bits (1107), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 242/542 (44%), Positives = 335/542 (61%), Gaps = 8/542 (1%)

Query: 34  WTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQT-LKHNIKTRHXXXXXXXXXXXXXXXV 92
           W +F DSFK        D +  D +   ++T    LKH++K RH               V
Sbjct: 47  WRKFKDSFKPLDEAVVTD-DMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFV 105

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            SG AL   GPAG++IG+  T TM+YC+V A  EL V +  + G +  Y T  +D+ FGF
Sbjct: 106 GSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFP-ISGGFTTYATRFIDESFGF 164

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYW-TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEA 211
           A    Y LQW  VLPLE+V AS+TV YW T     D FVA+F+V ++ I+ FG +GY EA
Sbjct: 165 ANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGVKGYGEA 224

Query: 212 EFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVW 270
           EF+F+ +KVL + GFIIM I L  G   +G   G +Y+HDPGAF GD A  RF+G+CSV+
Sbjct: 225 EFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVF 284

Query: 271 VQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQL 330
           V AAF++ GSE I + AAE A PR+SVPKA K+  +R                 +  ++L
Sbjct: 285 VTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERL 344

Query: 331 LSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG 390
           + A     + ASPFVIA   HG+R +P ++N +IL +V+SVGNSA+Y   R L +LA+  
Sbjct: 345 IGASSVDAA-ASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQN 403

Query: 391 MCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIA 450
             PKIF Y+DR GRPL  + F S FGL+AFVA S +E  VF WL A++GLS LFTW  I 
Sbjct: 404 FLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGIC 463

Query: 451 VSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELD 510
             H+RFR A+  QGRS  EL ++A  G  GS + +F  V++ +AQF++A+   P  G+  
Sbjct: 464 FCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVAL--FPPGGKPS 521

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKE 570
            E FFQ+YL+FPV++ FY G+KL+ R+++L+IP S++D+ + R+  D +VL QE AE K+
Sbjct: 522 AEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQ 581

Query: 571 RL 572
            +
Sbjct: 582 MM 583

>AFR230C [3422] [Homologous to ScYKR039W (GAP1) - NSH]
           (855416..857230) [1815 bp, 604 aa]
          Length = 604

 Score =  427 bits (1097), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 225/548 (41%), Positives = 332/548 (60%), Gaps = 9/548 (1%)

Query: 31  RNAWTRFTDSFKRAQVDTAVDLEGKDADN-GLNKTQQTLKHNIKTRHXXXXXXXXXXXXX 89
           R  W  F D+F+RA++   +D    +A+   +      L   +K RH             
Sbjct: 46  RKGWNGFVDTFRRAEMPV-IDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVG 104

Query: 90  XXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149
             V SGKAL   GPAG++IG+  T+TM+  +  +  EL V +  + G Y  Y    +D+ 
Sbjct: 105 LFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFP-VSGGYITYAARFIDES 163

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDV-FVAIFYVFLLFIHFFGSRGY 208
           +GFA    Y +Q   V+PLE+V AS+TV YW +     + FVA+F+V ++ I+ FG RG+
Sbjct: 164 WGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLFGVRGF 223

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            EAE IF+ +KV+ + GFIIM + L + G  +   IGG+YW+DPG F G+   D+FKG+C
Sbjct: 224 GEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVC 283

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           SV+V AAF++ GSE I L AAE   PR+S+PKA K+  +R                  N+
Sbjct: 284 SVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNN 343

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
           + LL+ +    +  SPFVIA  +H +RV+P IIN +ILT+VISVGNS++YS+ R + +LA
Sbjct: 344 EHLLAPQQIDAAH-SPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALA 402

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           EHG  PKIF Y+DR+GRPL  + F SLFGL+ FVA + +E  +F WL AI+GLS  FTW 
Sbjct: 403 EHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWL 462

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
            I ++H+RFR A++ QGR+  EL + + TG +GS YA+    +VL+AQFW+A+ P    G
Sbjct: 463 TINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDG 522

Query: 508 ---ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQE 564
              +     FF+ YL+F V +V YL +K+W R+++  I + E+D+ + R+  D E+  +E
Sbjct: 523 TSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEE 582

Query: 565 EAERKERL 572
            A+ +  L
Sbjct: 583 LAQERALL 590

>Sklu_2390.1 YGR191W, Contig c2390 5453-7270 reverse complement
          Length = 605

 Score =  423 bits (1087), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 213/541 (39%), Positives = 330/541 (60%), Gaps = 10/541 (1%)

Query: 40  SFKRAQVDTAVDLEGK-----DADNGLNKT--QQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
           S K +  D+  +++       D +N +  T     L  ++  RH               V
Sbjct: 53  SLKSSSFDSKENIKSDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFV 112

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            SG +L+ GGPA L++ +V  ST L+ +V A  EL   +  + G +N Y T  V+  FGF
Sbjct: 113 NSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVV-GGFNVYITRFVEPSFGF 171

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212
           AV + Y  QWA +LPLELV AS+T++YW +++N D +VAIFY  +   +    + + E E
Sbjct: 172 AVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETE 231

Query: 213 FIFNSLKVLLMAGFIIMAISLTAGASEQG-YIGGQYWHDPGAFGGDRAIDRFKGICSVWV 271
           F+ + +K+L + GF I+ I L  G    G YIGG+YW+DPGAF GD    RFKG+C+V+V
Sbjct: 232 FVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPGRRFKGVCAVFV 291

Query: 272 QAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL 331
            AAF+Y G+E +A++AAE  NPR ++PKA+KR  +                  +N ++LL
Sbjct: 292 TAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLL 351

Query: 332 SAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGM 391
           +      + ASP VIA    G++ +P ++N IIL +++SV NSA+Y+  R ++++AE G 
Sbjct: 352 NGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGN 411

Query: 392 CPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAV 451
            PK   Y+D++GRPL  +    +FGL++F+AAS+++E VFTWLSA++GLS LF W +I +
Sbjct: 412 LPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINL 471

Query: 452 SHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDV 511
           SH+RFR+AM+ Q RSL EL + + TG  GS+Y      +VLIA FW ++ P+   G  D 
Sbjct: 472 SHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGA-DA 530

Query: 512 EFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKER 571
           E FF+ YL+ P+ +V YLG+K++K+D+RL + + ++DL + R+  D ++L QE    +E+
Sbjct: 531 ESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQ 590

Query: 572 L 572
           +
Sbjct: 591 M 591

>ADL272W [1469] [Homologous to ScYDR508C (GNP1) - NSH]
           complement(227416..229110) [1695 bp, 564 aa]
          Length = 564

 Score =  418 bits (1075), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 213/495 (43%), Positives = 311/495 (62%), Gaps = 10/495 (2%)

Query: 67  TLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCE 126
           +L+ +IK RH               V +GK++   G  G +IGY+    M+ C +Q+  E
Sbjct: 24  SLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQSVGE 83

Query: 127 LGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNP 186
           L VA+ +L G +N+Y    +D   GF V+ ++ LQW  VLPLELVTASMT+KYW S+++P
Sbjct: 84  LVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSNLSP 143

Query: 187 DVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISL-TAGASEQGYIGG 245
            +FV+ FY+ +  ++FFGS GYAEAEFIFN +KV+++A FI++ I + T G    G IG 
Sbjct: 144 SLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGPIGF 203

Query: 246 QYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWL 305
           QY   PGAF  +  +  FK      V AAF+ GG EF+AL+AAEQ   R+++PK+ +R  
Sbjct: 204 QYLKTPGAFNTNYNV--FKATAGTLVNAAFSCGGVEFLALSAAEQN--RDNMPKSIRRAC 259

Query: 306 ----YRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIIN 361
                R                 ++S  L+   G   +  SP+V A ALHGVR+VPHIIN
Sbjct: 260 RQVSIRMFVFYLLSISVVGLLVPYDSPMLM-GSGSDTTHTSPYVAAIALHGVRIVPHIIN 318

Query: 362 FIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFV 421
            +IL +V+SV NSAMYS+ R L SLAE    P+ F  +++ G+P+  L+  ++ GLI+F+
Sbjct: 319 AVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGLISFI 378

Query: 422 AASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGS 481
           A    +E VF WL +I+GLS +FTWT I ++H+RFR A+++QG+SL  LGYR+NTG +GS
Sbjct: 379 AEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTGVIGS 438

Query: 482 YYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLV 541
           Y A   NV+V+I QFW+++ P+  +G+ D   FFQNY+A PV V+ YLG+KL+  D+   
Sbjct: 439 YIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTNDWTPW 498

Query: 542 IPSSEVDLLSHRQIF 556
           I +  VD+ + R ++
Sbjct: 499 IRTHCVDINTDRDVY 513

>KLLA0A06886g complement(621646..623409) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, start by similarity
          Length = 587

 Score =  415 bits (1066), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 234/539 (43%), Positives = 329/539 (61%), Gaps = 13/539 (2%)

Query: 34  WTRFTDSFKRAQVDTAVDLEGKDADN-GLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
           W RF DSFKRA     +D    DA+   +      LK  +K+RH               V
Sbjct: 42  WERFRDSFKRADTQD-LDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFV 100

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            SGKAL   GPAG++IG+  T TM+YC+V A  EL V +  + G +  Y +  VD+ FGF
Sbjct: 101 GSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-IAGGFTTYASRFVDESFGF 159

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYW-TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEA 211
           A   +Y LQW  VLPLE+V AS+TV YW T     D FVA+FYV ++ I+FFG +GY EA
Sbjct: 160 AFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGEA 219

Query: 212 EFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVW 270
           EFIF+ +KV+ + G+II+ + L  G   QG   G + WH+PGAF      + FKG+CSV+
Sbjct: 220 EFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA-----NGFKGVCSVF 274

Query: 271 VQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQL 330
           V AAF++ GSE + L AAE ANPR+S+P A K+  +R                 + SD+L
Sbjct: 275 VTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL 334

Query: 331 LSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG 390
           +  +    + ASPFVI+    G++ +P +IN +IL +V+SVGNSA+++  R + +LA  G
Sbjct: 335 I-GQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQG 393

Query: 391 MCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIA 450
             PKIF Y+DR GRPLV +I   +FGL++F+AAS +E  VF WL A++GLS LFTW  I 
Sbjct: 394 SLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIM 453

Query: 451 VSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELD 510
           + H+R RRA+  Q R+  EL + A TG  GS Y     +++L+AQFWIA+ PI       
Sbjct: 454 LCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGDKPSAS 513

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569
              FF+ YL+FP+L+ FY+G+K+WK++++L I +  +D+ + R+  D E L QE AE K
Sbjct: 514 A--FFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

>AGR319W [4630] [Homologous to ScYGR191W (HIP1) - SH]
           complement(1327939..1329819) [1881 bp, 626 aa]
          Length = 626

 Score =  413 bits (1061), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/567 (39%), Positives = 331/567 (58%), Gaps = 29/567 (5%)

Query: 30  NRNAW-TRFTDSFKRAQ--------VDTAVDLEGKD-----------ADNGLNKTQQTLK 69
            ++ W TR  + FKRA          D+ ++++GK             D   N +Q  L 
Sbjct: 53  QKDVWYTRLLNDFKRADEGETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQ--LS 110

Query: 70  HNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGV 129
            N+  RH               V SG +L+ GGP  ++I +   ST L+ +V +  EL  
Sbjct: 111 KNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELAS 170

Query: 130 AYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVF 189
           A+  + G +N Y T  V+  FGFAV + Y  QWA +LPLEL  AS+T+KYW + +N D +
Sbjct: 171 AFPVV-GGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKINSDAW 229

Query: 190 VAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG-GQYW 248
           VAIFYV +   +    + + E EF+ + +K+L + GF I+   L  G    G     +YW
Sbjct: 230 VAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYW 289

Query: 249 HDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRX 308
           HDPGAF GD    +FKG+CSV+V AAF+Y G+E + ++AAE  NPR ++P+A+KR  +  
Sbjct: 290 HDPGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLI 349

Query: 309 XXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSV 368
                            N  +LL+        ASP VIA    G+R VP ++N IIL ++
Sbjct: 350 TSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLMNAIILIAI 409

Query: 369 ISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEE 428
           ISV NS++Y+  R ++S+A+ G  PK+F Y+DR+GRPLV ++   +FGL++FVAAS+++E
Sbjct: 410 ISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQE 469

Query: 429 NVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFN 488
            +FTWLSA++GLS LF W AI +SH+RFRRAM  Q RSL EL Y + TG LGS+Y     
Sbjct: 470 AIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVL 529

Query: 489 VIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVD 548
           + VL+  FW ++ P P       E FF+ YL+FP+ ++ Y+ +KL+KRD+RL IP+ ++D
Sbjct: 530 LFVLVLSFWTSLFP-PGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQID 588

Query: 549 LLSHRQIFDEEVL----LQEEAERKER 571
           + S R+  D E L    L+E+AE  ++
Sbjct: 589 VDSGRRALDIEELKEQKLREQAETAKK 615

>Kwal_33.15407
          Length = 587

 Score =  411 bits (1057), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 227/573 (39%), Positives = 327/573 (57%), Gaps = 31/573 (5%)

Query: 31  RNAWTRFTDSFKRAQV-------------DTAVDLEGKDADNG-----LNKTQQT----- 67
           +++W R  DSFK A+                A D +  DA +G     L   + T     
Sbjct: 5   QSSWQRMLDSFKPAETYKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSD 64

Query: 68  -----LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQ 122
                   ++  RH               V SG AL  GGP  LVI +V  ST L+ +V 
Sbjct: 65  AEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVN 124

Query: 123 ACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS 182
           A  EL   +  + G +N Y +  V+  FGFAV L Y  QWA +LPLELV AS+T++YW S
Sbjct: 125 ALGELSSTFPVV-GGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNS 183

Query: 183 SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGY 242
           ++N D +VAIFY  +   +    + + E EF+ + +K+L + GF I+ I LT G   +G 
Sbjct: 184 TINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGG 243

Query: 243 IGG-QYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKAT 301
             G +YW +PGAF G+ +  RF G+CSV+V AAF+Y G+E IA++AAE  NPR ++PKA 
Sbjct: 244 YIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKAC 303

Query: 302 KRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIIN 361
           KR  +                   +  +LL         ASP VIA    G++ +P ++N
Sbjct: 304 KRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMN 363

Query: 362 FIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFV 421
            IIL +V+SV NSA+Y+  R + S+A  G  PK F+YVDR+GRPL  ++   +FGL++F+
Sbjct: 364 AIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFI 423

Query: 422 AASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGS 481
           AASN++E VFTWLSA++GLS LF W AI VSH+RFR  M+ +GRSL EL + + TG  GS
Sbjct: 424 AASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGS 483

Query: 482 YYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLV 541
           YY      +VL+  FW A+ P    G    E FF+ YL+FP+L+V Y+G+KL+ + +RL+
Sbjct: 484 YYGCVIIFVVLVVCFWTALFP-STEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLL 542

Query: 542 IPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
            P++E+D+ S R+  D EVL  E+   ++ +R 
Sbjct: 543 TPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMRE 575

>Kwal_33.14276
          Length = 596

 Score =  402 bits (1032), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 223/549 (40%), Positives = 325/549 (59%), Gaps = 28/549 (5%)

Query: 37  FTDSFKRAQVDTAVDLEGKDADNGLNKTQQT--------LKHNIKTRHXXXXXXXXXXXX 88
           F D F+  ++D        D D  L+ T++         LK ++K RH            
Sbjct: 53  FVDGFREYKLD--------DVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGT 104

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V SGKAL  GGPA +++ ++ T +M+Y VVQA  EL VA   + G+Y +Y +  +D 
Sbjct: 105 GLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGELCVALP-VSGSYLSYVSRFIDP 163

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVN-PDVFVAIFYVFLLFIHFFGSRG 207
            FGFA+A  Y +     +PLE+V AS+TV YW       D FVA+FYV +L I+F G +G
Sbjct: 164 SFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKG 223

Query: 208 YAEAEFIFNSLKVLLMAGFIIMAISLTAG--ASEQGYIGGQYWHDPGAFGGDRAIDRFKG 265
           Y EAEF+F+ +KVL + GFII+ I L  G  ++  GYIG +YWH+PG F        FKG
Sbjct: 224 YGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFA-----HGFKG 278

Query: 266 ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXH 325
             +++V +AF++ GSE  AL AAE  NPR  +PKA K+  +R                 +
Sbjct: 279 FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPY 338

Query: 326 NSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
            +  L ++     + ASPFVIA    G+  +P +IN +IL +V+SVGN+ ++++ R  LS
Sbjct: 339 TNKHLFASSSVD-ASASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLS 397

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           LA +G  PK F YVDR+GRPL  LI   +FGL++F+++S  +  VF W+ A++GL   FT
Sbjct: 398 LAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFT 457

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPK 505
           W +I V H+RFR+ +R QGRS  EL ++A TG  GS Y I    +VL  QFW+A+ P+ K
Sbjct: 458 WGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPLSK 517

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEE 565
                   FF+ YL+ PV++VFY+G+K++ R++RLVIP+ E+DL + R+  D E+L QE 
Sbjct: 518 SP--SAYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEI 575

Query: 566 AERKERLRN 574
            E  E +R+
Sbjct: 576 KEENESIRS 584

>KLLA0A06930g complement(625498..627261) similar to sp|P19145
           Saccharomyces cerevisiae YKR039w GAP1 general amino acid
           permease, hypothetical start
          Length = 587

 Score =  401 bits (1030), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/539 (42%), Positives = 329/539 (61%), Gaps = 13/539 (2%)

Query: 34  WTRFTDSFKRAQ-VDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
           W RF DSF+ A+ VD    L   +    +      LK  +K+RH               V
Sbjct: 42  WERFKDSFREAETVDLDPSLTPAE-KMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFV 100

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            SGK+L   GPAG++IG+  T TM+YC+V A  EL V +  + G Y  Y +  VD+ FGF
Sbjct: 101 GSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFP-VAGGYTTYASRFVDESFGF 159

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYW-TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEA 211
           A   VY + W   LPLE+V AS+TV YW T +   D FVA+FYV ++ I+ FG +GY EA
Sbjct: 160 AFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEA 219

Query: 212 EFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVW 270
           EFIF+ +KV+ + GFII+ + L  G   QG   G + WH+PGAF      + FKG+CSV+
Sbjct: 220 EFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFA-----NGFKGVCSVF 274

Query: 271 VQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQL 330
           V AAF++ GSE + L AAE ANPR+S+P A K+  +R                 + SD+L
Sbjct: 275 VTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL 334

Query: 331 LSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG 390
           +  +    + ASPFVI+    G++ +P +IN +IL +V+SVGN A++   R + +LA  G
Sbjct: 335 I-GQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQG 393

Query: 391 MCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIA 450
             PKIF Y+DR GRPLV ++   +FGL++F+AAS +E  VF WL A++GLS LFTW  I 
Sbjct: 394 SLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIL 453

Query: 451 VSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELD 510
           + H+R RRA+  Q R+  EL + A T   GS Y++   +++LIAQFWIA+ PI   G+  
Sbjct: 454 LCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPI--GGKPS 511

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569
              FF+ YL+FP+ +VFY+G+K+WK++++L I +S++D+ S R+  D E L QE AE K
Sbjct: 512 AAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEK 570

>CAGL0B03773g 373956..375773 highly similar to sp|P06775
           Saccharomyces cerevisiae YGR191w HIP1 Histidine
           permease, start by similarity
          Length = 605

 Score =  394 bits (1011), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 208/534 (38%), Positives = 312/534 (58%), Gaps = 8/534 (1%)

Query: 25  IEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXX 84
           +  +GN +     T  + R   D     E       +N T   L  ++  RH        
Sbjct: 50  VSSSGNDDILKGDTKEYPR---DVKATPEAASYVEDINNTN--LNKDLSVRHLLTLAVGG 104

Query: 85  XXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTF 144
                  V SG +L  GGPA LVIG+V  ST L+ V+ +  EL  A+  + G +N Y T 
Sbjct: 105 AIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVV-GGFNVYITR 163

Query: 145 LVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFG 204
            ++  F FA+ L Y  QW  +LPLELV AS+T++YW   +N D +VAIFY  +   +   
Sbjct: 164 FIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLD 223

Query: 205 SRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRF 263
            + + E EFI + +K+L + GF I+ I LT G    G   G +YWH+PGAF G  A  +F
Sbjct: 224 VKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQF 283

Query: 264 KGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXX 323
           KG+CSV+V AAF+Y G E  A++AAE  NP+E++PKA KR  +                 
Sbjct: 284 KGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLV 343

Query: 324 XHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRIL 383
            +N  +LL+      + ASP VIA    G++ +P ++N IIL +++SV NSA+Y+  R +
Sbjct: 344 PYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCM 403

Query: 384 LSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQL 443
           +S+A  G  PK  + VD++GRPL  ++    FGL++F+AAS+++E VFTWLSA++GLS +
Sbjct: 404 VSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTI 463

Query: 444 FTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPI 503
           F W AI +S +RFR AM+ QGRSL E+ + + +G  G++Y +    +VL+A FW ++ P+
Sbjct: 464 FCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPV 523

Query: 504 PKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD 557
                   + FF+ YL+ P+L+  Y+G+KLWKRD+RL++P  E+DL S R++ D
Sbjct: 524 -GSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>KLLA0A11770g 1014918..1016663 similar to sp|P06775 Saccharomyces
           cerevisiae YGR191w HIP1 histidine permease, start by
           similarity
          Length = 581

 Score =  391 bits (1004), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 208/514 (40%), Positives = 298/514 (57%), Gaps = 3/514 (0%)

Query: 62  NKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVV 121
           N     L  ++  RH               V SG +L  GGPA LVI +   ST L+ +V
Sbjct: 58  NTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIV 117

Query: 122 QACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWT 181
            +  EL   +  + G +N Y T  V+  FGFAV   Y  QWA +LPLEL  AS+T++YW 
Sbjct: 118 NSLGELSATFPVV-GGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWN 176

Query: 182 SSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQG 241
            S+NPD +V+IFYV + F +    + + E EF+ + +K+L + GF I+ I L  G    G
Sbjct: 177 KSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSG 236

Query: 242 YIGG-QYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA 300
              G +YW+DPGAF GD    RFKG+ +V++ AAF+Y G E + ++AAE  NPR ++PKA
Sbjct: 237 GFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKA 296

Query: 301 TKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHII 360
            KR  +                   N   LL+      + ASP VIA    G++ +P ++
Sbjct: 297 AKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLM 356

Query: 361 NFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAF 420
           N IIL +++SV NSA+Y+  R ++S+AE G  P+   +VD++GRPL  +    L GL++F
Sbjct: 357 NAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSF 416

Query: 421 VAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALG 480
           +AASN+ + VFTWLSA++GLS LF W AI ++H+RFR AM+ Q RSL EL Y + TG  G
Sbjct: 417 IAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWG 476

Query: 481 SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL 540
           S+Y      +VLIA FW ++ P   +G  D   FF++YL+ P+ +  YLG+K+WKR+ RL
Sbjct: 477 SWYGCIVIGLVLIASFWTSLFPAGGNGA-DATSFFESYLSLPIFIACYLGHKIWKRNLRL 535

Query: 541 VIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
            I  SEVD+ S R   D   L QE+    E ++ 
Sbjct: 536 YIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKT 569

>YGR191W (HIP1) [2141] chr7 (880423..882234) Histidine permease,
           member of the amino acid permease family of membrane
           transporters [1812 bp, 603 aa]
          Length = 603

 Score =  387 bits (995), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/521 (39%), Positives = 306/521 (58%), Gaps = 14/521 (2%)

Query: 38  TDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKA 97
           +D F+R +     D E +D +N        L  ++  RH               V +G A
Sbjct: 67  SDRFRRNE-----DTEQEDINN------TNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAA 115

Query: 98  LHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALV 157
           L  GGPA LVI +V  ST L+ V+ +  EL  A+  + G +N Y    ++  F FAV L 
Sbjct: 116 LSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVV-GGFNVYSMRFIEPSFAFAVNLN 174

Query: 158 YGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNS 217
           Y  QW  +LPLELV AS+T+KYW   +N D +VAIFY  +   +    + + E EF+ + 
Sbjct: 175 YLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSM 234

Query: 218 LKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVWVQAAFA 276
           +K+L + GF I+ I L+ G    G   G +YWHDPGAF G  +  +FKG+CSV+V AAF+
Sbjct: 235 IKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFS 294

Query: 277 YGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGG 336
           Y G E  A++AAE  NPRE++PKA KR  +                   N  +LL+    
Sbjct: 295 YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSS 354

Query: 337 SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396
             + +SP VIA    G++ +P ++N IIL +V+SV NSA+Y+  R ++++A  G  PK  
Sbjct: 355 VDAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFL 414

Query: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456
             VD++GRP+  ++    FGL++FVAAS+++  VFTWLSA++GLS +F W AI +SH+RF
Sbjct: 415 NRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRF 474

Query: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516
           R+AM+VQ RSL EL + + TG  GS+Y      +VLIA FW ++ P+   G    E FF+
Sbjct: 475 RQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGA-SAESFFE 533

Query: 517 NYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD 557
            YL+FP+L+V Y+G+KL+ R++ L++   ++DL + R+  D
Sbjct: 534 GYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>KLLA0F01012g complement(90772..92442) similar to sp|P48813
           Saccharomyces cerevisiae YDR508c GNP1 high-affinity
           glutamine permease, hypothetical start
          Length = 556

 Score =  383 bits (984), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 306/529 (57%), Gaps = 19/529 (3%)

Query: 33  AWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
            ++  +D  +   +DT        AD  L K +  LK +IK  H               V
Sbjct: 11  TFSNLSDPTRTNSIDTT-------ADVTLPKNE--LKQSIKPFHVFMMSTATGIGTGLLV 61

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            +G+++   G  G ++GY+    ML C +Q   EL VA+ ++PG + +Y    +D   GF
Sbjct: 62  GNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVGELVVAFPSMPGGFTSYGKRFIDPSVGF 121

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212
            ++ ++ L W  VLPLE+  ASMT+ +W  ++NP + VA+ Y  +  ++FFG+R YA+A+
Sbjct: 122 TISWLFFLNWTVVLPLEICVASMTINFWNENINPSIVVALCYSLVCGVNFFGARCYADAD 181

Query: 213 FIFNSLKVLLMAGFIIMAISLTAGA-SEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWV 271
            IFN LKVL++ GFII+ I +  G     GY+G +Y+H PG F  D  +  FK I +  +
Sbjct: 182 CIFNCLKVLMILGFIILGIFVNTGVVGTSGYLGFKYFHSPGFFRNDEGL--FKSIAATLI 239

Query: 272 QAAFAYGGSEFIALTAAEQANPRESVPKATKR----WLYRXXXXXXXXXXXXXXXXXHNS 327
            A F+ GG+EF+AL+ AEQ    E +P++ KR     + R                  NS
Sbjct: 240 TACFSTGGTEFVALSCAEQNT--EDMPRSIKRASIQVVVRIAIIFCVSLMIIGLLVPFNS 297

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
             L+ + G   + ASP+V+A   +GVR++PHI+N IIL S+ISV N+AMYS+ R L SLA
Sbjct: 298 PYLMGS-GSELTHASPYVVALTTNGVRIIPHIVNAIILLSIISVANNAMYSSSRTLHSLA 356

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           E G   K F  +D  G+P   L   +  GL +F+A    +E VF WL +I+GLS +FTW+
Sbjct: 357 EQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFIAEYKDQETVFVWLLSISGLSTIFTWS 416

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
              VSH+RFR+AM+ Q ++L +LGY++  G  GSY ++F   I+LI QFW+++ P+  +G
Sbjct: 417 MTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGSYISLFICAIILIVQFWVSLFPLESNG 476

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIF 556
            L+V  F QNY+A P+ +V YLG+K +  +++  I + E+D+ + R I+
Sbjct: 477 RLNVVSFLQNYMAVPITIVLYLGHKAYTGNWKPFIRAPEIDIQTDRDIY 525

>Scas_479.1
          Length = 595

 Score =  376 bits (965), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/544 (38%), Positives = 316/544 (58%), Gaps = 9/544 (1%)

Query: 32  NAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXX 91
           N  + F +  K + ++  +D+  + +        ++L  ++  RH               
Sbjct: 43  NTPSPFNEKSKDSPIEDNIDITSQSSVTK-EDINKSLNKDLSIRHLLTLAVGGAIGVGLF 101

Query: 92  VASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFG 151
           V SG AL  GGPA LVI +V  ST L+ V+ +  EL  A+  + G +N Y T  VD  F 
Sbjct: 102 VNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVV-GGFNVYITRFVDPSFA 160

Query: 152 FAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEA 211
           FAV L Y  QW  +LPLELV AS+T+KYW S++N D +VAIFY  +   +    + + E 
Sbjct: 161 FAVNLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGET 220

Query: 212 EFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVW 270
           EF+ + +K+L + GF I+ I L+ G   +G   G +YWH+PGAF G  +  +FKG+CSV+
Sbjct: 221 EFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVF 280

Query: 271 VQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQL 330
           V AAF+Y G E  A++AAE  +PR+++PKA KR  +                  ++  +L
Sbjct: 281 VTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRL 340

Query: 331 LSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG 390
           +S      + ASP VIA    G++ +  ++N IIL S+ISV NSA+Y+  R ++S+A  G
Sbjct: 341 MSGTSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIG 400

Query: 391 MCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIA 450
             PK    VD++GRP+   +    FGL++F+AAS+++  VFTWLSA++GLS +F W AI 
Sbjct: 401 NLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAIN 460

Query: 451 VSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELD 510
           +SH+RFR+AM  Q RSL E+ Y + TG  GS Y +    +VL+A FW ++ P+      D
Sbjct: 461 ISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSA-D 519

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDE-----EVLLQEE 565
           V+ FF+ YL+ P+L+V Y+G+KL+ +++  V+   E+DL + R+  D      EVL +E 
Sbjct: 520 VQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVLAEEA 579

Query: 566 AERK 569
           A  K
Sbjct: 580 AVAK 583

>Scas_607.4
          Length = 599

 Score =  374 bits (961), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/557 (37%), Positives = 322/557 (57%), Gaps = 34/557 (6%)

Query: 27  YAGNRNAWTRFTDSFKRAQVDTAVDLEGK-DADNGLNKTQQTLKHNIKTRHXXXXXXXXX 85
           Y   RN + R  DSFK         L+G  D +N        LK ++K RH         
Sbjct: 58  YQPPRNIFQRCIDSFKPP-------LDGSFDTNN--------LKRSLKARHLIMIAIGGS 102

Query: 86  XXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFL 145
                 V SG+A+  GGP  +VIG+    + +   +    E+ V +  + G +  Y T  
Sbjct: 103 IGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYSTRF 161

Query: 146 VDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGS 205
           +D    F ++ +Y +QW  VLPLE+++++MTV+YW  S++P V+VAIFY  ++ I+ FG+
Sbjct: 162 LDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGA 221

Query: 206 RGYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFK 264
           RG+ EAEF+F+S+KVL + GFII+ I L  G   +  ++G +YWHDPG          F 
Sbjct: 222 RGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLA-----HGFP 276

Query: 265 GICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXX 324
           G+ SV V A+++ GG+E + L + E  +P+E +P A K+  +R                 
Sbjct: 277 GVLSVLVVASYSLGGTEMVCLASGE-TDPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVP 334

Query: 325 HNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILL 384
           + ++ LL   GGS    SPFVIA  LH ++V+P I+N +IL S++SVGNS ++++ R L 
Sbjct: 335 YTNENLL---GGSSVNNSPFVIAIKLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLC 391

Query: 385 SLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLF 444
           S+A  G+ P+ F Y+DR GRPL  +I  SLFGL+AF+  S+    VF WL AIAGL+   
Sbjct: 392 SMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCI 451

Query: 445 TWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP 504
            W +I +SH+RFR AM+ QGRSL EL + +  G  GS Y+   N ++L+AQF+ A+ PI 
Sbjct: 452 VWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIG 511

Query: 505 --KHGELDVEFFFQNYLAFPVLVVFYLGYKLWKR----DFRLVIPSSEVDLLSHRQIFDE 558
             ++  +  + FFQ+YL   +++V ++G+K++ R     +  ++P +++DL + R+  D 
Sbjct: 512 GWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDI 571

Query: 559 EVLLQEEAERKERLRNS 575
           E+L QE AER   LR S
Sbjct: 572 EILKQEIAERNRHLRAS 588

>Scas_507.1
          Length = 592

 Score =  374 bits (959), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/519 (38%), Positives = 301/519 (57%), Gaps = 8/519 (1%)

Query: 43  RAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGG 102
           +   D A  +  +D  N +N     L  N+  RH               V SG AL  GG
Sbjct: 55  QTTTDFASVISHEDDINNVN-----LNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGG 109

Query: 103 PAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQW 162
           PA LVI ++  ST L+ V+ A  E+  A+  + G +N Y T  +D   GFAV + Y  QW
Sbjct: 110 PASLVIDWIIISTCLFTVINALGEMAAAFPVV-GGFNVYITRFIDPSVGFAVNINYLAQW 168

Query: 163 ATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL 222
             +LPLELV ASMT+KYW  ++N D +VAIFY  +   +    + + E EF+ + +K+L 
Sbjct: 169 LVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILA 228

Query: 223 MAGFIIMAISLTAGASEQGYIGG-QYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSE 281
           + GF I+ I L  G    G   G +YW+ PG+F G  +  +FKG+CSV+V AAF+Y G E
Sbjct: 229 IIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIE 288

Query: 282 FIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRA 341
             A++AAE  +PR ++PKA KR  +                  ++  +LLS      + +
Sbjct: 289 MTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAAS 348

Query: 342 SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDR 401
           SP VIA    G++ +P ++N IIL S+ISV NSA+Y+  R ++++A  G  P+I   VD 
Sbjct: 349 SPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDT 408

Query: 402 QGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMR 461
           +GRP+  +IF   FGL++FVAAS+++ +VFTWLSA++GLS +F W AI +SH+RFR++M 
Sbjct: 409 KGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMA 468

Query: 462 VQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAF 521
            Q RSL EL + + TG  GS+Y      +VL+A FW ++ P+      D E FF+ YL+F
Sbjct: 469 KQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSA-DAESFFEGYLSF 527

Query: 522 PVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEV 560
           P+L+  Y G+KL+ R    ++  +++DL + R+  D +V
Sbjct: 528 PILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVDLDV 566

>AEL030W [2476] [Homologous to ScYOL020W (TAT2) - SH]
           complement(577332..579551) [2220 bp, 739 aa]
          Length = 739

 Score =  370 bits (949), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/536 (38%), Positives = 311/536 (58%), Gaps = 20/536 (3%)

Query: 42  KRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFG 101
           KR  V   +D      D   +     LK  +K+RH               + SGKAL  G
Sbjct: 201 KRGLVRRCIDSFKPPVDGSFDP--DNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATG 258

Query: 102 GPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQ 161
           GP  ++IG+    T +   +    E+ V +  + G +  Y T  +D    F V+ +Y LQ
Sbjct: 259 GPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVV-GAFANYSTRFLDPSVSFVVSSIYVLQ 317

Query: 162 WATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221
           W  VLPLE++ +++T+++WT+SV+P V+VA+FY  ++ I+ FG R + + +F+F+ +K++
Sbjct: 318 WFFVLPLEIIASAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMV 377

Query: 222 LMAGFIIMAISLT-AGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGS 280
            + GFII+ + L   G     +IG +YWHDPGA       + FKG+ +V V A+++ GGS
Sbjct: 378 PICGFIILCLVLILGGGPTHEFIGARYWHDPGALA-----NGFKGVAAVMVTASYSLGGS 432

Query: 281 EFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSR 340
           E   L + E  +P+E +P A K+  +R                 + +DQLL   GGS   
Sbjct: 433 EMTCLASGE-TDPKE-IPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLL---GGSNVN 487

Query: 341 ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400
            SPFVIA  +H +RV+PHIIN +IL S++SVGNS ++++ R L S+A  G+ P+IF YVD
Sbjct: 488 NSPFVIAIKMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVD 547

Query: 401 RQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM 460
           R GRPL  ++  SLFGL+AF+  S+    VFTWL A+AGL+    W +I VSH+RFR AM
Sbjct: 548 RAGRPLTGILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAM 607

Query: 461 RVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP--KHGELDVEFFFQNY 518
           + QG+SL EL + +  G  GS Y+   NV+VL+AQF++++ PI   K      E FFQNY
Sbjct: 608 KAQGKSLDELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNY 667

Query: 519 LAFPVLVVFYLGYKLWKR----DFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKE 570
           L   +L+  ++ +K++ R     +  ++P +E+DL S R+  D EV+  E A RK+
Sbjct: 668 LCALILLFMFVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 723

>KLLA0A10813g complement(936126..937880) similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 584

 Score =  352 bits (903), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/554 (37%), Positives = 318/554 (57%), Gaps = 40/554 (7%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGK-DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           N+N   R  DSFK         L+G   +DN        LK  +K+RH            
Sbjct: 46  NKNIVRRMIDSFKPP-------LDGSYHSDN--------LKRKLKSRHLIMIAIGGSIGT 90

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V SGKAL  GGP  ++IG+    + +   +    E+ + +  + G +  Y T L+D 
Sbjct: 91  GLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVV-GAFANYSTRLLDP 149

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
              F V+ +Y  QW  VLP+EL+ ++MTV++WT+ V+P V+VAIFYV ++ ++ FG + +
Sbjct: 150 SISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVF 209

Query: 209 AEAEFIFNSLKVL-LMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            EAEF F+ +KV+ ++   I+  I +  G  +  +IG +YWH PGA       + FKG+ 
Sbjct: 210 GEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALA-----NGFKGVA 264

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           SV+V A+++ GGSE + L +AE  +P+E +P A K+  +R                 + +
Sbjct: 265 SVFVTASYSLGGSEMVCLCSAE-TDPKE-LPHAIKQVFWRIVFFFLVSLTLVGFLVPYTN 322

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
           + LL   GGS    SPFVIA  L G+RV+P IIN +IL S++SVGNS ++++ R L S+A
Sbjct: 323 ENLL---GGSSVNNSPFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMA 379

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
             G+ P++F YVDR GRPLV +I  SLFGL+AF+  S     VF WL AIAGL+    W 
Sbjct: 380 HQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWL 439

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP--K 505
           +I +SH+RFR AM+ Q RSL EL ++++ G  GS Y+   N+++LIAQF+I++ P+    
Sbjct: 440 SINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWT 499

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKR-------DFRLVIPSSEVDLLSHRQIFDE 558
             +   E FF+NYL   VLV  ++ +K++ +       DF+   P +E+DL + R+  D 
Sbjct: 500 SSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFK---PLAEIDLETDRKNIDI 556

Query: 559 EVLLQEEAERKERL 572
           E++ QE  ER+  L
Sbjct: 557 EIVKQEVREREMYL 570

>YOL020W (TAT2) [4796] chr15 (286172..287950) High affinity
           tryptophan permease, also transports other aromatic
           amino acids, alanine and glycine, member of the amino
           acid permease family [1779 bp, 592 aa]
          Length = 592

 Score =  352 bits (902), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/553 (36%), Positives = 307/553 (55%), Gaps = 32/553 (5%)

Query: 29  GNRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           G RN + R  DSFK + +D + D                LK  +K RH            
Sbjct: 53  GKRNIFQRCVDSFK-SPLDGSFD-------------TSNLKRTLKPRHLIMIAIGGSIGT 98

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              V SGKA+  GGP G+VIG+    + +   +    E+ V +  + G +  Y T  +D 
Sbjct: 99  GLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDP 157

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
              F V+ +Y LQW  VLPLE++ A+MTV+YW SS++P ++VAIFY  ++ I+ FG RG+
Sbjct: 158 SISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGF 217

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            EAEF F+++K + + GFII+ + L  G   +  +IG +YWHDPG        + F G+ 
Sbjct: 218 GEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFIGAKYWHDPGCLA-----NGFPGVL 272

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           SV V A+++ GG E   L + E  +P+  +P A K+  +R                 + +
Sbjct: 273 SVLVVASYSLGGIEMTCLASGE-TDPK-GLPSAIKQVFWRILFFFLISLTLVGFLVPYTN 330

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
             LL   GGS    SPFVIA  LH ++ +P I+N +IL SV+SVGNS ++++ R L S+A
Sbjct: 331 QNLL---GGSSVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMA 387

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
             G+ P  F Y+DR GRPLV ++  SLFGL+AF+  S     VF WL AIAGL+    W 
Sbjct: 388 HQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWL 447

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP--K 505
           +I +SH+RFR AM+ QG+SL EL + +  G  GS Y+   N ++LIAQF+ ++ PI    
Sbjct: 448 SINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWT 507

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKR----DFRLVIPSSEVDLLSHRQIFDEEVL 561
            G+   + FFQNYL   +++  ++ +K++ +     +  V    ++DL + R+  D E++
Sbjct: 508 SGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIV 567

Query: 562 LQEEAERKERLRN 574
            QE AE+K  L +
Sbjct: 568 KQEIAEKKMYLDS 580

>CAGL0D02178g 222597..224330 highly similar to sp|P38967
           Saccharomyces cerevisiae YOL020w SCM2 high affinity
           tryptophan transport protein, hypothetical start
          Length = 577

 Score =  350 bits (899), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/552 (35%), Positives = 310/552 (56%), Gaps = 32/552 (5%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXX 89
            RN + R  DSFK   VD + D                LK  +K+RH             
Sbjct: 39  KRNIFQRCVDSFK-PPVDGSFD-------------TSNLKRTLKSRHLIMIAIGGSIGTG 84

Query: 90  XXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149
             + SG+AL  GGP  ++IG+    + +   +    E+ V +  + G +  Y T  +D  
Sbjct: 85  LFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGEITVRFPVV-GAFADYSTRFLDPS 143

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209
             F V+ +Y +QW  VLPLE++ +++T++YW SS++P V+VAIFY  ++ I+ FG+RG+ 
Sbjct: 144 ISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFG 203

Query: 210 EAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGICS 268
           EAEF+F+++K + + GFII+ I L  G   +  +IG +YWHDPGA         F G+ S
Sbjct: 204 EAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGAKYWHDPGALA-----HGFPGVLS 258

Query: 269 VWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSD 328
           V V A+++ GG+E   L + E  +P+E +P A K+  +R                 + ++
Sbjct: 259 VLVVASYSLGGTEMTCLASGE-TDPKE-LPSAIKQVFWRILFFFLASLTLVGFLVPYTNE 316

Query: 329 QLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAE 388
            LL   GGS    SPFVIA  LH ++ +P I+N +IL S++SVGNS ++++ R L S+A 
Sbjct: 317 NLL---GGSSVDNSPFVIAIKLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAH 373

Query: 389 HGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTA 448
            G+ P+ F Y+DR GRPL  ++  SLFGL+AF+  S+    VF WL AIAGL+    W +
Sbjct: 374 QGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLS 433

Query: 449 IAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP--KH 506
           I +SH+RFR AM+ Q ++L EL + +  G  GS Y+   NV++LIAQF+I++ PI     
Sbjct: 434 INLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTD 493

Query: 507 GELDVEFFFQNYLAFPVLVVFYLGYKLWKR----DFRLVIPSSEVDLLSHRQIFDEEVLL 562
                + FFQ+YL   ++++ +  +K++ R     +  V P  ++DL + R+  D +V+ 
Sbjct: 494 SSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIK 553

Query: 563 QEEAERKERLRN 574
            E AERK  L+ 
Sbjct: 554 AEIAERKMYLKK 565

>Kwal_34.16254
          Length = 481

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/457 (38%), Positives = 256/457 (56%), Gaps = 28/457 (6%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGK-DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXX 88
           NRN   R  DSFK  +       +G   +DN        LK ++K RH            
Sbjct: 49  NRNVLQRMVDSFKPPE-------DGSFHSDN--------LKKSLKARHLVMIAIGGSIGT 93

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              + SGKAL  GGP  L+IG+    T +   +    E+ V +  + G +  Y T  ++ 
Sbjct: 94  GLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHGLGEITVRFPVV-GAFADYGTRFLEP 152

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGY 208
              F V L+Y LQW  VLPLE++ A+MTV+YW +SV+P V+VAIFY  +  I+  G RG+
Sbjct: 153 SISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSVSPVVWVAIFYGIIALINLVGVRGF 212

Query: 209 AEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
            EAEF+F+ +KV+ + GFII+ I L  G   ++ ++G +YWHDPG        + FKG+ 
Sbjct: 213 GEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFVGAKYWHDPGPLA-----NGFKGVA 267

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
            V V A+++ GG+E   L + E  +P+E +P A K+  +R                 + +
Sbjct: 268 GVLVIASYSLGGTEMACLASGE-TDPKE-LPSAIKQVFWRIVFFFLVSLTLVGFLVPYTN 325

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
             L+   GGS    SPFVIA  LHG+  +P I+N +IL S++SVGNS ++++ R L S+A
Sbjct: 326 QNLM---GGSSVDNSPFVIAIRLHGINALPSIVNAVILVSLLSVGNSCIFASSRTLCSMA 382

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
             G+ P++F Y+DR GRPL  ++   LFGL+AF+  S    +VFTWL AIAGL+    W 
Sbjct: 383 HQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLVKSGSAGDVFTWLMAIAGLATCVVWL 442

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYA 484
           +I +SH+RFR AM+ QG  L EL + +  G  GS Y+
Sbjct: 443 SINISHIRFRLAMKAQGVDLEELEFVSGVGIYGSVYS 479

>KLLA0B06776g 594172..595938 similar to sgd|S0006195 Saccharomyces
           cerevisiae YPL274w SAM3 high affinity
           S-adenosylmethionine permease, start by similarity
          Length = 588

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/586 (32%), Positives = 314/586 (53%), Gaps = 26/586 (4%)

Query: 1   MSGFVSDKPAVPKATXXXXXXXXXIEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADN- 59
           M+    D    P             +  G+R+ +TR  DSFKR ++   V+ EG D D  
Sbjct: 1   MTDLAKDLAKDPTQVSENFTQSLYTDEDGSRSLFTRVKDSFKRQEL---VETEGIDLDTY 57

Query: 60  GLNKTQQT--------LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYV 111
            +   Q+T         + N+  RH               +  G +L   GP  L+IG++
Sbjct: 58  SMTDYQRTNYLLAKQPYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFL 116

Query: 112 TTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELV 171
            T   ++CVVQ   EL   Y  + G++ ++ +  VD  +GF V   Y L W+   P EL+
Sbjct: 117 LTGLAIFCVVQCAAELSCQYP-VSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELI 175

Query: 172 TASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAI 231
             +MT+ YW SSVNP V+V IF++F++ ++ FG RG+AE E++ +  K+L +  F+I+ +
Sbjct: 176 GCAMTIGYWDSSVNPVVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGV 235

Query: 232 SLTAGA--SEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAE 289
            L  G   +  GYIG +YWHDPG+F        FK +C+ +V AAF++GG+E + LTAAE
Sbjct: 236 VLICGGGPNSNGYIGTKYWHDPGSFKAPV----FKSLCNTFVSAAFSFGGTELVVLTAAE 291

Query: 290 QANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAA 349
            +   ES+ +A K   +R                 +  ++LL  +      ASPFVIA A
Sbjct: 292 -SRKVESISRAAKGTFWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALA 350

Query: 350 LHGV--RVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLV 407
             G     V + +N +IL +V+SV NS +Y+A R++ SL   G  P I  YVDR+GRPL 
Sbjct: 351 NTGKFGERVSNFMNAVILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLF 410

Query: 408 TLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSL 467
            ++ V LFG + F+ ASN+   VF WL A+  +S +F W +I  S++R+R A++ Q RS 
Sbjct: 411 GILVVGLFGFLPFIVASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSA 470

Query: 468 GELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVF 527
            E+ Y++  G  G+Y  +  + ++++ + ++++ P+ +      E FF+  L+ P+++  
Sbjct: 471 DEIAYKSMLGIWGAYLGLLLSALLIVGEIYVSLFPLGESPS--AEAFFKYCLSIPIMIAV 528

Query: 528 YLGYKLWKRDFR-LVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572
           Y+G+K +  +++  VIP S +DL +     D E++  E   ++ +L
Sbjct: 529 YIGHKSYTGNWKSFVIPLSGIDLDTGLSHSDVEIMKHELEIQRVKL 574

>Kwal_56.22951
          Length = 596

 Score =  312 bits (800), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 191/545 (35%), Positives = 303/545 (55%), Gaps = 22/545 (4%)

Query: 40  SFKRAQVDTA--VDLE--GKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASG 95
           SF+R +   +  VDL    ++         Q  + ++  RH               +  G
Sbjct: 48  SFQRQEAPNSEGVDLSLLSEEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLG 107

Query: 96  KALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVA 155
            +L   GP  L+IG++    M++CVVQ+  E+   Y  + G+++ + +  ++   GF V+
Sbjct: 108 FSLA-SGPGSLLIGFLIVGLMMFCVVQSAAEMACQYP-VSGSFSTHVSRFMEPSIGFTVS 165

Query: 156 LVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIF 215
             Y L W    P EL+  ++T++YW SSVN  V+VAIFYVF++ ++ FG RGY EAEF  
Sbjct: 166 TNYALAWLISFPSELIGCAITLRYW-SSVNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWM 224

Query: 216 NSLKVLLMAGFIIMAISLTAGAS--EQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQA 273
           +  KV+ +  FII+ I L  G      GYIG +YWH+PG+F    A   FKG+C+ ++ A
Sbjct: 225 SLFKVVAIVIFIIIGIVLICGGGPHSSGYIGTKYWHNPGSF----AKPVFKGLCNTFISA 280

Query: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA 333
           AF++GG+E + LTA+E +   ESV +A K   +R                 +  D+LL  
Sbjct: 281 AFSFGGAELVVLTASE-SKKVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGG 339

Query: 334 EGGSGSRASPFVIAAALHGV--RVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGM 391
           + G    ASPFVIA +  G     V H +N +IL +V+SV NS +Y++ R++ +L   G 
Sbjct: 340 DTGEDITASPFVIALSGQGSMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQ 399

Query: 392 CPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAV 451
            P+   Y+D++GRPLV +    +FGL+ F+ A +++++VFTWL A+  +S  FTW  I V
Sbjct: 400 LPRACGYIDKKGRPLVGIAICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICV 459

Query: 452 SHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDV 511
           S VRFR A+R QGRS  E+ +++  G  G       N++++  + +++I P+   G    
Sbjct: 460 SQVRFRLALRAQGRSTDEIAHKSMLGIYGGILGGVLNILLIAGEIYVSIFPL--GGSPSA 517

Query: 512 EFFFQNYLAFPVLVVFYLGYKLWK---RDF-RLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567
           E FFQ  ++ P+++V Y  +K +K   RD  R+++P SE+DL S R+I D E+   E  E
Sbjct: 518 EQFFQYCMSIPIMIVVYALHKTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEE 577

Query: 568 RKERL 572
            K R+
Sbjct: 578 DKARI 582

>Scas_536.1
          Length = 372

 Score =  298 bits (764), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 160/359 (44%), Positives = 233/359 (64%), Gaps = 4/359 (1%)

Query: 215 FNSLKVLLMAGFIIMAISLTAGASEQGYIG-GQYWHDPGAFGGDRAIDRFKGICSVWVQA 273
           F+ +KV  + GFII+ I L  G   +G     +YWHDPGAF G  +  +FKG+CSV+V A
Sbjct: 3   FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 62

Query: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA 333
           AF++ GSE I +TAAE ANPR+S+P A K+ ++R                 +N  +L+ A
Sbjct: 63  AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 122

Query: 334 EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393
                + ASPFVIA   HG++ +P +IN +IL +V+SVGNSA+++  R + +L++ G  P
Sbjct: 123 SSVDAA-ASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLP 181

Query: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453
           K+F Y+DR GRPLV +   S FGL+AFVAAS +E  VF WL A++GLS LFTW  I + H
Sbjct: 182 KVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCH 241

Query: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEF 513
           +RFR A++ QGR   EL + +  G  GSY+ +F  V++ IAQF++A+   P  G+ D E 
Sbjct: 242 IRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVAL--FPPGGKPDAEV 299

Query: 514 FFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERL 572
           FFQ+YL+FP++V  Y G+K++KR+++L IP  ++D+ + R+  D E+L QE  E K  L
Sbjct: 300 FFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAIL 358

>YPL274W (SAM3) [5177] chr16 (22938..24701) High affinity
           S-adenosylmethionine permease, member of the amino acid
           permease family of membrane transporters [1764 bp, 587
           aa]
          Length = 587

 Score =  303 bits (775), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 190/546 (34%), Positives = 298/546 (54%), Gaps = 22/546 (4%)

Query: 36  RFTDSFKRAQVDT-AVDLEGKDADNGLNKTQ-----QTLKHNIKTRHXXXXXXXXXXXXX 89
           R  DSFK++ +     DLE  +      K Q     Q  +  +  RH             
Sbjct: 36  RMKDSFKQSNLHVIPEDLENSEQTEQ-EKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTG 94

Query: 90  XXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149
             +  G +L   GPA L+IG++   T ++CVVQ+  EL   +  + G+Y  + +  +D+ 
Sbjct: 95  LFIGLGYSLA-SGPAALLIGFLLVGTSMFCVVQSAAELSCQFP-VSGSYATHVSRFIDES 152

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209
            GF VA  Y L W    P EL+  ++T+ YW  +VNP V+VAIFYVF++ ++ FG RG+A
Sbjct: 153 VGFTVATNYALAWLISFPSELIGCALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFA 212

Query: 210 EAEFIFNSLKVLLMAGFIIMAISLTAGA--SEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
           E EF  + +KV+ +  FII+ I L AG   +  GYIG +YWHDPGAF    A   FK +C
Sbjct: 213 ETEFALSIIKVIAIFIFIIIGIVLIAGGGPNSTGYIGAKYWHDPGAF----AKPVFKNLC 268

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           + +V AAF++GGSE + LT+ E  N   ++ +A K   +R                 +N 
Sbjct: 269 NTFVSAAFSFGGSELVLLTSTESKNI-SAISRAAKGTFWRIAIFYITTVVIIGCLVPYND 327

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVR--VVPHIINFIILTSVISVGNSAMYSAPRILLS 385
            +LLS        ASPFVIA +  G     V + +N +IL +V+SV NS +Y++ R++ +
Sbjct: 328 PRLLSGSNSEDVSASPFVIALSNTGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQA 387

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           L   G  P + +Y+DR+GRPLV +     FGL+ F+ AS +E+ VFTWL A+  +S  FT
Sbjct: 388 LGASGQLPSVCSYMDRKGRPLVGIGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFT 447

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPK 505
           W  I +S +RFR A++ QGRS  E+ Y++  G  G       N +++  + +++ AP+  
Sbjct: 448 WFCICMSQIRFRMALKAQGRSNDEIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGS 507

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR-LVIPSSEVDLLSHRQIFDEEVL-LQ 563
                 E FF+  L+ P+++V Y  ++ ++RD++   I  SE+DL +   + + E+   Q
Sbjct: 508 PS--SAEAFFEYCLSIPIMIVVYFAHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQ 565

Query: 564 EEAERK 569
           +EAE +
Sbjct: 566 KEAEEQ 571

>YLL061W (MMP1) [3363] chr12 (17956..19707) High affinity
           S-methylmethionine permease, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1752 bp, 583 aa]
          Length = 583

 Score =  302 bits (773), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 188/554 (33%), Positives = 287/554 (51%), Gaps = 24/554 (4%)

Query: 29  GNRNAWTRFTDSFKRAQVDTAVDLEG-------KDADNGLNKTQQTLKHNIKTRHXXXXX 81
           GN N   RF +SFKR   D+    EG       ++     +   Q  K  +  RH     
Sbjct: 26  GN-NLIHRFKNSFKRN--DSPAIQEGLLYSELSEEEKIQWDLANQPYKKVLDQRHLTMIA 82

Query: 82  XXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAY 141
                     +  G++L   GPA L+IG++     + CVVQ   EL   Y  + G+Y  +
Sbjct: 83  IGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQYP-VSGSYALH 140

Query: 142 PTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIH 201
            +  +D   GF++ + Y L W    P ELV  S+T+ YW  SVNP  +VAI +V  + ++
Sbjct: 141 ASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAPSVNPAAWVAIAFVLSMLLN 200

Query: 202 FFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGA--SEQGYIGGQYWHDPGAFGGDRA 259
            FG+RG+AE+EF  +  K++ +  FII+ I L AG      GYIG +YWHDPG+F    A
Sbjct: 201 LFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGTKYWHDPGSF----A 256

Query: 260 IDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXX 319
           +  FK +C+ +V AA+++ G+E + LT+ E A    SV +A K   +R            
Sbjct: 257 VPVFKNLCNTFVSAAYSFSGTEMVVLTSTE-ARSVSSVSRAAKGTFWRIIIFYIVTVIII 315

Query: 320 XXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGV--RVVPHIINFIILTSVISVGNSAMY 377
                +N  +L+S        ASPFVIA +  G     V H +N +IL +V SV NS +Y
Sbjct: 316 GCLVPYNDPRLISGSSSEDITASPFVIALSNTGAMGTRVSHFMNAVILIAVFSVCNSCVY 375

Query: 378 SAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAI 437
           ++ R++  LA  G  PKI  Y+DR GRPLV +     FGL+ F+  S  +  VFTWL A+
Sbjct: 376 ASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWLFAL 435

Query: 438 AGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFW 497
             +S   TW  I    VRFR AM+ QGRS  ++ YR+  G  G  +    NV+++I + +
Sbjct: 436 CSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTLGIYGGIFGCILNVLLVIGEIY 495

Query: 498 IAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR-LVIPSSEVDLLSHRQIF 556
           ++ AP+          FF+  ++ P+++  Y+G+++++RD+R   I   ++DL S   + 
Sbjct: 496 VSAAPVGSPSS--AANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDLDSGHSLE 553

Query: 557 DEEVLLQEEAERKE 570
           D E    E  E K+
Sbjct: 554 DFEATKLERDEDKK 567

>AER405C [2905] [Homologous to ScYPL274W (SAM3) - NSH]
           (1413790..1415283) [1494 bp, 497 aa]
          Length = 497

 Score =  287 bits (734), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 166/490 (33%), Positives = 281/490 (57%), Gaps = 23/490 (4%)

Query: 92  VASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFG 151
           +  G++L   GP  L+IG++     ++CV+Q+  EL   Y  + G+++++ +  ++   G
Sbjct: 14  IGIGQSLQ-SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYP-VSGSFSSHVSRFIEPSLG 71

Query: 152 FAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEA 211
           F V+  Y L W    P ELV  +MT+ YW   + P V+V I Y+ ++ ++ F  RG+AE+
Sbjct: 72  FTVSCAYALSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFAVRGFAES 131

Query: 212 EFIFNSLKVLLMAGFIIMAISLTAGA---SEQGYIGGQYWHDPGAFGGDRAIDRFKGICS 268
           EF  + +KVL +  F+I+ I +  G    +++GY+GG+YWHDPGAF        F  +C 
Sbjct: 132 EFWLSIIKVLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAF----RPPFFSSLCQ 187

Query: 269 VWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSD 328
            +V AAF +GG+E + LTA E +   ES+ +A K   +R                 + S 
Sbjct: 188 TFVSAAFTFGGAELVLLTANE-SRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSP 246

Query: 329 QLLSAEGGSGSRASPFVIAAALHGV--RVVPHIINFIILTSVISVGNSAMYSAPRILLSL 386
            L     G   RASPFVIA +  G     V H +N +I+ +V+SV NS +Y+A R++ SL
Sbjct: 247 AL----DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSL 302

Query: 387 AEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTW 446
              G  P+IF Y+D++GRPLV +   ++FGL+AF+  + + ++VF WL A+  ++  F W
Sbjct: 303 GACGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVW 362

Query: 447 TAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKH 506
             I VS +R+RRA++VQG    E+ Y++  G          N +++  + ++++    K 
Sbjct: 363 FCICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV----KD 418

Query: 507 GELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRL-VIPSSEVDLLSHRQIFDEEVLLQEE 565
           G  DVE FFQN ++ P+L++FY  ++L++RD++  +IP+ ++DL + R+  D E++  E 
Sbjct: 419 G--DVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHEL 476

Query: 566 AERKERLRNS 575
              + R+ +S
Sbjct: 477 IVSRARIASS 486

>Scas_706.37
          Length = 544

 Score =  273 bits (699), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 168/537 (31%), Positives = 275/537 (51%), Gaps = 18/537 (3%)

Query: 40  SFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALH 99
           SF+    DT   +   D D    + QQ +K  +K RH               +   + L 
Sbjct: 10  SFQVDSNDTPTTISTLDDDQ---EKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLI 66

Query: 100 FGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYG 159
             GP G +I Y+   T+++ V Q+  E+   +  +  ++  +    +   FG A   +Y 
Sbjct: 67  IAGPIGALIAYLFMGTVVFSVTQSLGEM-CTFIPVTASFTVFAQRFLSPAFGAANGYMYW 125

Query: 160 LQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLK 219
             WA    LEL      +++WT +V    +++I +V L   + F  R Y E EF   S+K
Sbjct: 126 FSWAMTFALELSVVGQIIQFWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVK 185

Query: 220 VLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAA 274
           VL + GFII  I +  GA   G +G +YW +PG +G      +    RF G  S  + AA
Sbjct: 186 VLAILGFIIYGICIICGAGVTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAA 245

Query: 275 FAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAE 334
           F + G+E + +TA E  NPR++VPKA K+ ++R                 +N  +L S +
Sbjct: 246 FTFQGTELVGITAGEAKNPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSND 305

Query: 335 GGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPK 394
             S   +SPF+I     G +++PHI N +IL ++IS GNS +Y   RIL  LA++   PK
Sbjct: 306 --SYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPK 363

Query: 395 IFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHV 454
            FT   + G P VT++F S+FG +A++  +   +  FTWL  I G++  F W  I+ SH+
Sbjct: 364 FFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHI 423

Query: 455 RFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFF 514
           RF +A++ +G S  +L Y+A      +YYA+FF VI+++ Q + + AP     +  V  F
Sbjct: 424 RFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAP-----KFKVANF 478

Query: 515 FQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKER 571
           F  Y++  + ++F++ +++W +  RLV    +VDL + R+  +EEV   ++ E K +
Sbjct: 479 FAAYISVFLFIIFWVAFQIWFKC-RLVWKLQDVDLDTDRRDIEEEV-WSDDVEDKNK 533

>CAGL0J08162g complement(801555..803348) Highly similar to sp|P32487
           Saccharomyces cerevisiae YNL268w LYP1 or sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 or sp|P38971
           Saccharomyces cerevisiae YNL270c ALP1, hypothetical
           start
          Length = 597

 Score =  262 bits (669), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/506 (31%), Positives = 257/506 (50%), Gaps = 14/506 (2%)

Query: 68  LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127
           +K  +K RH               V     L   GP G +I Y+   T++Y V Q+  E+
Sbjct: 91  VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEM 150

Query: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187
              +  +  +   +    +   FG A   +Y   WA    +E+      ++YWT  V   
Sbjct: 151 A-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLA 209

Query: 188 VFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQY 247
            ++ IF+V +  ++FF  + Y E EF   S+KV+ + G++I A+ +  G S QG IG +Y
Sbjct: 210 AWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRY 269

Query: 248 WHDPGAFGG-----DRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATK 302
           W +PGA G      D    RF G  S  + AAF Y G+E + +TA E ANPR+SVP+A  
Sbjct: 270 WRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 329

Query: 303 RWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINF 362
           + ++R                 +N  +L ++   +   +SPFVI+    G +V+P I N 
Sbjct: 330 KVVFRIVLFYIMSLFFVGLLVPYNDPRLSASS--AVIASSPFVISIQNAGTKVLPDIFNA 387

Query: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422
           ++L +VIS  NS +Y   R+L +LA+ G  PK F YV R G P + +I  +L GL+AF+ 
Sbjct: 388 VVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLV 447

Query: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSY 482
            ++     F WL  I+ L+ L  W  I+++H+RF +A++ +G S  +L ++A     G+Y
Sbjct: 448 VNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAY 507

Query: 483 YAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVI 542
           YA FF  +++  Q + A AP     + DV  FF  Y++  +LVV + G +L+ R  R + 
Sbjct: 508 YASFFVTVIIFIQGFQAFAP-----KFDVSEFFTAYISLILLVVLFAGCQLYYR-CRFLW 561

Query: 543 PSSEVDLLSHRQIFDEEVLLQEEAER 568
              ++D+ S R+  D  V   +E + 
Sbjct: 562 KLEDIDIDSDRREIDAIVWEDDEPQN 587

>YNL268W (LYP1) [4340] chr14 (138549..140384) High affinity lysine
           permease, also transports methionine [1836 bp, 611 aa]
          Length = 611

 Score =  259 bits (663), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/541 (29%), Positives = 275/541 (50%), Gaps = 24/541 (4%)

Query: 38  TDSFKRAQV---DTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           T+S  R QV   +T ++ + ++A    +   + +K  +K RH               V  
Sbjct: 77  TNSLTRLQVVSHETDINEDEEEA----HYEDKHVKRALKQRHIGMIALGGTIGTGLFVGI 132

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
              L   GP G +I Y+   T++Y V Q+  E+   +  +  +   +    +   FG + 
Sbjct: 133 STPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVSN 191

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
             +Y   WA    +E+      ++YWT  V    ++AIF+V +  ++FF  + Y E EF 
Sbjct: 192 GYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFW 251

Query: 215 FNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSV 269
             S+KVL + G++I A+ +  G S QG IG +YW +PGA+G      D++  RF G  S 
Sbjct: 252 VASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSS 311

Query: 270 WVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQ 329
            + AAF Y G+E + +TA E ANPR++VP+A  + ++R                 +N  +
Sbjct: 312 LINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSR 371

Query: 330 LLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEH 389
           L ++   +   +SPFVI+    G   +P I N ++L +V+S  NS +Y   R+L SLA  
Sbjct: 372 LSASS--AVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLART 429

Query: 390 GMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAI 449
           G  PK F YV RQG P + ++  +  GL+AF+  +N     F WL  I+ L+ L  W  I
Sbjct: 430 GNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFI 489

Query: 450 AVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGEL 509
           +++H+RF +A++ +G S  +L ++A     G+YYA FF  +++  Q + A  P       
Sbjct: 490 SLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP------F 543

Query: 510 DVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569
            V  FF +Y++  +L V ++G +++ +  R +    ++D+ S R+  + E ++ E+ E K
Sbjct: 544 KVSEFFTSYISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDRR--EIEAIIWEDDEPK 600

Query: 570 E 570
            
Sbjct: 601 N 601

>KLLA0C02343g complement(203552..205297) similar to sp|P04817
           Saccharomyces cerevisiae YEL063c CAN1 amino acid
           permease, start by similarity
          Length = 581

 Score =  258 bits (659), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 156/543 (28%), Positives = 266/543 (48%), Gaps = 20/543 (3%)

Query: 39  DSFKRAQVDTAVDLEGKDADNGL------NKTQQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
           D   R   D  + LE  D D+        +  Q  +K  +K RH               +
Sbjct: 38  DDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFI 97

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
           +    L   GP G +I ++   T+ Y V Q+  E+   +  +  ++  +    +    G 
Sbjct: 98  SISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGA 156

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212
           A   +Y   WA    LEL      ++YWT +V  + ++AIF+V L+  + F  + Y E E
Sbjct: 157 ANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFE 216

Query: 213 FIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGG-----DRAIDRFKGIC 267
           F   S+KV+ + GF+I ++ +  GA  +G IG +YW  PG +G      +    RF G  
Sbjct: 217 FWVASIKVIAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWV 276

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           S  + AAF Y G+E + +TA E  NPR++VP+A  +  +R                 +N 
Sbjct: 277 SSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYND 336

Query: 328 DQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
            +L  ++ GS    SPF+IA       V+PHI N +ILT++IS GNS +Y   RIL  L+
Sbjct: 337 PKLEGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLS 396

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
           ++ + PK F+   + G P + ++  ++FG +A++  SN  + VF WL  I  ++   TW 
Sbjct: 397 KNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWL 456

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
            I++SH+RF + ++ +G S  +L Y+A      +YYA FF  +++I Q + A AP     
Sbjct: 457 LISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAP----- 511

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567
             +V  FF  Y++   + +F++ + +++  +R  +  +  ++       D +V++ EE E
Sbjct: 512 HFNVSDFFAAYIS---VFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEE 568

Query: 568 RKE 570
            K 
Sbjct: 569 PKN 571

>Scas_706.36d
          Length = 607

 Score =  258 bits (660), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 151/505 (29%), Positives = 256/505 (50%), Gaps = 14/505 (2%)

Query: 68  LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127
           +K  +K RH               V     L   GP G +I Y+   +++Y + Q+  E+
Sbjct: 101 VKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEM 160

Query: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187
              +  +  +   +    +   FG A   +Y   WA    +E+      ++YWT  V   
Sbjct: 161 A-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLA 219

Query: 188 VFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQY 247
            ++AIF+VF+  ++FF  + Y E EF    +KVL +AG+++ A+ +  G S QG IG +Y
Sbjct: 220 AWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGFRY 279

Query: 248 WHDPGAFGG-----DRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATK 302
           W +PG +G      D+   RF G  S  + AAF Y G+E + +TA E ANPR+SVP+A  
Sbjct: 280 WRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 339

Query: 303 RWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINF 362
           + ++R                 ++  +L S    +   +SPFVI+    G +++P I N 
Sbjct: 340 KVVFRIALFYIMSLFFIGLLVPYDDPRLSSDS--AVVASSPFVISIQNAGTKILPDIFNA 397

Query: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422
           I++ +VIS  NS +Y   R+L +LA+ G  PK F YV R G P + ++  +  GL+AF+ 
Sbjct: 398 IVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLV 457

Query: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSY 482
            +N     F WL  I+ L+ L  W  I++SH+RF +A++ +G S  +L ++A      +Y
Sbjct: 458 VNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAY 517

Query: 483 YAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVI 542
           YA FF  +++  Q + A +P       DV  FF  Y++  +L V ++G +++ R  R   
Sbjct: 518 YATFFVTVIIFIQGFQAFSP-----HFDVTAFFTAYISLIILAVLFIGCQIYYR-CRFFW 571

Query: 543 PSSEVDLLSHRQIFDEEVLLQEEAE 567
              ++D+ + R+  +E +   +E +
Sbjct: 572 KLEDIDIDTDRREIEEVIWEDDEPK 596

>Kwal_33.13411
          Length = 560

 Score =  256 bits (653), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 257/516 (49%), Gaps = 16/516 (3%)

Query: 55  KDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTS 114
           +D +  L + Q  +K  +K RH               V     L   GP G +I Y+   
Sbjct: 43  EDDEGDLQEGQ--VKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMG 100

Query: 115 TMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTAS 174
           +++Y V Q+  E+   +  +  +   +    +   FG A   +Y   WA    +E+    
Sbjct: 101 SIVYFVTQSMGEMA-TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIG 159

Query: 175 MTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLT 234
             ++YWT +V    ++ IF+V +   +FF  R Y E EF   S+KV+ + G+++ A+ + 
Sbjct: 160 QVIQYWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIV 219

Query: 235 AGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAE 289
            G S+QG IG +YW +PG +G     GD+   RF G  +  + A+F Y G+E + +TA E
Sbjct: 220 CGGSKQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGE 279

Query: 290 QANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAA 349
            ANPR++VPKA  +  +R                 +N   L   +  S   +SPFVI+  
Sbjct: 280 AANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL--DKHTSVIASSPFVISIQ 337

Query: 350 LHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTL 409
             G R++P I N ++L ++IS  NS +Y   RIL SLA  G+ PK F+YV  QG P + +
Sbjct: 338 SAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGV 397

Query: 410 IFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGE 469
           I  +L GL+AF+   +     F WL  I+ L+ L  W  I++SH+RF + ++ +G S  +
Sbjct: 398 ICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDD 457

Query: 470 LGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYL 529
           L +++     G+YYA F+  +++  Q + A  P  K  E     FF  Y++  +L V + 
Sbjct: 458 LPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAE-----FFTGYISLILLAVVFC 512

Query: 530 GYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEE 565
             +L+ R  R      ++D+ S R+  D  +  +EE
Sbjct: 513 LAQLYYR-CRFFNRLEDIDIDSDRREIDALIWEEEE 547

>Kwal_33.13401
          Length = 559

 Score =  255 bits (651), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 266/534 (49%), Gaps = 18/534 (3%)

Query: 35  TRFTDSFKRAQVDTAVDLEGKDA-DNGLNKT---QQTLKHNIKTRHXXXXXXXXXXXXXX 90
           TR  D    +  + A+D E + + D+ L  +   +  ++  +K RH              
Sbjct: 16  TRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGL 75

Query: 91  XVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGF 150
            +     L   GP G +I Y+   ++ YCV Q+  E+   +  +  ++  +    +    
Sbjct: 76  FIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMAT-FIPVTSSFTVFTRRFLSLPL 134

Query: 151 GFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAE 210
           G A   +Y   W+    LEL      ++YWTS+V    ++AIF+V +   +    + Y E
Sbjct: 135 GAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWVPITLSNLVPVKFYGE 194

Query: 211 AEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFGG-----DRAIDRFKG 265
            +F    +KV+ + GF++  + +  GA + G +G +YW +PG +G      D    RF G
Sbjct: 195 FQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWGDGIISHDIHEGRFLG 254

Query: 266 ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXH 325
             S  V AAF Y G+E + ++A E ANPR++VPKA  +  +R                  
Sbjct: 255 WVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPF 314

Query: 326 NSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
           N ++L S++  S S  SPF+IA    G +++P I N +IL ++IS  NS +Y   R+L  
Sbjct: 315 NDEKLTSSD--SYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYG 372

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           LA+  + P+ F   +R G P V ++FV+ FG + +++ SN     F WL  I  ++  F+
Sbjct: 373 LAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFS 432

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPK 505
           W  I++ HVRF +A+++QG S  +L ++A     G+YY+ FF  +++I Q + ++AP   
Sbjct: 433 WLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAP--- 489

Query: 506 HGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEE 559
               +V  FF  Y++  + +V +  ++ W R  R++     VD+ S R+  D +
Sbjct: 490 --TFNVSNFFAAYISVFMFLVIWAVFQCWYRT-RIIHRIEHVDIDSDRREVDAQ 540

>KLLA0E16335g 1455271..1457088 gi|28565044|gb|AAO32605.1
           Kluyveromyces lactis DIP5, start by similarity
          Length = 605

 Score =  256 bits (653), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 171/555 (30%), Positives = 270/555 (48%), Gaps = 30/555 (5%)

Query: 37  FTDSFKRAQVDTAVDLEGKDADNGLNKTQQ--------TLKHNIKTRHXXXXXXXXXXXX 88
           F D    ++V       G D  N +  T +         LK  ++ RH            
Sbjct: 40  FYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEARHVSMIAIGGSLGT 99

Query: 89  XXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDK 148
              + +G +L   GPA ++I Y     +++ V+    E+  AY  L G + +Y T   D 
Sbjct: 100 GLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMA-AYIPLDG-FTSYSTRYADP 157

Query: 149 GFGFAVALVYGLQWATVLPLELVTASMTVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSR 206
             GFAV   Y  ++  ++P +L   ++ ++YW     VNP V++ I  V ++ I+F G R
Sbjct: 158 ALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVR 217

Query: 207 GYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGG-----DRAI 260
            + E E+  +++K+ +M G II+ + L  G       +G +YW +PGAF         A 
Sbjct: 218 FFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAK 277

Query: 261 DRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXX 320
            RF    SV+V A FAY G+E   +  +E  NPR++VPKA K  +YR             
Sbjct: 278 GRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLG 337

Query: 321 XXXXHNSDQLLSAEGGSGS-RASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSA 379
                N   L+SA+    S  ASPFV+A    G+ V+PHI+N  IL  V S  NS +Y A
Sbjct: 338 MCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVA 397

Query: 380 PRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAG 439
            R L  LA     P+IF   ++QG P  +L+   LF L+A++  S+    VFT+      
Sbjct: 398 SRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVS 457

Query: 440 LSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWI 498
           +  L +W +I ++++RF +A RVQG     L Y++     G+++++FF +++ LI  F  
Sbjct: 458 IFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNF-- 515

Query: 499 AIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDE 558
              P       D + F   Y+  P  ++ Y+GYKLW +    +IPS EVDL+S ++  D 
Sbjct: 516 ---PAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK--TKIIPSEEVDLVSFKEAVDL 570

Query: 559 EVLLQEEAERKERLR 573
           E   +EE +  +  R
Sbjct: 571 E---EEEGKMLDEER 582

>YNL270C (ALP1) [4339] chr14 complement(135939..137660) Arginine
           permease, has strong similarity to basic amino acid
           permeases Can1p and Lyp1p, member of the amino acid
           permease family of membrane transporters [1722 bp, 573
           aa]
          Length = 573

 Score =  254 bits (648), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 157/543 (28%), Positives = 271/543 (49%), Gaps = 21/543 (3%)

Query: 39  DSFKRAQVDTAVDLEGKDADNGLNKTQQT------LKHNIKTRHXXXXXXXXXXXXXXXV 92
           + +    V  A+  E K  D+   +T+ +      +K  +K RH               +
Sbjct: 31  EQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLII 90

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
             G  L   GP G +I Y+   T++Y V Q+  E+ V +  +  +++ +    +    G 
Sbjct: 91  GIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM-VTFIPVTSSFSVFAQRFLSPALGA 149

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212
               +Y L W     LEL      ++YWT +V    ++ IF+  L  ++ F  + Y E E
Sbjct: 150 TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFE 209

Query: 213 FIFNSLKVLLMAGFIIMAISLTAGASE-QGYIGGQYWHDPGAFG-----GDRAIDRFKGI 266
           F   S+KV+ + GFII +  +  GA +  G IG +YW +PGA+G      D+   RF G 
Sbjct: 210 FCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGW 269

Query: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHN 326
            S  + AAF Y G+E + +TA E ANPR+++P+A K+ + R                 +N
Sbjct: 270 VSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYN 329

Query: 327 SDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSL 386
             +L S   G    +SPF+I+    G +V+P I N ++L +++S GNS +Y   R+L SL
Sbjct: 330 DPKLDS--DGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSL 387

Query: 387 AEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTW 446
           +++ + P+  + V R G P  +++  S+FG +AF+  S      F WL  I G++  F W
Sbjct: 388 SKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW 447

Query: 447 TAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKH 506
             I+ SH+RF +A+R +G S  +L Y+A      +YYA FF  ++++ Q + A A  P  
Sbjct: 448 LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFA--PTF 505

Query: 507 GELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEA 566
             +D   F   Y++  + +  +L +++W +  RL+    ++D+ S R+  +E V ++ E 
Sbjct: 506 QPID---FVAAYISIFLFLAIWLSFQVWFK-CRLLWKLQDIDIDSDRRQIEELVWIEPEC 561

Query: 567 ERK 569
           + +
Sbjct: 562 KTR 564

>CAGL0J08184g 804507..806225 similar to sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or sp|P38971 Saccharomyces
           cerevisiae YNL270c ALP1 or sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1, hypothetical start
          Length = 572

 Score =  253 bits (645), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 153/509 (30%), Positives = 260/509 (51%), Gaps = 15/509 (2%)

Query: 65  QQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124
              +K ++K RH               +     L   GP G ++ Y+   T+++ V Q+ 
Sbjct: 63  HHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSL 122

Query: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184
            E+   +  +  +++ +    +    G A   +Y L W     LEL      +++WT  V
Sbjct: 123 GEMA-TFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181

Query: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244
               +++IF+V L   + F  + Y E EF   S+KVL + GF+I ++ +  GA + G IG
Sbjct: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPIG 241

Query: 245 GQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299
            +YW +PGA G      +    RF G  S  + AAF Y G+E + +TA E ANPR++VP+
Sbjct: 242 FRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 301

Query: 300 ATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHI 359
           A ++ L R                 +N  +L S +  S   +SPF+I     G RV+PHI
Sbjct: 302 AIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD--SYVSSSPFIITIQNAGTRVLPHI 359

Query: 360 INFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIA 419
            N +ILT++IS GNS +Y   RIL S+A++G+ PK       QG P ++++ +S FG ++
Sbjct: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419

Query: 420 FVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGAL 479
           ++  S      F WL  I G++  F W  I+ SHVRF +A++ +G S  +L Y+A     
Sbjct: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479

Query: 480 GSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR 539
            +YYAIFF V++++ Q + + AP           F   Y++  + +VF+  ++++ R  R
Sbjct: 480 LAYYAIFFMVVIILIQGFTSFAP-----HFSGRDFVAAYISVGLFLVFWGFFQIYFR-CR 533

Query: 540 LVIPSSEVDLLSHRQIFDEEVLLQEEAER 568
           ++    +VD+ + R+   E V+ +++A +
Sbjct: 534 IIWKLEDVDIDTDRREI-ESVVWEDDAPK 561

>CAGL0A01199g 121067..122908 similar to sp|P53388 Saccharomyces
           cerevisiae YPL265w DIP5 dicarboxylic amino acid
           permease, hypothetical start
          Length = 613

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 166/553 (30%), Positives = 273/553 (49%), Gaps = 32/553 (5%)

Query: 35  TRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           +R  DS K+   D  +D +GKD           L+ ++K RH               + +
Sbjct: 64  SRLEDSEKQ---DDYMD-DGKD-------EHTRLRKDLKARHISMIAIGGSIGTGLLIGT 112

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
           G +L+  GP  + I Y     +++  + A  E+  +Y  L G + +Y +   D   GFAV
Sbjct: 113 GNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAV 170

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212
              Y  ++  + P +L  A++ ++YW     VNP V++ IF V ++ ++F G + + E E
Sbjct: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230

Query: 213 FIFNSLKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAFGG-DRAID----RFKGI 266
           F  ++ KV++M G II+  + +  G      +G +++  PGAF    ++ID    +F   
Sbjct: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAF 290

Query: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHN 326
            +V V A FAY G E   + AAE ANPR+S+PKA K  +YR                 ++
Sbjct: 291 VAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350

Query: 327 SDQLLSAE-GGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
              L  A+  G+G+ ASP+V+A    G++ +PHI N  +L  V S  NS +Y A R L  
Sbjct: 351 DPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           LA     PKIF   +R G P  +L+  S F L+A+++ S+    +F +   +  +  L +
Sbjct: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIP 504
           W +I ++++ F RA++ Q        YRA     GSY+ + F +++  I  F + +    
Sbjct: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---- 526

Query: 505 KHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQE 564
            +   D + F   Y+  PV V+ Y GYK  K+    +    EVDL + +   DEE    +
Sbjct: 527 -NHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGK 583

Query: 565 --EAERKERLRNS 575
             +AER+ERL+NS
Sbjct: 584 IADAERRERLKNS 596

>Scas_377.2
          Length = 490

 Score =  244 bits (623), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 143/469 (30%), Positives = 244/469 (52%), Gaps = 15/469 (3%)

Query: 102 GPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQ 161
           GP G +I Y+  +T+ Y V Q+  E+   +  +  ++  +    V   FG A   +Y   
Sbjct: 19  GPVGALIAYLFMATLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFS 77

Query: 162 WATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221
           W     LEL      +++WT +V    +++IF+V L  ++ F  + Y E EF    +KV+
Sbjct: 78  WCITFALELSVVGQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVV 137

Query: 222 LMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFA 276
            + GF+I    +  GA   G +G +YW  PGAFG      D+   RF G  S  + AAF 
Sbjct: 138 AIMGFLIYCFCMVCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFT 197

Query: 277 YGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGG 336
           + G+E + +TA E ANPR++VP+A K+ ++R                 ++  +L S +  
Sbjct: 198 FQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTD-- 255

Query: 337 SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396
           S   ASPF+IA    G  V+PHI N +I+ ++IS GNS +Y   RI+  L+   + P I 
Sbjct: 256 SYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGIL 315

Query: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456
           +   + G P V ++  SLFG +A++  S   +  F WL  I G++  FTW  I++SH+RF
Sbjct: 316 SRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRF 375

Query: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516
            +A+ ++G S  +L ++A      +YY +FF  +++I Q + +  P      +D   F  
Sbjct: 376 MQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP---WNGID---FLT 429

Query: 517 NYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEE 565
            Y++  + +  ++ ++ W R  RL+    +VD+ + R+  +E V +++E
Sbjct: 430 AYISVFMFIAIWIAFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQE 477

>YEL063C (CAN1) [1365] chr5 complement(31694..33466) Permease for
           basic amino acids, arginine, lysine, and histidine,
           member of the amino acid-polyamine-choline (APC) family
           of membrane transporters [1773 bp, 590 aa]
          Length = 590

 Score =  246 bits (629), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 154/519 (29%), Positives = 254/519 (48%), Gaps = 17/519 (3%)

Query: 56  DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTST 115
           D D G  +  + +K  +K RH               +     L   GP G +I Y+   +
Sbjct: 73  DEDEGEVQNAE-VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGS 131

Query: 116 MLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASM 175
           + Y V Q+  E+   +  +  ++  +    +   FG A   +Y   WA    LEL     
Sbjct: 132 LAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190

Query: 176 TVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTA 235
            +++WT  V    +++IF+V +  ++ F  + Y E EF   S+KVL + GF+I    +  
Sbjct: 191 VIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVC 250

Query: 236 GASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQ 290
           GA   G +G +YW +PGA+G      D+   RF G  S  + AAF + G+E + +TA E 
Sbjct: 251 GAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310

Query: 291 ANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAAL 350
           ANPR+SVP+A K+ ++R                 +N  +L   +  S    SPF+IA   
Sbjct: 311 ANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIEN 368

Query: 351 HGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLI 410
            G +V+PHI N +ILT++IS  NS +Y   RIL  L+++ + PK  +   + G P + + 
Sbjct: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428

Query: 411 FVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGEL 470
             + FG +A++  S   + VF WL  I G++  F W  I++SH+RF +A++ +G S  EL
Sbjct: 429 VTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488

Query: 471 GYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLG 530
            ++A      +YYA  F  I++I Q + A AP   +G      +   +L   V ++F   
Sbjct: 489 PFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCI 547

Query: 531 YKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569
           ++      R +    +VD+ S R+  D E ++ E+ E K
Sbjct: 548 FRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579

>KLLA0C02365g 208462..210201 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 lysine-specific high-affinity
           permease, hypothetical start
          Length = 579

 Score =  245 bits (625), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 170/541 (31%), Positives = 275/541 (50%), Gaps = 22/541 (4%)

Query: 39  DSFKRAQVDTAVDL----EGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           DS + + V  + +L    E ++ +   ++T+  +K  +K RH               V  
Sbjct: 42  DSIELSDVQVSSELYDHAESEEGEGDFHETE--VKRALKPRHVSMIALGGTIGTGLFVGI 99

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
            K L   GP G +I Y+   +++Y V Q+  E+   +  +  +   +    +   FG A 
Sbjct: 100 AKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVAN 158

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
             +Y   WA    +EL      + YWT +V    ++AIF+V L   +FF  + Y E EF 
Sbjct: 159 GYMYWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFC 218

Query: 215 FNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYWHDPGAFG-GDRAID----RFKGICSV 269
             S+KV+ + G+++ A+ +  G S QG IG +YW +PG +G G  A +    RF G    
Sbjct: 219 VASIKVIAIVGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGS 278

Query: 270 WVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQ 329
            V A+F Y G+E + +TA E +NPR++VPKA  +  +R                 +NS Q
Sbjct: 279 LVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQ 338

Query: 330 LLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEH 389
           L S      S  SPFVI+    G +V+P I N ++L +++S GNS +Y   R+L SLA  
Sbjct: 339 LESNSAVIAS--SPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALS 396

Query: 390 GMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAI 449
           G  PK F+YV +QG P + +I  +L GL+AF+A +      F WL  I+ L+ L  W  I
Sbjct: 397 GNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFI 456

Query: 450 AVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGEL 509
           +V+H+RF + ++++G S   L ++A     G+YYA FF  +++  Q + A AP       
Sbjct: 457 SVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP-----RF 511

Query: 510 DVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERK 569
           DV  FF  Y++  +LVV ++  +L+ R  R +    ++D+ S R+  D   ++ E+ E K
Sbjct: 512 DVSEFFTAYISLILLVVLFILCQLYYR-CRFLTKIEDIDIDSDRREID--AIIWEDDEPK 568

Query: 570 E 570
            
Sbjct: 569 N 569

>Scas_520.2*
          Length = 372

 Score =  238 bits (607), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 204/356 (57%), Gaps = 13/356 (3%)

Query: 206 RGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQG-YIGGQYWHDPGAFGGDRAIDRFK 264
           + + E EF+ + +++L + GF I+ I L  G    G +I GQYW+ PG+F G  +  +FK
Sbjct: 3   KSFGETEFVLSMVRILAIIGFTILGIVLACGGGPHGSFIDGQYWNYPGSFVGHNSGTKFK 62

Query: 265 GICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXX 324
           G+CSV+V AAF+Y G E  A++  E  +PR ++PKA KR                     
Sbjct: 63  GLCSVFVIAAFSYSGIEMTAVSPVENKDPRITIPKAAKR-----------TFVLIGCFVP 111

Query: 325 HNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILL 384
           +++ +LLS      + +SP VIA    G + +  ++N IIL S+ISV NSA+Y+  R ++
Sbjct: 112 YDNPRLLSRTSFVDAASSPLVIAIENGGNKGLLTLMNAIILISIISVANSAVYTCSRCMV 171

Query: 385 SLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLF 444
           ++   G  P+I   VD +GRP+  +IF   FGL++FVAAS+++ +VFTWLSA++GL  +F
Sbjct: 172 AMVHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSGLFTIF 231

Query: 445 TWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP 504
            W AI +SH+R R+AM  Q RSL EL + + TG  GS+Y        L+A FW ++ P+ 
Sbjct: 232 RWMAINLSHIRVRQAMAKQNRSLDELPFLSQTGVWGSWYGTIVLFSDLVASFWTSLFPLG 291

Query: 505 KHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEV 560
                D E FF+ +     L+   L   L+ R    ++  +++DL + R+  D +V
Sbjct: 292 GTSA-DAELFFEVFFTVSHLISMLLCPNLYMRKREFMVGLTDMDLDTGRRQMDLDV 346

>YPL265W (DIP5) [5186] chr16 (41043..42869) Dicarboxylic amino acid
           permease, also transports alanine, glycine, serine,
           asparagine and glutamine [1827 bp, 608 aa]
          Length = 608

 Score =  244 bits (623), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 168/547 (30%), Positives = 271/547 (49%), Gaps = 34/547 (6%)

Query: 44  AQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGP 103
           A+ D+    +GKD +  L K       ++K RH               + +G AL  GGP
Sbjct: 65  ARDDSFAVPDGKDENTRLRK-------DLKARHISMIAIGGSLGTGLLIGTGTALLTGGP 117

Query: 104 AGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA 163
             ++I Y     +++    AC     +Y  L G + +Y +  VD   GFA+   Y  ++ 
Sbjct: 118 VAMLIAYAFVGLLVF-YTMACLGEMASYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYF 175

Query: 164 TVLPLELVTASMTVKYWTSS--VNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221
            + P +L  A++ ++YW S   VNP V++ IF V ++ I+  G + + E EF  +S KV+
Sbjct: 176 ILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVM 235

Query: 222 LMAGFIIMAISLTA-GASEQGYIGGQYWHDPGAF--------GGDRAIDRFKGICSVWVQ 272
           +M G I++   +   G      +G +YW DPGAF        GG     +F    +V+V 
Sbjct: 236 VMLGLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGK---GKFVSFVAVFVY 292

Query: 273 AAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLS 332
           + F+Y G E   +  +E  NPR+SVPKA K  +YR                 +N  +LLS
Sbjct: 293 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS 352

Query: 333 AEGGSGSRA-SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGM 391
            +G S S A SPFV+A    G+ V+PHI N  +L  V S  NS +Y + R L +LA  G 
Sbjct: 353 TKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 412

Query: 392 CPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAV 451
            PKIF    R G P   LI   LF  +A++  S+    +F +   +  +  + +W  I +
Sbjct: 413 APKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 472

Query: 452 SHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELD 510
            ++ F +A R QG    +  Y A     G+Y+A+FF +++ LI  F + +       + D
Sbjct: 473 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLG-----HKFD 527

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLLQEEAER 568
            + F   Y+  PV ++ + GYKL  +    VI S++VDL + ++I+D  EE    ++ E+
Sbjct: 528 YKTFITGYIGLPVYIISWAGYKLIYK--TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEK 585

Query: 569 KERLRNS 575
           +ERL+++
Sbjct: 586 EERLKSN 592

>AFR668W [3861] [Homologous to ScYEL063C (CAN1) - SH; ScYNL270C
           (ALP1) - SH] complement(1659469..1661139) [1671 bp, 556
           aa]
          Length = 556

 Score =  240 bits (613), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 132/443 (29%), Positives = 221/443 (49%), Gaps = 6/443 (1%)

Query: 65  QQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124
           Q  +K  +K RH               +     +   GP G ++ Y+  +TM YCV Q+ 
Sbjct: 46  QSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSL 105

Query: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184
            E+   +  +  ++  + +  V    G A   +Y L W     LE+      + YW+ +V
Sbjct: 106 GEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244
               ++AIF+V L  I+    + Y E EF   SLKV+ +  F+   + +  G S+ G IG
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 245 GQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299
            +YW DPG +G      +    +F G  S  ++AAF + G+E + +TA E  NPR +VPK
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 300 ATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHI 359
           A     +R                 ++  QL+     + + ASPFV+A    G +V+P I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 360 INFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIA 419
           +N +I+ ++IS GNS +Y   R+L  L   G+ P   +    +G P V ++  S+FG + 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 420 FVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGAL 479
           ++  S++  +VF WL +I  +S  FTW  I+VSH+RF + ++ +G S  +L ++A     
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 480 GSYYAIFFNVIVLIAQFWIAIAP 502
           G+YYA FF +++++ Q + A  P
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP 487

>AFR667C [3860] [Homologous to ScYNL268W (LYP1) - SH]
           (1657064..1658755) [1692 bp, 563 aa]
          Length = 563

 Score =  237 bits (605), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 146/515 (28%), Positives = 251/515 (48%), Gaps = 24/515 (4%)

Query: 65  QQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124
           +  +K  +K RH               +     L   GP G ++ Y+   T++Y + Q+ 
Sbjct: 52  ETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSL 111

Query: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSV 184
            E+   +  +  +   +    +   FG A   +Y   WA    +EL      ++YWT  V
Sbjct: 112 GEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 185 NPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIG 244
               ++ IF+V +  ++FF  R Y E EF   S+KVL + G++I A  +  G S+QG IG
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIG 230

Query: 245 GQYWHDPGAFG----GDRAIDR-------FKGICSVWVQAAFAYGGSEFIALTAAEQANP 293
                 P   G    G RA  R       F G  S  ++AAF Y G+E + +TA E  NP
Sbjct: 231 -----LPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNP 285

Query: 294 RESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGV 353
           R++VPKA  +  +R                 ++ D  L++E  +   ASPFVI+    G 
Sbjct: 286 RKNVPKAINKVFFRILFFYIGSLLFVGLLVPYD-DPRLNSESSTDVNASPFVISIKNAGT 344

Query: 354 RVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVS 413
           +++P I N ++L +VIS  NS +Y   R+  SLA  G  PK   +V +QG P   ++  S
Sbjct: 345 KILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITS 404

Query: 414 LFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYR 473
           L GL++F+  ++     F WL  I+ L+ L  W  I+++H+RF + ++ +G S  +L ++
Sbjct: 405 LMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFK 464

Query: 474 ANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKL 533
           A      +YYA FF  +++  Q + A  P     + DV  FF +Y++  ++++ ++G ++
Sbjct: 465 AKFMPWAAYYATFFVTVIIFIQGYTAFTP-----KFDVTTFFTSYISLFLMLLVFIGCQI 519

Query: 534 WKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAER 568
           + +  R +    ++D+ S R+  D  V  ++E + 
Sbjct: 520 YYK-CRFLWAVEDIDIDSDRREIDAIVWEEDEPKN 553

>Scas_486.2
          Length = 597

 Score =  236 bits (602), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 169/536 (31%), Positives = 261/536 (48%), Gaps = 26/536 (4%)

Query: 53  EGKDADNGLNKTQQT-LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYV 111
           +  D+ N   KT+ T LK  ++ R                + +G +L   GP  ++I Y 
Sbjct: 55  DQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYA 114

Query: 112 TTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELV 171
               +++  + +  E+  +Y  L G + +Y T   D   GFAV   Y  ++  + P +L 
Sbjct: 115 FVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPNQLT 172

Query: 172 TASMTVKYWT--SSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLM-AGFII 228
            A++ ++YW     VNP V++ IF V ++ I+  G + + E EF  +S KVL+M A  I+
Sbjct: 173 AAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIIL 232

Query: 229 MAISLTAGASEQGYIGGQYWHDPGAFG-------GDRAIDRFKGICSVWVQAAFAYGGSE 281
           + I +  G      +G ++W  PGAF        GD    +F    SV+V A FAY G+E
Sbjct: 233 LFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTG--KFVAFVSVFVYATFAYLGTE 290

Query: 282 FIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRA 341
            + +   E  NPR+SVPKA K  +YR                 ++   LL A+  S S A
Sbjct: 291 LVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAA 350

Query: 342 -SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400
            SPFV+A    G++V+PHI N  +L  V S  NS +Y A R L SLA     PKIF   +
Sbjct: 351 ASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTN 410

Query: 401 RQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM 460
           R G P  +L    LF L+A+++ S+    +F +   +  +  L +W  I V+++ F RA+
Sbjct: 411 RWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAV 470

Query: 461 RVQGRSLGELGYRANTGALGSYYAIFF-NVIVLIAQFWIAIAPIPKHGELDVEFFFQNYL 519
           R QG       Y A     G+Y+A+FF ++I LI  F + +       + D + F   Y+
Sbjct: 471 RAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLG-----HQFDYKTFITGYI 525

Query: 520 AFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLLQEEAERKERLR 573
             PV  + Y GYKL  +    +I   EVDL + +   D  EE    E+  RKER++
Sbjct: 526 GIPVFFISYFGYKLIYK--TKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIK 579

>YOR348C (PUT4) [5125] chr15 complement(986894..988777) High
           affinity proline permease, also transports alanine and
           glycine [1884 bp, 627 aa]
          Length = 627

 Score =  230 bits (587), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 164/553 (29%), Positives = 272/553 (49%), Gaps = 44/553 (7%)

Query: 43  RAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGG 102
           R  +   VDLE   + +G +     LK  +++RH               V +   LH  G
Sbjct: 82  REDLIMDVDLEKSPSVDG-DSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCG 140

Query: 103 PAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYP-------TFLVDKGFGFAVA 155
           PAGL I Y+  S ++Y ++   C LG     LPG+ +          T  VD   GFA  
Sbjct: 141 PAGLFISYIIISAVIYPIM---CALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATG 197

Query: 156 LVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIF 215
             Y   +  ++  E   AS  V+YWT++V   V++ IF   ++ ++F   + Y E+EF F
Sbjct: 198 WNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWF 257

Query: 216 NSLKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAF-----GGDRAIDRFKGICSV 269
            S+K+L + G II++ I    G      +G +YW  PGAF     GG  ++  F  I + 
Sbjct: 258 ASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTG 315

Query: 270 WVQAAFAY-GGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSD 328
            ++ AFA+  G E + +T+AE A+ R ++ KA++R+++R                 +N  
Sbjct: 316 IIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDP 375

Query: 329 QLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSL 386
            L++A  +G  G+ +SPFVI     G++V+PHIIN  ILTS  S  N+ M+++ R LL++
Sbjct: 376 TLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTM 435

Query: 387 AEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTW 446
           A+ G  PK    +++ G P V +    L   +A++  S+   +VF W S I+ +S    W
Sbjct: 436 AQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGW 495

Query: 447 TAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAP---- 502
               ++++RFR+A+   G     L  R      G  Y ++F++IV+     I I      
Sbjct: 496 MCGCIAYLRFRKAIFYNG-----LYDRLPFKTWGQPYTVWFSLIVIGI---ITITNGYAI 547

Query: 503 -IPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR-LVIPSSEVDLLSHRQIFDEEV 560
            IPK+    V  F   Y+  P+ +V + G+KL+ R +R   +P SE+D+ +        V
Sbjct: 548 FIPKYWR--VADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGL------V 599

Query: 561 LLQEEAERKERLR 573
            ++E++   E +R
Sbjct: 600 EIEEKSREIEEMR 612

>Kwal_33.15545
          Length = 576

 Score =  222 bits (566), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 163/520 (31%), Positives = 252/520 (48%), Gaps = 21/520 (4%)

Query: 68  LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127
           LK  ++ RH               + +G +L   GP  ++I Y     ++Y V+    E+
Sbjct: 50  LKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEM 109

Query: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSS--VN 185
             A+  L G + +Y +  VD   GFAV   Y  ++  V P +L   +M +++W S   VN
Sbjct: 110 A-AFIPLDG-FTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVN 167

Query: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTA-GASEQGYIG 244
           P V++ IF   ++ I+  G R + E EF  +S+KVL+M G I++   +   G       G
Sbjct: 168 PGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTG 227

Query: 245 GQYWHDPGAFGG-DRAID----RFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299
            ++W DPGAF     AI     +F    SV+  A FAY G+E   + AAE  NPR SVP+
Sbjct: 228 FRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPR 287

Query: 300 ATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEG-GSGSRASPFVIAAALHGVRVVPH 358
           A K  LYR                 +N  +LL A+   + + ASPFV+A     + V+PH
Sbjct: 288 AIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPH 347

Query: 359 IINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLI 418
           I N  +L  V S  NS +Y A R L  LA  G  P+IF   ++ G P  +L    LF L+
Sbjct: 348 IFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLL 407

Query: 419 AFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGA 478
           A++  S+    VF +   +  +  L +W  I ++++RF +A+RVQ      L Y A    
Sbjct: 408 AYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQP 467

Query: 479 LGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRD 537
             +Y A+FF  ++ LI  + + +       + D + F   Y+  PV ++ Y+GYK+  R 
Sbjct: 468 WSTYVALFFCCLIGLIKNYTVFLG-----HKFDYKTFISGYIGIPVYLICYVGYKVVYRT 522

Query: 538 FRLVIPSSEVDLLSHRQIFDE--EVLLQEEAERKERLRNS 575
            +L+ P  +VDL + +   D   E     E ER E + NS
Sbjct: 523 -KLIKP-EDVDLYTFKDAIDAEEEEYKLLEKERLENMENS 560

>AFR156W [3348] [Homologous to ScYOR348C (PUT4) - NSH]
           complement(717645..719321) [1677 bp, 558 aa]
          Length = 558

 Score =  216 bits (551), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 155/546 (28%), Positives = 259/546 (47%), Gaps = 29/546 (5%)

Query: 25  IEYAGNRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXX 84
           IE A N     +      R  ++   +LE + A +  N    TL   +++RH        
Sbjct: 10  IEKADNGGYMHKVKTPHSRTSLE---ELETQSAGSEYN----TLHKGLQSRHIQLIALGG 62

Query: 85  XXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTF 144
                  V +   LH  G A L++ ++  ST++Y ++ +  E+ + Y    G+     + 
Sbjct: 63  CIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM-ICYLPQQGSVPELVSR 121

Query: 145 LVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFG 204
            VD   GFA    Y   +A ++  EL  A+  V YW + V    ++ IF V ++ ++F  
Sbjct: 122 YVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTA 181

Query: 205 SRGYAEAEFIFNSLKVLLMAGFIIMAISLT-AGASEQGYIGGQYWHDPGAFGGDRA---I 260
            + Y EAEF F S+K++ + G +++++ +   GA      G +YW +PG F    A    
Sbjct: 182 VKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSLAPGST 241

Query: 261 DRFKGICSVWVQAAFAYGGS-EFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXX 319
            RF  +    +++AFA+  S E I +   E  + R +  KA++R++YR            
Sbjct: 242 GRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMI 301

Query: 320 XXXXXHNSDQLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMY 377
                    +L+ A   G  G+ +SPFV   A  G+ V+ H+IN  IL+S  S GNS MY
Sbjct: 302 GVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMY 361

Query: 378 SAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAI 437
           ++ R++L+LA  G  PK  T ++R G P   +I  +L   +A++       NVF WLS I
Sbjct: 362 ASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNI 421

Query: 438 AGLSQLFTWTAIAVSHVRFRRAM---RVQGRSLGELGYRANTGALGSYYAIFFNVIVLIA 494
             +S    W A+ ++ +RFRR +    +Q R    + Y+       +YY  F  V+V + 
Sbjct: 422 CTISGFIGWFAMGIAFIRFRRGIVFNNLQSR----IPYQGPLQPYIAYYFTFMTVVVCLT 477

Query: 495 Q-FWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHR 553
             F + +      G  +V  F   Y+  P+ +V YLG+KLW R  R  IP  ++D+++  
Sbjct: 478 NGFHVFL-----KGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRT-RWYIPVEQIDVITGL 531

Query: 554 QIFDEE 559
              +EE
Sbjct: 532 VEAEEE 537

>CAGL0E05632g complement(556619..558415) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, hypothetical start
          Length = 598

 Score =  216 bits (551), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 155/538 (28%), Positives = 263/538 (48%), Gaps = 57/538 (10%)

Query: 55  KDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTS 114
           K + +  + T   LK  +K+RH               V +   LH  GPAGL I Y   S
Sbjct: 62  KHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIIS 121

Query: 115 TMLYCVVQACCELGVAYATLPGNYNAYPTF-------LVDKGFGFAVALVYGLQWATVLP 167
           +++Y ++Q   E+ V Y  LPG+ +    F        VD+  GFA A  Y   +  ++ 
Sbjct: 122 SVIYPIMQGIGEM-VCY--LPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVA 178

Query: 168 LELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFI 227
            E   AS  V+YWT+SV    ++ IF   ++ ++F   + Y E+EF F S+K+L + G I
Sbjct: 179 AECTAASGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLI 238

Query: 228 IMA-ISLTAGASEQGYIGGQYWHDPGAF-----GGDRA--IDRFKGICSVWVQAAFAY-G 278
           I++ I    G      +G +YW +PG F     GG     +D + GI    ++  FA+  
Sbjct: 239 ILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGI----IKGGFAFIL 294

Query: 279 GSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGG 336
           G E IA+T++E  + R ++ KA +R+++R                 +N   L +A  +  
Sbjct: 295 GPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNK 354

Query: 337 SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396
            G+ +SPFVI     G++V+PHIIN  IL+S  S GN+ M+++ R LL++A++G  P+IF
Sbjct: 355 PGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIF 414

Query: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456
             V+R G P   +   S    +A++  S+   +VF W S I+ +S    W  + ++++RF
Sbjct: 415 AKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRF 474

Query: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVL------------IAQFWIAIAPIP 504
            +A+   G     +  R    A G  Y I++ ++V+            I +FW       
Sbjct: 475 HKAILFHG-----MQSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFW------- 522

Query: 505 KHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRD-FRLVIPSS--EVDLLSHRQIFDEE 559
                D + F   Y+  PV  V ++G+++++R  F L    S  E+D+++  +  +E+
Sbjct: 523 -----DAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEK 575

>KLLA0F23419g complement(2187386..2189107) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease, start by similarity
          Length = 573

 Score =  215 bits (547), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 157/530 (29%), Positives = 250/530 (47%), Gaps = 26/530 (4%)

Query: 62  NKTQ---QTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLY 118
           NK Q     LK  +K+ H               V +   L+  GPAGL I Y   ST++Y
Sbjct: 43  NKPQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIY 102

Query: 119 CVVQACCELGVAYATLP------GNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVT 172
            V+ A  E+      LP      G+ +   T  VD   GFAV   Y   +  ++  E   
Sbjct: 103 PVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTA 162

Query: 173 ASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAIS 232
           AS  V YWT++V    ++ IF   ++ ++      Y  +E IF SLK+  + G II++I 
Sbjct: 163 ASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIV 222

Query: 233 LT-AGASEQGYIGGQYWHDPGAFG---GDRAIDRFKGICSVWVQAAFAY-GGSEFIALTA 287
           L   G      +G ++W DPGA+     D    R   I +  ++A FA+  G E + LT+
Sbjct: 223 LFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIITGVIRAGFAFILGPELVVLTS 282

Query: 288 AEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGGSGSRASPFV 345
            E  + R ++ KA +R+++R                  N   LL+A  +G  G+ +SPFV
Sbjct: 283 TEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFV 342

Query: 346 IAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRP 405
           I     G++V+PHIIN  IL+S  S GNS MY+  R LLSL++ G  PKIF  V+R G P
Sbjct: 343 IGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVP 402

Query: 406 LVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGR 465
              + F + F  +A++  S+   +VF W S I+ +S    W    V+++RFR+A+     
Sbjct: 403 YTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL 462

Query: 466 SLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLV 525
               L ++        Y+  F+ +++ I                D   F   Y+  P+ +
Sbjct: 463 -YDRLPFKT---PFQPYFTWFYIILIAIICLINGYESFVHWNYKD---FIAAYITLPLFL 515

Query: 526 VFYLGYKLWKRDF-RLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           + +LG+K + R + + +I  SE+D+ +  +  +EE   +E   R+   RN
Sbjct: 516 ILWLGHKAYTRTWSQWMISVSEIDVTTGLREIEEET--KELNARRIPPRN 563

>Kwal_8.590
          Length = 629

 Score =  214 bits (544), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/564 (26%), Positives = 263/564 (46%), Gaps = 18/564 (3%)

Query: 7   DKPAVPKATXXXXXXXXXIEYAGNRNAWTRFTDSFKRAQVDTAVD--LEGKDA--DNGLN 62
           D P + K           +  +G + A+     S +  +  T  D  L+ +D+     L+
Sbjct: 52  DHPGLHKTRTTCFTIVSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLS 111

Query: 63  KTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQ 122
             ++  +  +  R                V+ G  +  GGP  L+I +   S +   + +
Sbjct: 112 LEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSK 171

Query: 123 ACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS 182
             C + V Y  + G++  +    VD+  GFAV   Y +  A  +  E+    + V+YWT 
Sbjct: 172 CMCVM-VTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTD 230

Query: 183 SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGY 242
            +     +++  +    ++ +    + E EF  +  KV+L  G II  + + AG + Q  
Sbjct: 231 KIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHT 290

Query: 243 I-GGQYWHDPGAFG---GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVP 298
           + G + W +PGAF     D ++ RF G  S  V A + + G +++   A+E  NPR+ +P
Sbjct: 291 VLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIP 350

Query: 299 KATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGGSGSRASPFVIAAALHGVRVV 356
            + ++   R                 +N   ++ A  EG  G+ ASP+V A    G+RV+
Sbjct: 351 SSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVL 410

Query: 357 PHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFG 416
           PHI+N +ILTS+IS GNS++YSA R+L  LA     P+IF    ++G P+   I V +  
Sbjct: 411 PHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVIC 470

Query: 417 LIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANT 476
            +A+++ SN   NV TW   +   +    +  I VS+++FR+    Q   L  L Y +++
Sbjct: 471 GLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSS 530

Query: 477 GALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKR 536
               +++++F+ V++L+   +         G  D + F  +Y   P  +VF  G+KL+K 
Sbjct: 531 LPYLAWHSLFWLVLMLLVNGYTVFL----KGSWDTQSFVFSYFMIPFFLVFLFGHKLYKG 586

Query: 537 DFRLVIPSSEVDLLSH-RQIFDEE 559
             + V P  E+DL +   ++ DE+
Sbjct: 587 T-KSVRP-LEMDLFTGIEELADED 608

>KLLA0B14685g complement(1289025..1290740) similar to sp|P15380
           Saccharomyces cerevisiae YOR348c PUT4 proline and
           gamma-aminobutyrate permease P23. 1.f18.1, start by
           similarity
          Length = 571

 Score =  212 bits (539), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 155/524 (29%), Positives = 251/524 (47%), Gaps = 30/524 (5%)

Query: 53  EGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVT 112
           +G  +D    K  Q +   +KTRH               + SG AL   GPA L+I Y+ 
Sbjct: 40  QGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYII 99

Query: 113 TSTMLYCVVQACCELGVAYATLPGNYNAY---PTFLVDK-GFGFAVALVYGLQWATVLPL 168
            S  ++ ++    E+ V    LPG  + Y    T+L     F     L Y +  A ++P 
Sbjct: 100 ISFFVWSIMNQMTEM-VCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAM--AMIVPA 156

Query: 169 ELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFII 228
           E+   ++ V+YWT + N  +F++IF V  + +     + + E+EF  +S+K+L + G II
Sbjct: 157 EITACALLVQYWTDA-NSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLII 215

Query: 229 MAISL--TAGASEQGYIGGQYWHDPGAFGGDRA---IDRFKGICSVWVQAAFAYG-GSEF 282
           + I +    G ++   +G  YW +PGAF    A     RF  + +  +++ F++    E 
Sbjct: 216 VGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVPET 275

Query: 283 IALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGGSGSR 340
           +   +AE   PR ++PKA +R++YR                  N+D+L++A   G S + 
Sbjct: 276 VTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAA 335

Query: 341 ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400
           ASPFVI     G++++PHIIN  ILTS  S G   +Y + R L S+A  G  PKIF  V+
Sbjct: 336 ASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVN 395

Query: 401 RQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM 460
           R G P  +    SLF  +A++  S     VF WLS IA +S   +W  ++++++RFR+ +
Sbjct: 396 RFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVI 455

Query: 461 RVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLA 520
                +      R     L      FF ++ L   + + +      G  +V  FF +Y+ 
Sbjct: 456 NALDLNDRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFV-----KGNWNVSDFFASYVT 510

Query: 521 FPVLVVFYLG----YKLWK-RDFRLVIPSSEVDLLSHRQIFDEE 559
              ++  YL     YK W  RDF+ +    EV++L    I DEE
Sbjct: 511 IGFVIFLYLVGSFYYKQWTFRDFKEI----EVEILPKIDIADEE 550

>Kwal_26.6940
          Length = 570

 Score =  211 bits (538), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 155/529 (29%), Positives = 252/529 (47%), Gaps = 28/529 (5%)

Query: 50  VDLEGKDADN-GLNKTQQ----TLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPA 104
           +D E   A N G +++Q+    TLK  +++RH               V +   L   GPA
Sbjct: 26  LDTESLSALNTGGSESQKREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPA 85

Query: 105 GLVIGYVTTSTMLYCVVQACCELGVAYATLPGN-------YNAYPTFLVDKGFGFAVALV 157
           GL+  Y+  S ++Y V+ A  E+ V Y  LPG+        +   +   D   GFA    
Sbjct: 86  GLLTSYIIISLVIYPVMNALGEM-VCY--LPGSGTDSGGSISKLVSRYADPSLGFATGWN 142

Query: 158 YGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNS 217
           Y   +  ++  E   AS  V YWT+ V    ++ IF   +  ++F   + Y E+EF F  
Sbjct: 143 YYYCYVILIAAECTAASGVVTYWTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAI 202

Query: 218 LKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVW---VQA 273
           LK+L + G + ++ I    G      +G +YW  PGAF              VW   ++ 
Sbjct: 203 LKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKG 262

Query: 274 AFAY-GGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLS 332
            FA+  G E +A+T++E  + R ++ KA++R+ YR                  N   L  
Sbjct: 263 GFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRD 322

Query: 333 A--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG 390
           A   G +G+ +SPFVIA     ++++PHIIN  IL+S  S GNS M++A R LLS+AE G
Sbjct: 323 ALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDG 382

Query: 391 MCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIA 450
           + PK+F  ++R G P   +   + F  +A++  S+     FTW S I+ +S    W  I 
Sbjct: 383 VAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIG 442

Query: 451 VSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELD 510
           V+++RFR+A+  +G     + +++     G+Y+ I    I+ +   +    P    G   
Sbjct: 443 VAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGAD- 500

Query: 511 VEFFFQNYLAFPVLVVFYLGYKLWKRDFRL-VIPSSEVDLLSHRQIFDE 558
              F   Y+  PV VV ++G+K++ R     VIP +EVD+ +     +E
Sbjct: 501 ---FVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTTGLAEIEE 546

>ACL135W [914] [Homologous to ScYPL265W (DIP5) - NSH]
           complement(115359..117125) [1767 bp, 588 aa]
          Length = 588

 Score =  210 bits (534), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 155/542 (28%), Positives = 252/542 (46%), Gaps = 26/542 (4%)

Query: 48  TAVDLEGKDADNGLNKTQQ--TLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAG 105
           ++ D E +  D   +   +   LK +++ RH               + +G +L   GP  
Sbjct: 37  SSTDQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGS 96

Query: 106 LVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATV 165
           ++I Y     +++ V+    E+  AY  L G + +Y T   D   GFAV   Y  ++  +
Sbjct: 97  ILIAYSIMGWVVFTVMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVL 154

Query: 166 LPLELVTASMTVKYW--TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLM 223
            P +L   ++ +++W   + V+P V++ +    ++ I+  G R + E EF  +S KVL+M
Sbjct: 155 TPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVM 214

Query: 224 AGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAID--------RFKGICSVWVQAA 274
              +I+ + L  G       +G +YW DPGAF      D        +F    SV+V A 
Sbjct: 215 LCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYAL 274

Query: 275 FAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAE 334
           FAY G+E   + AAE  +PR +VP+A K  LYR                 +N   L+ A 
Sbjct: 275 FAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQAS 334

Query: 335 GGSGSRAS-PFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP 393
               S A+ P+V+A     + V+P++ N  +LT V S  NS +Y   R L  LA  G  P
Sbjct: 335 SAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAP 394

Query: 394 KIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSH 453
           K+F   ++ G P   L   +LF  +A+++ S      F +   +  +  L +W +I +++
Sbjct: 395 KLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITY 454

Query: 454 VRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVE 512
           + F RA R QG     L Y A       + A+ F + V LI  F   I       E+DV 
Sbjct: 455 ICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGK-----EVDVP 509

Query: 513 FFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD--EEVLLQEEAERKE 570
            F   Y+  P+ +  ++GYK+  +     IPS EVDL + ++  D  EE  ++E A  KE
Sbjct: 510 TFITGYIGLPIYIFCFIGYKIVHKT--KWIPSKEVDLFTFKEAIDLEEEECIRERALMKE 567

Query: 571 RL 572
           +L
Sbjct: 568 QL 569

>Sklu_2438.14 YOR348C, Contig c2438 29357-31033
          Length = 558

 Score =  207 bits (528), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 145/536 (27%), Positives = 249/536 (46%), Gaps = 38/536 (7%)

Query: 51  DLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGY 110
            LEG   D      +  L+  + +RH               V +   LH  GP  L + +
Sbjct: 35  QLEGTKCD------ENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSF 88

Query: 111 VTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLEL 170
           V  S ++Y V+    E+ + Y    G      +  VD   GFA    Y   ++ ++  EL
Sbjct: 89  VIISFIVYPVMNTLAEM-ICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATEL 147

Query: 171 VTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMA 230
             A+  V+YWT  V+  V++ IF V ++ ++F   + Y E+EF F SLK++ + G +I++
Sbjct: 148 SAAAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVS 207

Query: 231 ISLT-AGASEQGYIGGQYWHDPGAF-----GGDRAIDRFKGICSVWVQAAFAYGGS-EFI 283
           I +   GA     +G +YW++PG F     GG+    RF  I +  +++ FA+  S E I
Sbjct: 208 IVIFFGGAPSHDRLGFRYWNNPGPFAYHITGGNTG--RFLDIWTAIIKSGFAFILSPELI 265

Query: 284 ALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGGSGSRA 341
            L   E  + R ++ KA++R+++R                  +  +L+ A      G+ +
Sbjct: 266 GLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAAS 325

Query: 342 SPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDR 401
           SPFV   +  G+ V+ HIIN +IL+S  S  NS MY++ R +L+LA+ G  PK+FT ++R
Sbjct: 326 SPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINR 385

Query: 402 QGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM- 460
            G P   +   +    + ++ AS+    VFTWLS I  +S    W  I ++++RFR+A+ 
Sbjct: 386 LGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIF 445

Query: 461 ------RVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFF 514
                 RV  +S  +  +            +       I ++W            +   F
Sbjct: 446 YNNLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYW------------NASDF 493

Query: 515 FQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKE 570
              Y+  P+  + YLG+K+W +  R  IP  E+D+++     +EE  + +    K 
Sbjct: 494 VAAYITLPIFFLLYLGHKIWFKT-RWYIPFREIDVITGLADAEEEAKMTQPRTPKN 548

>Scas_84.1
          Length = 213

 Score =  194 bits (493), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 132/207 (63%), Gaps = 2/207 (0%)

Query: 222 LMAGFIIMAIS-LTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGS 280
           ++ GF I+ I  +  GA   GYIG + WH+PG+F GD+ +DRFKG+ S    AAFA+G +
Sbjct: 1   MLTGFFILGIVVICGGAGNDGYIGTKLWHNPGSFRGDKPVDRFKGVASTLANAAFAFGMT 60

Query: 281 EFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSR 340
           EF+ +TA+EQ+NPR+++P A K  LYR                 ++SDQLL    G+ ++
Sbjct: 61  EFLGVTASEQSNPRKAIPSAAKNMLYRIICIYLGSVTIVGYLVPYDSDQLLGTS-GAATK 119

Query: 341 ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400
           ASP+V+A ++HGVRVVPH I+ +IL SV+SVGNSA YS  R LL L++ G  P    YVD
Sbjct: 120 ASPYVLAISVHGVRVVPHFIHAVILMSVVSVGNSAFYSTSRQLLPLSQLGYAPSFLNYVD 179

Query: 401 RQGRPLVTLIFVSLFGLIAFVAASNQE 427
           R GRP+       L G+IA+ A S +E
Sbjct: 180 RNGRPMKAYCVSPLAGVIAYCATSPEE 206

>Kwal_23.2817
          Length = 580

 Score =  200 bits (509), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 153/554 (27%), Positives = 268/554 (48%), Gaps = 49/554 (8%)

Query: 42  KRAQVDTAV--DLE-GKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKAL 98
           K+  + TAV  D+E G  +D    K    +   +K+RH               + SG AL
Sbjct: 35  KKDAIITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTAL 94

Query: 99  HFGGPAGLVIGYVTTSTMLYCVVQACCELGV--------AYATLPGNYNAYPT-FLVDKG 149
              GPA L+I Y   S  ++ ++    E+ V        + A+L G Y   P+ F+    
Sbjct: 95  SSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWN 154

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209
             +A+++V        +P E+   ++ ++YWT + N  +FV IF +    +     + + 
Sbjct: 155 CFYAMSMV--------VPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFG 205

Query: 210 EAEFIFNSLKVLLMAGFIIMAISL--TAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGIC 267
           E+EF  + +K+L + G I++ + +    G ++   +G  YW+ PGAF             
Sbjct: 206 ESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKGSTGAFL 265

Query: 268 SVW---VQAAFAYGG-SEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXX 323
           +VW   +++ FA+    E  +  +AE A PR+++P+A +R++YR                
Sbjct: 266 AVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIV 325

Query: 324 XHNSDQLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPR 381
            +++  L  A   G + + ASPFVI     G+R++PHIIN  ILTS  S   S +Y A R
Sbjct: 326 GYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASR 385

Query: 382 ILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLS 441
           +L SLA  G  PK F+ V++ G P  ++   SLFG++A++  S     VF WLS IA +S
Sbjct: 386 VLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATIS 445

Query: 442 QLFTWTAIAVSHVRFRRA---MRVQGRSLGELGYRAN-TGALGSYYAIFFNVIVLIAQFW 497
               W  ++++++RFR+    +++  R    + YR     AL    AIFF ++ +   F+
Sbjct: 446 GFVNWVFVSITYLRFRKITDYLKINDR----VPYRRRGQRALAYASAIFFALLAITNGFY 501

Query: 498 IAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD 557
           + IA     G  +V  FF  Y+    + V ++G  ++ +++       ++D++  R+I  
Sbjct: 502 VFIA-----GNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTF----RDMDVVG-REIMP 551

Query: 558 EEVLLQEEAERKER 571
           +  + Q + E KE 
Sbjct: 552 K--IDQADQEEKEE 563

>CAGL0M00154g 22039..23691 similar to sp|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or sp|P04817 Saccharomyces
           cerevisiae YEL063c CAN1, hypothetical start
          Length = 550

 Score =  194 bits (494), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 146/537 (27%), Positives = 246/537 (45%), Gaps = 31/537 (5%)

Query: 45  QVDTAVDLEGKDAD-NGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGP 103
           +V +++D++   +D +     ++ L   +  RH               +++ K+LH GGP
Sbjct: 22  EVSSSLDIDELRSDFDPEQNIREDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGP 81

Query: 104 AGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWA 163
           A L + Y     ++Y  +    E+   +  + G++ +Y      + F  A+   Y    A
Sbjct: 82  ASLFMNYTIIGGVVYLTMLCLGEMS-TFMPISGSFCSYARKFGSESFACALMWNYWFNDA 140

Query: 164 TVLPLELVTASMTVKYWTSSVNPDVFVA---IFYVFLLFIHFFGSRGYAEAEFIFNSLKV 220
             +  +L    + + YW ++ +   +     IF+ F+LF++    R Y EAE+    LKV
Sbjct: 141 VSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKV 200

Query: 221 LLMAGFIIMAISLTAGASEQG-YIGGQYW-HDPGAFGGDRAIDRFKGICSVWVQAAFAYG 278
           + +  F IM+I +  G + Q  YIG + W H    F     ++ FKG  S++V A FAYG
Sbjct: 201 IAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPF-----VNGFKGFASLFVSACFAYG 255

Query: 279 GSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSG 338
           G+E I LT  E +NP  + PK  K   +R                 ++   L +      
Sbjct: 256 GTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKS---- 311

Query: 339 SRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP-KIFT 397
              SPF +   + G R     +N +ILTSVIS  N A+++  RI+ ++A  G  P KI  
Sbjct: 312 VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVG 371

Query: 398 YVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFR 457
             +R   P V ++     G +   A+      ++TWL  I G+S    W  I ++ +RFR
Sbjct: 372 RTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFR 431

Query: 458 RAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN 517
           + + VQG++   L ++  T   G Y+ + F V +++ Q W A  P        V  FF  
Sbjct: 432 KGLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP------WSVTDFFSV 484

Query: 518 YLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLRN 574
           YL   V    Y+ + LWKRD+   +   ++D ++ R I  +E++     E  ERL N
Sbjct: 485 YLELFVFPFVYIIWWLWKRDW--FVKYEDMDFVTDRYIPTKEIV-----ELNERLDN 534

>Kwal_26.9612
          Length = 543

 Score =  194 bits (493), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 232/496 (46%), Gaps = 20/496 (4%)

Query: 50  VDLEGKDADNGLNK--TQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLV 107
           V+L+  + D+ LN+      +K  +K RH               + +G AL+ GGP  L+
Sbjct: 23  VELQRLETDS-LNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALL 81

Query: 108 IGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLP 167
           +G+     + + ++++  EL   Y +  G +         +G        Y + +  VL 
Sbjct: 82  LGFGIIGLVCFSIMESIGELVTLYPS-GGGFITLARRFHSEGLSAVSGYAYIVVFFAVLA 140

Query: 168 LELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFI 227
            E  T S  +++W   V    +  IF+ F L     G   + E E+     K+L +  F 
Sbjct: 141 NEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFY 200

Query: 228 IMAIS-LTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALT 286
           I +I  ++ G   +  IG QYW +PGA         F+GI  V+V  +  Y G+E +AL 
Sbjct: 201 IFSIVYMSGGIPGKPPIGFQYWKNPGALS-----HGFRGIAVVFVFCSTFYSGTESVALA 255

Query: 287 AAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVI 346
           A E  NPR++VP A ++  +R                 +N D  L A+  + S  SP  I
Sbjct: 256 ATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYN-DPTLGAQ--TKSLKSPISI 312

Query: 347 AAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPL 406
           A +  G     H++N  IL + IS  NS++Y   R L  LA  G+ P+I  + D++G P+
Sbjct: 313 ALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPV 372

Query: 407 VTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRS 466
             LI  +  GLI+ +  S    N + ++  ++G+     W+AI+++H+RFR+A   QGRS
Sbjct: 373 PALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRS 432

Query: 467 LGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVV 526
           L EL YRA      + +++  N+ + + Q W ++ P      +D       Y+  P   +
Sbjct: 433 LSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVPFVAKDFVDA------YILLPAAGL 486

Query: 527 FYLGYKLWK-RDFRLV 541
            Y+G   WK R+F+ V
Sbjct: 487 LYVGINFWKNRNFKTV 502

>Kwal_26.8097
          Length = 544

 Score =  186 bits (473), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 156/542 (28%), Positives = 251/542 (46%), Gaps = 33/542 (6%)

Query: 42  KRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFG 101
           + +  D   D EG++AD+     ++ L  ++  RH               + +GKAL  G
Sbjct: 18  RTSSSDVQYDSEGQEADH----VREHLNRSLTPRHINMISIAGVIGTGLYLGTGKALAKG 73

Query: 102 GPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQ 161
           GPA LVI Y     ++Y  +    E+   +  + G++ +Y          F +   Y   
Sbjct: 74  GPASLVINYSIIGLVVYLTMLCLGEMS-TFMPISGSFCSYAKKFGSGSLAFTLMCNYWFN 132

Query: 162 WATVLPLELVTASMTVKYW-TSSVNPDVFVA--IFYVFLLFIHFFGSRGYAEAEFIFNSL 218
            A  +  +L    + + +W TS  +   + A  IF+  LL ++    R Y EAE+    L
Sbjct: 133 DAVSVASDLTALQLILDFWKTSDAHFPYWAASLIFWFVLLLLNVVHVRVYGEAEYWLAML 192

Query: 219 KVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAY 277
           KV+ +  F I++I + AG + +  YIG + W    + G    ++ FKG  S++V ++FAY
Sbjct: 193 KVIAIIIFFIISIVVNAGHNQDHSYIGFKNW----SVGEAPFVNGFKGFASLFVSSSFAY 248

Query: 278 GGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGS 337
           GG+E I LTA E  NP  + PK  K   +R                 +N  +L       
Sbjct: 249 GGTESITLTAGEAKNPIRNTPKIIKTVFWRILIFYVFTTFFIGMNVPYNYPKL----SEK 304

Query: 338 GSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHG-MCPKIF 396
               SPF I   + G +     +N +ILTSVIS GN A+++  R+L +L   G   P I 
Sbjct: 305 SVMTSPFTIVFQMVGTKAAASFMNAVILTSVISAGNHALFAGSRVLFNLGLEGYFFPSII 364

Query: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456
           T  +R   P V ++     G + F ++      ++TWL  I G+S    W  I++  +RF
Sbjct: 365 TKTNRYQIPYVAVLITWAAGGLCFGSSFVGAGTLWTWLQNIVGVSNQIAWLCISIVSIRF 424

Query: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516
           RR +  QG++  EL +   T   G Y+ + F   +++ Q W + AP       +V  FF 
Sbjct: 425 RRGLAKQGKT-HELQFSNWTYPYGPYFLVLFVSFIILVQGWSSFAP------WNVTDFFS 477

Query: 517 NYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIF-DEEVLLQEEAE-----RKE 570
            Y+   V V  Y+ + LWKRD    + S ++D ++ + I   EEVLL EE +     +K 
Sbjct: 478 YYIELIVFVALYVFWWLWKRD--AFVRSEDMDFVTDKYISPHEEVLLNEELDNLKGWKKV 535

Query: 571 RL 572
           RL
Sbjct: 536 RL 537

>KLLA0F27093g 2501049..2502740 similar to sp|P43548 Saccharomyces
           cerevisiae YFL055w AGP3 amino acid permease, start by
           similarity
          Length = 563

 Score =  186 bits (472), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 129/502 (25%), Positives = 223/502 (44%), Gaps = 24/502 (4%)

Query: 56  DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTST 115
           D D+G+       K  +K RH               + +G AL  GGP  L++G+     
Sbjct: 51  DPDSGV-------KRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGI 103

Query: 116 MLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASM 175
           + + ++++  E+   Y +  G +                   Y + +  VL  E  T S 
Sbjct: 104 LAFIMMESIGEMITLYPS-GGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSS 162

Query: 176 TVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL-LMAGFIIMAISLT 234
            +++W   V    ++ IF+         G   + E E+     K+L L+  +I   + ++
Sbjct: 163 IMQFWGPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYIS 222

Query: 235 AGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPR 294
            G   +   G QYW+DPGA       + FKGI +V+V  +  Y G+E +AL A E  NPR
Sbjct: 223 GGVKNRPAFGFQYWNDPGALS-----NGFKGIANVFVFCSTFYSGTESVALAATESKNPR 277

Query: 295 ESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIAAALHGVR 354
            +VP A ++  +R                 +N + L  A   +    SP  IA +  G  
Sbjct: 278 RAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA---TKVLKSPIAIAISRAGWP 334

Query: 355 VVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSL 414
              H++N  IL + IS  N ++Y   R L  LA  G+ PK+  + DR+G P+  +   + 
Sbjct: 335 AGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNA 394

Query: 415 FGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRA 474
            GLI+ +  S    + + ++  ++G+     W  I+++H+RFR+A ++QG +  EL Y+A
Sbjct: 395 LGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKA 454

Query: 475 NTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLW 534
               +    +I  N+ + + Q W    P       D + F   Y+  P  ++ YLG   W
Sbjct: 455 KLFPVFPIVSIIANIFLGLVQGWSYFKP------FDAKNFVDAYILIPAGIILYLGVSYW 508

Query: 535 K-RDFRLVIPSSEVDLLSHRQI 555
           K + F   +  SEV+LL  +++
Sbjct: 509 KTKGFLTAVDLSEVNLLFGQRL 530

>Scas_377.1
          Length = 148

 Score =  173 bits (439), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 109/137 (79%), Gaps = 1/137 (0%)

Query: 438 AGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFW 497
           +GLSQLFTW +I +SH+RFRRAMRVQGRS+GE+G+++  G  GS Y+    V++LIAQFW
Sbjct: 1   SGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFW 60

Query: 498 IAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFD 557
            A+ P+ + G+ DV+ FF+NYLA P+ +V Y G+K+WK+D+RL I + ++DL+SHR+IFD
Sbjct: 61  TALVPVGE-GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFD 119

Query: 558 EEVLLQEEAERKERLRN 574
           EE+L QE+ E + +LR+
Sbjct: 120 EELLKQEDEEYRRKLRD 136

>Scas_552.3
          Length = 558

 Score =  183 bits (465), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 144/534 (26%), Positives = 250/534 (46%), Gaps = 27/534 (5%)

Query: 45  QVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPA 104
           ++D ++  E +D D   N  ++ L+  +K RH               +++ K+L+ GGPA
Sbjct: 33  ELDPSLTTE-EDYDPEAN-IREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPA 90

Query: 105 GLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWAT 164
            L + Y     ++Y  +    E+   Y  + G++ +Y      + F  A+   Y    A 
Sbjct: 91  SLFMNYTIMGGVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAV 149

Query: 165 VLPLELVTASMTVKYWTSSVNPDVFVA---IFYVFLLFIHFFGSRGYAEAEFIFNSLKVL 221
            +  ++    + + YW +  +   + A   +F+  ++ ++    R Y EAE+    LKV+
Sbjct: 150 SVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVI 209

Query: 222 LMAGFIIMAISLTAGASEQG-YIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGS 280
            +  F I++I +  G + Q  YIG + W+     G    +D FKG  S++V A+FAYGG+
Sbjct: 210 AIIIFFILSIVVNVGHNPQHEYIGFKNWNH----GEAPFVDGFKGFASLFVSASFAYGGT 265

Query: 281 EFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSR 340
           E I LT  E ANP  + PK  K   +R                 ++   L +        
Sbjct: 266 ESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDT----KSVV 321

Query: 341 ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCP-KIFTYV 399
            SPF +   + G +     +N +I+TSVIS  N A+++  R++ ++   G  P KI +  
Sbjct: 322 TSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRT 381

Query: 400 DRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRA 459
           +R   P V+++  S  GL+ F A+      V+TWL  I G+S    W  I ++ +RFR+ 
Sbjct: 382 NRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKG 441

Query: 460 MRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYL 519
           +  QG++  EL Y+  T   G Y+ + F   +++ Q W A  P       DV  FF  YL
Sbjct: 442 LEKQGKT-HELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP------WDVTNFFSYYL 494

Query: 520 AFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLR 573
              V    ++ + L+KRD R V    ++D ++ R I  +E++  E  E  + L+
Sbjct: 495 DLFVFPFCFIIWWLYKRD-RFV-KLEDMDFVTDRYIPTKEII--ELNENLDHLK 544

>Scas_460.3
          Length = 584

 Score =  173 bits (438), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 129/499 (25%), Positives = 221/499 (44%), Gaps = 17/499 (3%)

Query: 48  TAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLV 107
           T+V  +  D+   L  +  T K N+  RH               VA GK L+ GGPA L+
Sbjct: 54  TSVSSQDNDSKTFLVASHTT-KRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLL 112

Query: 108 IGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLP 167
           + +      + C+  +  E+ V +  +   +    T  VD       +  +       +P
Sbjct: 113 LAFAIWCIPILCITVSTAEM-VCFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIP 171

Query: 168 LELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAG-F 226
            E+VT +  + YW    +  + + I  +  L I     + Y E EF   S K++L  G F
Sbjct: 172 YEIVTVNTIIHYWRDDYSAAIPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLF 231

Query: 227 IIMAISLTAGASEQGYIGGQYWHD-PGAFGGDRAIDR------FKGICSVWVQAAFAYGG 279
               I++  G  ++   G +Y+HD P        IDR      F+G     +QA+F   G
Sbjct: 232 CFTFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAG 291

Query: 280 SEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSA--EGGS 337
            E+I++ A E   PR  +P+A K+   R                  N   L +A  E   
Sbjct: 292 GEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARP 351

Query: 338 GSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFT 397
           G+ +SP+VIA    G+R++P I+N  ++T+  S GN+  Y + R L  +A  G  PKIFT
Sbjct: 352 GAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFT 411

Query: 398 YVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFR 457
             ++QG P+  +    L+  I+ +  ++    V  WL  I   SQL  +  + ++++ FR
Sbjct: 412 RCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFR 471

Query: 458 RAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQN 517
           RA  +Q   L EL +++      + + +   ++++I Q +    P       +V+ F   
Sbjct: 472 RAYLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIVQGYTVFFP----KNWNVQDFLFC 527

Query: 518 YLAFPVLVVFYLGYK-LWK 535
           YL   + +  Y+ YK +W+
Sbjct: 528 YLMIFINIGIYIFYKFIWR 546

>Kwal_23.4026
          Length = 534

 Score =  172 bits (435), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 138/532 (25%), Positives = 240/532 (45%), Gaps = 23/532 (4%)

Query: 39  DSFKRAQVDTAVDLEGKDAD--NGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGK 96
           D+      DT  + E  + D    + ++ QTL+   K RH               + +G 
Sbjct: 15  DTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGT 74

Query: 97  ALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVAL 156
           AL  GGP  L+I ++ T ++L  V+ +  E+  ++A +  +++ Y T  VD   GFA   
Sbjct: 75  ALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMA-SFAPMDKSFSGYATRYVDPALGFATGW 133

Query: 157 VYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFN 216
            Y L++A  L  EL    + V+YW   ++  +F+ +F V LL ++F   + Y E EF   
Sbjct: 134 NYFLKYAIALASELSAIGLLVQYWREDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSA 193

Query: 217 SLKVLLMAGFIIMAISLTAGAS-EQGYIGGQYWHD----PGAFGGDRAIDRFKGICSVWV 271
            LK L++    +  + LT G    +  IG +YW +    P    G     RF G  +  +
Sbjct: 194 LLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREYAFVPYLVKGTTG--RFLGWWACVI 251

Query: 272 QAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL 331
           Q+ +AY GSE I +   E  NP++++P AT+  ++R                  + D+ L
Sbjct: 252 QSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISPH-DKTL 310

Query: 332 SAEGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGM 391
           +    S +  SPFVIA    G++ +P  IN +++  + S  N+A+Y   R    LA+ GM
Sbjct: 311 ANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGM 370

Query: 392 CPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAV 451
            PKIF   +R G P    +   L  L++F+  SN    +F +L++   +     W ++ +
Sbjct: 371 APKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLI 430

Query: 452 SHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDV 511
           S++ + RA          + +R       +Y  +FF  +++    + A     K+     
Sbjct: 431 SYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAGFKYKS--- 487

Query: 512 EFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQ 563
             F  +Y+   V +   L +K WK+       +   DL   R I  EE +++
Sbjct: 488 --FIVSYIGIAVFIGNTLFWKFWKKS----AATRPEDL---RSIMVEEAIVE 530

>YBR132C (AGP2) [319] chr2 complement(499608..501398) Plasma
           membrane carnitine transporter, required for the
           carnitine-dependent pathway for transport of acetyl-CoA
           from peroxisomes to mitochondria, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [1791 bp, 596 aa]
          Length = 596

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 128/510 (25%), Positives = 221/510 (43%), Gaps = 28/510 (5%)

Query: 47  DTAVDLEGKDADNGLNKTQQT-------LKHNIKTRHXXXXXXXXXXXXXXXVASGKALH 99
           D  VD E +D  + ++   +T        +  ++ RH               VA GKAL+
Sbjct: 57  DVHVD-EHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALY 115

Query: 100 FGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYG 159
            GGPA L++ +      + C+  +  E+ V +  +   +    T  VD       +  + 
Sbjct: 116 RGGPASLLLAFALWCVPILCITVSTAEM-VCFFPVSSPFLRLATKCVDDSLAVMASWNFW 174

Query: 160 LQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLK 219
                 +P E+V+ +  + YW    +  + +A+  V  L I     + Y E EF   S K
Sbjct: 175 FLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFK 234

Query: 220 VLLMAG-FIIMAISLTAGASEQGYIG---------GQYWHDPGAFGGDRAIDRFKGICSV 269
           ++L  G F    I++  G  E    G          +Y+ D    G  ++   F+G  + 
Sbjct: 235 IILALGLFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVG--KSSGYFQGFLAC 292

Query: 270 WVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQ 329
            +QA+F   G E+I++ A E   PR+ +PKA K+   R                  N   
Sbjct: 293 LIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPD 352

Query: 330 LLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLA 387
           L +A  E   G+ +SP+VIA     +R++P I+N  ++T+  S GN+  Y + R    +A
Sbjct: 353 LTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMA 412

Query: 388 EHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWT 447
             G  PKIFT  +R G P+ ++    ++ L++ +  ++    V  WL  +   SQL  + 
Sbjct: 413 LDGYAPKIFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFV 472

Query: 448 AIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHG 507
            + + ++ FRRA  VQ  SL +L +R    + G  Y     ++   A   I    +    
Sbjct: 473 VLCIVYLFFRRAYHVQQDSLPKLPFR----SWGQPYTAIIGLVSCSAMILIQGYTVFFPK 528

Query: 508 ELDVEFFFQNYLAFPVLVVFYLGYK-LWKR 536
             + + F  +YL   + +  Y+GYK +WKR
Sbjct: 529 LWNTQDFLFSYLMVFINIGIYVGYKFIWKR 558

>YFL055W (AGP3) [1629] chr6 (17004..18680) Amino acid permease for
           serine, aspartate and glutamate, member of the amino
           acid permease family of membrane transporters [1677 bp,
           558 aa]
          Length = 558

 Score =  166 bits (420), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 133/520 (25%), Positives = 225/520 (43%), Gaps = 17/520 (3%)

Query: 49  AVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVI 108
           AVD++ +D D      Q  +K  +K RH               V +G AL+ GGP  L++
Sbjct: 31  AVDID-EDPDVSRYDPQTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLL 89

Query: 109 GYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPL 168
           G+     + + V+++  E+   Y +  G +                   Y + +  VL  
Sbjct: 90  GFSIIGIIAFSVMESIGEMITLYPS-GGGFTTLARRFHSDALPAVCGYAYVVVFFAVLAN 148

Query: 169 ELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVL-LMAGFI 227
           E  T S  +++W   V    ++ IF+         G   + E E+    LK++ L+A +I
Sbjct: 149 EYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYI 208

Query: 228 IMAISLTAGASEQGYIGGQYWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTA 287
              + ++     +   G  YW+ PGA         FKGI  V+V  +  Y G+E +AL A
Sbjct: 209 FSIVYISGDIRNRPAFGFHYWNSPGALS-----HGFKGIAIVFVFCSTFYSGTESVALAA 263

Query: 288 AEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGSGSRASPFVIA 347
            E  NP ++VP A ++ L+R                  + D  LSA   +    SP  IA
Sbjct: 264 TESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFD-DPNLSAS--TKVLKSPIAIA 320

Query: 348 AALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLV 407
            +  G     H++N  IL + IS  N ++Y   R L  LA  G+ PKI  + DR+G P+ 
Sbjct: 321 ISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIP 380

Query: 408 TLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSL 467
            +   +  GLI+ +  S    N ++++  ++G+     W  I+ +H+R R+A   QGRS+
Sbjct: 381 AITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSI 440

Query: 468 GELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVF 527
            EL Y A         ++  N+ + + Q W    P       D   F   Y+  PV ++ 
Sbjct: 441 EELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP------FDAGNFVDAYILLPVGILL 494

Query: 528 YLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAE 567
           Y+G  ++K +    +    ++L   R+   E  L  +E+ 
Sbjct: 495 YIGICVFKSNHFRTVDLRSINLDEGRRKDMEADLSDQESS 534

>AAR038W [224] [Homologous to ScYBR132C (AGP2) - SH]
           complement(409071..410771) [1701 bp, 566 aa]
          Length = 566

 Score =  163 bits (413), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 132/553 (23%), Positives = 235/553 (42%), Gaps = 22/553 (3%)

Query: 30  NRNAWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXX 89
           +R    R  DS+  ++  + V  E   A  G      +    ++ RH             
Sbjct: 17  DRGVAIRRKDSWVPSEHSSEVGDEASSA--GFAGKYHSTYRKLENRHVQLIGISGVIGTA 74

Query: 90  XXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKG 149
             V+ GKAL+ GG   L++G+      + C+  +  E+ V Y  L   +    +  V+  
Sbjct: 75  LFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEM-VCYLPLNSPFLRLASRCVNDS 133

Query: 150 FGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYA 209
                   +       +P E+V  +  + YW    +  + + +  +  L I  F  R Y 
Sbjct: 134 LTVMAGWNFWFLECVQIPFEIVAVNSIIHYWRDDYSAAITLVVQVMLYLLISLFAVRYYG 193

Query: 210 EAEFIFNSLKVLLMAG-FIIMAISLTAGASEQGYIGGQY-------WHDPGAFGGDRAID 261
           E EF   S KVLL  G F    +++  G  ++   G +Y        + P       +  
Sbjct: 194 EIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRYIGEAPFKQYSPTMEPISSSAG 253

Query: 262 RFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXX 321
            F+G  +  +QA+F   G +++++ A E   PR+ +P A K+   R              
Sbjct: 254 YFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGI 313

Query: 322 XXXHNSDQLLSAEGGS--GSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSA 379
               N   L +A   S  G+ +SP+VIA    G++++P I+N  ++T+  S GN+  Y +
Sbjct: 314 VCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCS 373

Query: 380 PRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAG 439
            R L  LA  G  P IF   +R G P+  +    ++ +++ +  ++    V  WL ++  
Sbjct: 374 SRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLIT 433

Query: 440 LSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIA 499
            SQL  +  + V ++ FRRA   Q  +L EL +++      +Y  +   +++++ Q +  
Sbjct: 434 ASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTV 493

Query: 500 IAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYK-LWKRDFRLVIPSSEVDLLSHRQIFDE 558
                     +V+ F   YL   + +  YLGY+ +W+R    VIP +EVDL +       
Sbjct: 494 F----YSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTTGLL---- 545

Query: 559 EVLLQEEAERKER 571
           E+ L E     ER
Sbjct: 546 EIELHERHHGFER 558

>CAGL0C00539g 57784..59502 highly similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease,
           hypothetical start
          Length = 572

 Score =  153 bits (386), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 111/449 (24%), Positives = 196/449 (43%), Gaps = 16/449 (3%)

Query: 41  FKRAQVDTAVDLEGKDADNGLNKTQ----QTLKHNIKTRHXXXXXXXXXXXXXXXVASGK 96
           F+   V  ++  +  +  +  ++TQ     +    +  RH               VA GK
Sbjct: 26  FESDDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGTALFVAIGK 85

Query: 97  ALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVAL 156
            L+ GGPA L++ +      + C+  +  E+ V++  +   +       VD+  G   + 
Sbjct: 86  PLYRGGPANLLLAFALWCIPILCITVSTAEM-VSFMPVSSPFLRLAKKCVDESLGVTASW 144

Query: 157 VYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFN 216
            +       +P E+V+ +  + YW    +P + + I  V  + I     + Y E EF   
Sbjct: 145 NFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLA 204

Query: 217 SLKVLLMAG-FIIMAISLTAGASEQGYIGGQYWHDP--------GAFGGDRAIDRFKGIC 267
           S K++L  G F    I++  G  +    G +Y+ +         G  G  ++   F+G  
Sbjct: 205 SFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNEGAGKSAGYFQGFL 264

Query: 268 SVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNS 327
           +  +QAAF   G E+I++ A E   PR+ +PKA K+   R                  N 
Sbjct: 265 TCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCVGIVCSPND 324

Query: 328 DQLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
             L +A  E   G+ +SP+VIA     +RV+P I+N  ++T+  S GN+  Y + R L  
Sbjct: 325 SALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYG 384

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           +A  G  PKIFT  ++ G P+  +     + L++ +  ++    V  WL  +   SQL  
Sbjct: 385 MALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLIN 444

Query: 446 WTAIAVSHVRFRRAMRVQGRSLGELGYRA 474
           +  + V ++ FRRA   Q   L EL +++
Sbjct: 445 FVFLCVIYLFFRRAYMTQKERLPELPFKS 473

>KLLA0C15873g 1381699..1383405 similar to sp|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease, start by
           similarity
          Length = 568

 Score =  152 bits (383), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 120/519 (23%), Positives = 218/519 (42%), Gaps = 19/519 (3%)

Query: 56  DADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTST 115
            +D+  +    +    ++ RH               V+ GKAL+ GGP  L++G+     
Sbjct: 41  SSDDNSSYFNNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCI 100

Query: 116 MLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASM 175
            + C+  +  E+ V Y  +   +        +          +       +P E+V  + 
Sbjct: 101 PILCITVSTAEM-VCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNT 159

Query: 176 TVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAG-FIIMAISLT 234
            + YW    +P + + +  +  + I  F  R Y E E    S K+LL  G F+   I++ 
Sbjct: 160 ILHYWRDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITML 219

Query: 235 AGASEQGYIGGQYWHD-------PGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTA 287
            G  +    G +Y  D       P    G  ++  F+G  +  +QA+F   G +++A+ A
Sbjct: 220 GGNPKHDRYGFRYITDTKFKQYFPNN-EGSSSMGYFQGFLACVIQASFTIAGPDYVAMIA 278

Query: 288 AEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLLSAEGGS--GSRASPFV 345
            E   PR+ +P A K+   R                  N   L +       G+ +SP+V
Sbjct: 279 GECKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYV 338

Query: 346 IAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRP 405
           IA    G++V+P ++N  ++T+  S GN+  Y + R L  L+  G  PK+F Y  + G P
Sbjct: 339 IAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVP 398

Query: 406 LVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGR 465
           +  ++    +  I+ +   +    V  WL  +   SQL  ++ + V ++ FRRA   Q  
Sbjct: 399 INAVLVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHP 458

Query: 466 S--LGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVE-FFFQNYLAFP 522
           S  L EL +++      +Y  +F   +++  Q +        HG  +V+ F F   + F 
Sbjct: 459 SGELPELPFKSWGQPYTAYCGLFAVTLMIGVQGYTVFL----HGSWEVQSFLFCYLMVFI 514

Query: 523 VLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVL 561
            L +F L + ++KR     +   + DLL+     +E  L
Sbjct: 515 DLGIFLLCFFVYKRTRDPWVKPEDADLLTGMDEVEEHEL 553

>Kwal_23.3847
          Length = 579

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/508 (23%), Positives = 211/508 (41%), Gaps = 20/508 (3%)

Query: 35  TRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
           T     F    +D +  LEGK + +  + T + L      RH               V+ 
Sbjct: 35  TGIPSEFAFESLDLSPPLEGKQSLD-TDATHRKLHE----RHVMLIGISGVIGTALFVSI 89

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
           GKAL+ GG A L++G       + C+  +  E+ V Y  L   +       VD     A 
Sbjct: 90  GKALYHGGSAFLLLGMAVWCIPMLCITVSTAEM-VCYLPLDSPFLRLTARCVDDSVAVAA 148

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFI 214
              +       +P E+V  +  + YW    +  + + +  V    I  F  R Y E EF 
Sbjct: 149 GWNFWFLECVQIPFEIVAVNTIIHYWRDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFW 208

Query: 215 FNSLKVLLMAG-FIIMAISLTAGASEQGYIGGQYWHD-------PGAFGGDRAIDRFKGI 266
             S K++L  G F    +++  G   +   G + + D       P    G  +   F+G 
Sbjct: 209 LASFKIILALGLFTFTLVAMLGGNPHKDRFGFRNFGDAPFKQYFPSGVVGTPSAGYFQGF 268

Query: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHN 326
            +  +QA+F   G +++++ A E   PR+ +P A K    R                  N
Sbjct: 269 LACLIQASFTIAGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSAN 328

Query: 327 SDQLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILL 384
              L +A  E   G+ +SP+VIA    G+R +P ++N  ++T+  S GN+  + + R L 
Sbjct: 329 DPDLTAAINEARPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLH 388

Query: 385 SLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLF 444
            +A  G  P+IF   +R G P+  +     + L++ +  +     V  WL  +   SQL 
Sbjct: 389 GMALDGNAPRIFRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLI 448

Query: 445 TWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIP 504
            +  + ++++ FRRA   Q  +L  L +++      +   +F ++++ + Q +       
Sbjct: 449 NFACLCLTYLYFRRAYLSQQHNLPSLPFKSWGQPYTALLGLFASLLMALVQGYSVF---- 504

Query: 505 KHGELDVEFFFQNYLAFPVLVVFYLGYK 532
           ++   +V+ F   YL   V +  YL +K
Sbjct: 505 QNSLWNVKDFLFCYLMVFVDIAIYLFHK 532

>Scas_619.2*
          Length = 471

 Score =  139 bits (349), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 120/445 (26%), Positives = 215/445 (48%), Gaps = 27/445 (6%)

Query: 146 VDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSS--VNPDVFVAIFYVFLLFIHFF 203
           VD+  GFA +  Y   +  ++  E   A+  V+YW  +  V    ++ IF   ++ ++  
Sbjct: 30  VDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNML 89

Query: 204 GSRGYAEAEFIFNSLKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAFG------- 255
               Y E+EF F S+K+L + G II++ I    G      +G +YW  PGAF        
Sbjct: 90  PVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFRYWQRPGAFADHITDGT 149

Query: 256 GDRAIDRFKGICSVWVQAAFAYG-GSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXX 314
           G   +D + G+    ++  FA+  G E ++LT++E  + R ++ KA++R+++R       
Sbjct: 150 GGNFLDVYTGV----IKGGFAFVLGPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVL 205

Query: 315 XXXXXXXXXXHNSDQLLSA--EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVG 372
                     +N   L +A  +   G+ +SPFVI     G++V+PHIIN  I+TS  S G
Sbjct: 206 GSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAG 265

Query: 373 NSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFT 432
           N+ M+++ R LL++A HG  PK F+ ++R    +       L  L + +     +   F 
Sbjct: 266 NAYMFASSRSLLTMASHGHAPKFFSKINRLRCSIRGSWLFLLILLFSLLKRLLIDSKRFQ 325

Query: 433 WLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFF-NVIV 491
            +   + +S    W    V+++RFR+A+ +       L Y+        +Y++F  ++I 
Sbjct: 326 LVFKHSTISGFIGWICACVAYIRFRKAI-IFNDLYDRLPYKGFAQKYLIWYSLFMVSLIT 384

Query: 492 LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFR-LVIPSSEVDLL 550
           L   + I    IP+    D + F   Y+  PV +V ++G+KL  R +R   IP  ++D+ 
Sbjct: 385 LTNGYQIF---IPRF--WDYKDFIAAYITLPVFIVLWIGHKLVTRSWRQWYIPVDKIDVF 439

Query: 551 SHRQIFDEEVLLQEEAERKERLRNS 575
           +  +  +E  L  E  E++    N+
Sbjct: 440 TGLEEIEE--LTNELDEKRVPPNNA 462

>Sklu_2365.9 YDR160W, Contig c2365 13522-15939
          Length = 805

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 133/580 (22%), Positives = 228/580 (39%), Gaps = 81/580 (13%)

Query: 65  QQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQAC 124
           Q T++  +K RH               + SGKA    GP G  +GY+  +  +   + + 
Sbjct: 226 QVTIQRKLKVRHLQMISLGATIGVGLFLNSGKAFSIAGPLGTFLGYLFGALTILATLLSF 285

Query: 125 CELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS-- 182
            E+ VA   L    +   +  +   FGF+V   +   +A   P EL+  ++ + Y+T+  
Sbjct: 286 AEI-VALIPLITGISGLCSRFIGDAFGFSVGWCHWASYAFGFPSELIATAIMLSYYTNLQ 344

Query: 183 --SVNPDVF---VAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGA 237
             S N       + I    L  ++    R Y E E+  +++K++++A  II+ I +  G 
Sbjct: 345 SISTNQGSMASAIVIMIAALTVLNLMDVRVYGELEYFASTIKLIVVALLIILMIVVNCGG 404

Query: 238 SEQGYIGGQYWHDP---------GAF--------GGDRAIDRFKGICSVWVQ-------A 273
              GYIG +YW            GAF         GD A +   G   V +        A
Sbjct: 405 LNNGYIGFRYWDKNKSKSEHITFGAFRPTFDLKDTGDGARNGIGGFGGVLLSCIASTLVA 464

Query: 274 AFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL-- 331
            F+Y GSE   + A E  NPR++VP  TKR   R                     +LL  
Sbjct: 465 VFSYVGSEIGFIAAGEAQNPRKAVPSVTKRIFTRVVVFYLLSIFVVGLNFYSGDPRLLRY 524

Query: 332 --------------------SAEGG--------------SGSRASPFVIAAALHGVRVVP 357
                                + GG                S  SP+VIA        + 
Sbjct: 525 YSPEDNQMLIEKFEGYKDLIDSLGGLNCNTVLTEQNFVNESSNQSPWVIALKSFKQCTLS 584

Query: 358 HIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGL 417
            I+N + +    S  +S +Y++ R L S+A     P +FT+ +R G P +++IF +  G 
Sbjct: 585 SIVNGVFVAIGFSAASSQLYASSRTLYSMATQQKAPSVFTWCNRHGVPYMSVIFCAFLGF 644

Query: 418 IAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMR----VQGRSLGELGYR 473
           ++ +  + +  +VF     I  +  +  W ++ +S +RF  A++    +  R   E  Y+
Sbjct: 645 LSLLCLNMKSTDVFIMFINIGAMGSVIMWFSMNLSFLRFYYALKRRPDIISRDSKEYPYK 704

Query: 474 ANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKL 533
           +    L  Y +IF  V   I    +           + + F  +Y    + VV Y GY  
Sbjct: 705 S---PLQPYLSIFGMVSTAI---LVLFNGFQNFFYWNTKNFISSYCTVVLFVVLYFGYNW 758

Query: 534 WKRDFRLVIPSSEVDLLSHRQIFDEEVLLQEEAERKERLR 573
           +K     +     +DL S R+  D  ++ +E+ +    L+
Sbjct: 759 FKHS--QINKLENIDLDSGRREMD-SIIWKEDVDYSLSLK 795

>KLLA0D16830g 1426856..1429354 similar to sp|Q03770 Saccharomyces
           cerevisiae YDR160w SSY1 transcriptional regulator of
           several transporter genes, start by similarity
          Length = 832

 Score =  128 bits (321), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 133/587 (22%), Positives = 236/587 (40%), Gaps = 83/587 (14%)

Query: 59  NGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLY 118
           N L  +  +++  ++ RH               + SGKA    GP G ++GYV   +++ 
Sbjct: 248 NALKGSHHSVQRKLEARHIQMIASGSSLGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVM 307

Query: 119 CVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVK 178
               +  EL  A   L   ++   +  V+  FGFA+  +Y   +   +P ++V ++M + 
Sbjct: 308 ASTLSFTEL-CALIPLTSGFSGLASRFVEDAFGFALGWLYWFSFIIAVPSQVVASTMLLN 366

Query: 179 YWTS----SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLT 234
           Y+ S    S     FV +F VF +FI+    R +    +    +K++     I + I L 
Sbjct: 367 YYQSLNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLN 426

Query: 235 AGASEQGY--IGGQYWHD----PGAFGG---------DRAIDRFKGICSV---------- 269
           +G +  G+  +G ++W      PG F G         D   +   GI             
Sbjct: 427 SGGAALGHDRVGFRFWDAGKSAPGLFYGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLS 486

Query: 270 WVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLY----------------------R 307
            + AAF Y G E   + + E  NP++++P A K+ LY                      R
Sbjct: 487 MLIAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIMLLIYTISIFVVGLNIYSGDPR 546

Query: 308 XXXXXXXXXXXXXXXXXHN-------------SDQLLSAEGGSGSRASPFVIAAALHGVR 354
                            HN             +     +    G+R S +VIA    G  
Sbjct: 547 LPRFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGSLLSDGNR-SAWVIALRSFGRC 605

Query: 355 VVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSL 414
               ++N I++    + G S++Y A   L S+A  G  P+I       G P + ++   +
Sbjct: 606 TFASVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPRICKACTSYGVPWIAVLVSGI 665

Query: 415 FGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQ----GRSLGEL 470
           FG+I+++A      N F  L+ I+  +    W  + VS +RF  A++++     R     
Sbjct: 666 FGVISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKIRPDIMSRDDPMF 725

Query: 471 GYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLG 530
            YR+      SYY +F +++++    + +      HG  +++ FF  Y      +V Y+G
Sbjct: 726 PYRSPFQPYLSYYGLFGSLVMIFFAGFTSFF----HGFWNIKIFFSCYGGLVFFIVLYIG 781

Query: 531 YKLW--KRDFRLVIPSSEVDLLSHRQIFDEEVLLQE---EAERKERL 572
           YKL+   +  RL     ++D+   R   D  +  Q+   +   KERL
Sbjct: 782 YKLFGTSKLQRL----DQIDMDIGRIELDRTIWNQQTEYQGNWKERL 824

>CAGL0E01089g complement(96582..99143) similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes, start by
           similarity
          Length = 853

 Score =  121 bits (304), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 124/551 (22%), Positives = 213/551 (38%), Gaps = 95/551 (17%)

Query: 63  KTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQ 122
           + +  L+ N+K RH               + SGKA    GP G ++G++ T T++   + 
Sbjct: 270 RRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFIITGTVVIATMM 329

Query: 123 ACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWT- 181
           +  EL        G ++   +  V+  FGFA+   Y       LP ++V+++    ++  
Sbjct: 330 SFAELATLIPVSSG-FSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVSSTFYFSHYDH 388

Query: 182 ---SSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGA- 237
              +      FV +F +F L ++ F  R   E  +I    KVL+    +I+ + L AG  
Sbjct: 389 LKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVIVMLVLNAGHG 448

Query: 238 -SEQGYIGGQYWH----------------------DPG-----AFGGDRAIDRFKGICSV 269
               G +  +YW                       D G       GG+R   RF  + SV
Sbjct: 449 FDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRG--RFIAVVSV 506

Query: 270 WVQAAFAYGGSEFIALTAAEQANPRESVPKATKRW------------------LYRXXXX 311
            + + FA+ G E   + + E  NPR+++P A KR                   +Y     
Sbjct: 507 MLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSINIYTGDPR 566

Query: 312 XXXXXXXXXXXXXHNSDQLLSAEGGSGSR-----------------ASPFVIAAALHGVR 354
                        HN +  +S E     R                 +SP+V+A    G  
Sbjct: 567 LLSYYTGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVLALENFGFC 626

Query: 355 VVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSL 414
                 N +++    S   S++Y++ R L +++     P +F   DR+G P V + F SL
Sbjct: 627 SFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPYVAIGFSSL 686

Query: 415 FGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELG--- 471
           F ++A++A  +   + F  L  I+  +    W  + V+ +RF  A++ +   +       
Sbjct: 687 FAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDIISRDDVFY 746

Query: 472 --------YRANTGALG-SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFP 522
                   Y +  G LG S + +F   I  I  +W            + + FF +Y    
Sbjct: 747 PYRSPFQPYLSMFGLLGCSIFVLFMGFINFIHGYW------------NTKSFFSSYGGLI 794

Query: 523 VLVVFYLGYKL 533
           +  V YLGYKL
Sbjct: 795 LFGVCYLGYKL 805

>Kwal_53.19461
          Length = 565

 Score =  117 bits (294), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 130/562 (23%), Positives = 230/562 (40%), Gaps = 99/562 (17%)

Query: 94  SGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFA 153
           SGKAL  GGP G ++G+    +++   + +  E+      L    +   +  V+  FGFA
Sbjct: 16  SGKALSIGGPFGFLLGFSICGSIVLATMLSFTEIA-TLIPLSSGISGLASRFVEDAFGFA 74

Query: 154 VALVYGLQWATVLPLELVTASMTVKYWTS----SVNPDVFVAIFYVFLLFIHFFGSRGYA 209
           +   Y L +A  L  ++V ++  + Y+ +    + +   FV  F VF +  +       A
Sbjct: 75  LGWSYWLTYAITLANQIVASNFMLSYYGTMPARTGSTVGFVTFFLVFAIAGNLLDVNILA 134

Query: 210 EAEFIFNSLKVLLMAGFIIMAISLTAGASEQGY--IGGQYWH------------------ 249
           E  + F   K+++ A  I   + L AGA    +  +G ++W                   
Sbjct: 135 ELAYGFTFFKIVITATMIFAMVILNAGAGRHKHPRVGFRFWDASKSPENLTYGLFRPTFD 194

Query: 250 -----DPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRW 304
                D    G   A  RF  +  V + ++F++ G E   +   E ANPR S+P ATKR 
Sbjct: 195 LQDVGDGAKNGIPGAKGRFLSVLVVIIVSSFSFSGVEVGFVACGEAANPRRSLPSATKRT 254

Query: 305 -------------------------LYRXXXXXXXXXXXXXXXXXHN---SDQLLSA--- 333
                                    L R                 +N   +DQ+ +A   
Sbjct: 255 IMTVIILYVVSIFVISLNVYSGDSRLLRYYTAATQEPTQSSVRAFNNNWQTDQVCTAHEI 314

Query: 334 ----EGGSGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEH 389
               +  +GS+ SP+V+A    G+     + N +++   ++   S++Y++ R L S++  
Sbjct: 315 VSTTDFTNGSQ-SPWVLALESFGLCTFSSVFNAMLVIFGVTSELSSLYASSRTLYSMSIQ 373

Query: 390 GMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAI 449
           G  P IF    R+G P V +IF  LFG +A++  + +   +F  L+ I+G +    W   
Sbjct: 374 GKAPPIFKICSRKGVPYVAVIFSGLFGALAYLTVNAKALEIFQALANISGATISIIWFGF 433

Query: 450 AVSHVRFRRAMR----VQGRSLGELGYRANTGALGSYYAIF--FNVIVLIA------QFW 497
            +S +RF  A++    +  R      YR+      + Y +F  F ++VL+        FW
Sbjct: 434 NLSFLRFYYALKRRPDIISREDPSFPYRSPLQPFLACYGLFGSFLIVVLMGFSNFLDGFW 493

Query: 498 IAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLW--KRDFRLVIPSSEVDLLSHRQI 555
                       + + FF +Y    V ++ Y GY+L    +  RL     ++DL S R+ 
Sbjct: 494 ------------NTKMFFSSYGGLIVFILCYAGYRLLGTSKIQRL----DQLDLDSGRRE 537

Query: 556 FDEEVLLQEEA---ERKERLRN 574
            D  +  +        +ER+R 
Sbjct: 538 MDRMIWTEHREYTNSVRERIRK 559

>Kwal_27.11900
          Length = 726

 Score =  116 bits (291), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 113/511 (22%), Positives = 198/511 (38%), Gaps = 72/511 (14%)

Query: 53  EGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVT 112
           E     N     Q T++  ++ RH               + SGKA    GP G +IG+  
Sbjct: 217 ENSPPSNKSVPQQSTIQRKLRVRHLQMISLGATIGVGLFLNSGKAFSIAGPMGALIGFTI 276

Query: 113 TSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVT 172
             T++   + +  E+ VA   L    +   +  V   FGF+V   + L +A   P E++ 
Sbjct: 277 GGTLILATLFSFAEM-VALIPLITGISGLCSRFVGDAFGFSVGWCHWLSYAVGFPSEVIA 335

Query: 173 ASMTVKYW-------TSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAG 225
           +++ + Y+       T+     + +    V L  I+    R Y E E+  +  K+ ++  
Sbjct: 336 STIMLSYYKNLEQIATNRYYTALTITGIVVGLTLINLMDVRIYGELEYCSSVFKLAIVVF 395

Query: 226 FIIMAISLTAGASEQGYIGGQYWH--------------------DPGAFGGDRAIDRFKG 265
            II+ I +  G     YIG +YW+                    + G  G    +  F G
Sbjct: 396 LIILMIVMNVGGLHNDYIGFRYWNRHKSPLEETTFGLFRPTFDMEDGGHGSRGGVPGFGG 455

Query: 266 ICSVWVQAA----FAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXX 321
           +    + +     FAY GSE   + A E  NPR++VP  TKR   R              
Sbjct: 456 VLLSCIASTLVSVFAYVGSEIGFIAAGEAKNPRKAVPSVTKRIFTRVIMFYLLSIFVVGL 515

Query: 322 XXXHNSDQLLSAEGGS--------------------GSRA----------------SPFV 345
                  +LL  + GS                    GS                  SP+V
Sbjct: 516 NIYSGDPRLLRYDAGSNIAVTDNDETGVQAIINALGGSNCQQSRTENIFLVDNPNQSPWV 575

Query: 346 IAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRP 405
           IA        +  +IN + ++  IS  +S +Y++ R L S+A     P +FT+  + G P
Sbjct: 576 IAMQSLNQCTLSSVINGVFVSIGISAASSQLYASSRTLYSMATQQKAPALFTWCTKGGVP 635

Query: 406 LVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQ-- 463
            + ++F  L G ++ +  +     VF    +I  +  +  W  + +S++RF  A++V+  
Sbjct: 636 YMCVLFCGLLGFLSLLCLNMDSAEVFFIFVSIGAMGSVIVWFGMNLSYLRFYYALKVRPD 695

Query: 464 --GRSLGELGYRANTGALGSYYAIFFNVIVL 492
              R+  E  YR+      + Y +   V+++
Sbjct: 696 ILSRNAKEFPYRSPCQPYLAIYGMVLAVLLI 726

>KLLA0B09922g complement(867748..870141) weakly similar to sp|Q03770
           Saccharomyces cerevisiae YDR160w SSY1 transcriptional
           regulator of several transporter genes P23.1.f18.1,
           hypothetical start
          Length = 797

 Score =  115 bits (287), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 135/606 (22%), Positives = 236/606 (38%), Gaps = 89/606 (14%)

Query: 38  TDSFKRAQVDTAVDLEGKDADNGLNKTQQ---TLKHNIKTRHXXXXXXXXXXXXXXXVAS 94
            D  K  +V  + +++    DN   +  +   +L+  +K RH               + S
Sbjct: 189 NDIMKIQEVTVSDNIDEVPIDNHHRRKSRHNTSLQRKLKIRHLQMISLGATIGVGLFLNS 248

Query: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154
           G+A    GP G  IG++  + ++   + +  E+ VA+  L    +   +  V   FGF V
Sbjct: 249 GRAFSIAGPMGAFIGFLYGALVILATLFSFAEM-VAFIPLITGISGLCSRFVGDSFGFTV 307

Query: 155 ALVYGLQWATVLPLELVTASMTVKYWT--SSVNPD-----VFVAIFYVFLLFIHFFGSRG 207
              + L +A   P EL+ +++ + Y+T    V  D     + V I  + L  I+    R 
Sbjct: 308 GWCHWLSYAVAFPSELIASAIMISYYTPFEKVATDNLYLGLTVTILIIVLTGINLLDVRI 367

Query: 208 YAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQYW------------------- 248
           YAE E+I +  K+ ++   +++ + L  G    GY+G ++W                   
Sbjct: 368 YAELEYIMSVFKLAVVLFLLVLVLILNCGGFRNGYLGFKFWTKDRSPSPDVTFGPFRPTF 427

Query: 249 --HDPGAFGGDRAIDRFKGI------CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKA 300
             +D G+ G  + I  F G+      CS  V + F+Y GSE   + A E  NPR++VP  
Sbjct: 428 DLNDYGS-GSKQGIGGFGGVLLSCITCS--VSSIFSYIGSEIGFIAAPEAENPRKAVPSV 484

Query: 301 TKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL---------------------SAEGG--- 336
           TKR   R                     +LL                        GG   
Sbjct: 485 TKRIFVRVVLFYLLSIFMVGTVIYAGDPRLLRIISDNSKVTDQNLEKFMLIIDQLGGMNC 544

Query: 337 -----------SGSRASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLS 385
                        S  SP+VIA        + ++IN + +   IS  +S +Y++ R L S
Sbjct: 545 NTRLQNDNIFQESSNQSPWVIAFKAVKQCDLANVINGVFVCIGISAASSQLYASSRTLYS 604

Query: 386 LAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFT 445
           +A     P +FT+    G P V+++F    G ++ +    +         +I     +  
Sbjct: 605 MATQNKAPSVFTWCTNGGVPYVSILFCGSLGFLSLLCFDLRSTEALLLFISIGITGSVVM 664

Query: 446 WTAIAVSHVRFRRAMR----VQGRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIA 501
           W  + +S +RF  A++    +  R+  E  Y++       Y  IF    +    F + + 
Sbjct: 665 WFGMNLSFLRFYMALKRRPDIIDRNSKEYPYKS---PFQPYLCIFG---MASTTFLLLMN 718

Query: 502 PIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVL 561
            I          F  +YL   + +V Y GY + +     +    ++DL S R+  D  VL
Sbjct: 719 GIQNFFVWKTANFISSYLIIVIFIVLYSGYNVVRTS--TINRLEQIDLDSGRREMD-RVL 775

Query: 562 LQEEAE 567
            +E A+
Sbjct: 776 WKENAD 781

>YDR160W (SSY1) [1002] chr4 (776157..778715) Component of an
           extracellular amino acid sensor comprised of Ptr3p,
           Ssy1p, and Ssy5p, member of the amino
           acid-polyamine-choline (APC) family of membrane
           transporters [2559 bp, 852 aa]
          Length = 852

 Score =  115 bits (287), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 125/549 (22%), Positives = 216/549 (39%), Gaps = 84/549 (15%)

Query: 56  DADNGLNKTQQTLKHNI----KTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYV 111
           D +   N+++ T K++I    K RH               + SGKA    GP G ++G+ 
Sbjct: 261 DIEKVFNRSRATRKYHIQRKLKVRHIQMLSIGACFSVGLFLTSGKAFSIAGPFGTLLGFG 320

Query: 112 TTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELV 171
            T +++   + +  EL        G ++   +  V+  FGFA+   Y +     LP ++ 
Sbjct: 321 LTGSIILATMLSFTELSTLIPVSSG-FSGLASRFVEDAFGFALGWTYWISCMLALPAQVS 379

Query: 172 TASMTVKYWTS-SVNPDV---FVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFI 227
           +++  + Y+ + +++  V   F+ +F  F + ++        E  ++    KV++    +
Sbjct: 380 SSTFYLSYYNNVNISKGVTAGFITLFSAFSIVVNLLDVSIMGEIVYVAGISKVIIAILMV 439

Query: 228 IMAISLTAGASEQGY--IGGQYWH--------------------DPGAFGGDRAID---- 261
              I L AG     +  +G +YW                     D G  G  + I     
Sbjct: 440 FTMIILNAGHGNDIHEGVGFRYWDSSKSVRNLTYGLYRPTFDLADAGE-GSKKGISGPKG 498

Query: 262 RFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXX 321
           RF    SV + + FA+ G E   L + E  NPR+++P ATKR                  
Sbjct: 499 RFLATASVMLISTFAFSGVEMTFLASGEAINPRKTIPSATKRTFSIVLISYVFLIFSVGI 558

Query: 322 XXXHNSDQLLS--------------------------AEGGSGSR--------ASPFVIA 347
                  +LLS                            GG   R        +SP+V+A
Sbjct: 559 NIYSGDPRLLSYFPGISEKRYEAIIKGTGMDWRLRTNCRGGIDYRQISVGTGYSSPWVVA 618

Query: 348 AALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLV 407
               G+       N I++    + G S+++S  R L +++     P +F    ++G P V
Sbjct: 619 LQNFGLCTFASAFNAILIFFTATAGISSLFSCSRTLYAMSVQRKAPPVFEICSKRGVPYV 678

Query: 408 TLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMR----VQ 463
           ++IF SLF +IA++A        F  L+ ++  S    W  + +S +RF  A++    + 
Sbjct: 679 SVIFSSLFSVIAYIAVDQTAIENFDVLANVSSASTSIIWMGLNLSFLRFYYALKQRKDII 738

Query: 464 GRSLGELGYR-------ANTGALG-SYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFF 515
            R+     Y+       A  G +G S + IF      I  FW   A    +G L   FFF
Sbjct: 739 SRNDSSYPYKSPFQPYLAIYGLVGCSLFVIFMGYPNFIHHFWSTKAFFSAYGGL--MFFF 796

Query: 516 QNYLAFPVL 524
            +Y A+ VL
Sbjct: 797 ISYTAYKVL 805

>AGL171W [4141] [Homologous to ScYDR160W (SSY1) - SH]
           complement(377256..379811) [2556 bp, 851 aa]
          Length = 851

 Score =  100 bits (248), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 111/536 (20%), Positives = 208/536 (38%), Gaps = 79/536 (14%)

Query: 68  LKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127
           ++  +K RH               + SG A    GP G ++G+    T+    + +  EL
Sbjct: 279 IQRKLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSFTEL 338

Query: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187
                   G ++   +  V+  FGFA+   Y L +    P +++ +   + Y+   V   
Sbjct: 339 STLIPISSG-FSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASVFMLSYYEKVVATR 397

Query: 188 V----FVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLL--MAGFIIMAISLTAGASEQG 241
           +     V +F+++    +    R +AE  +I   +KVL+  +A  +++ +++     + G
Sbjct: 398 ISTAGLVTVFWLYATAANLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDGKSG 457

Query: 242 YIGGQYW--------------------HDPG-----AFGGDRAIDRFKGICSVWVQAAFA 276
            IG ++W                    HD G       GG R   RF  I  V + + ++
Sbjct: 458 AIGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARG--RFLAIILVVLISTYS 515

Query: 277 YGGSEFIALTAAEQANPRESVPKATKRWLYRXXXXXXXXXXXXXXXXXHNSDQLL----- 331
           + G E   + + E  NPR+++P ATKR   +                     +LL     
Sbjct: 516 FNGVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYGVD 575

Query: 332 -----------------------------SAEGGSGSRASPFVIAAALHGVRVVPHIINF 362
                                        + E G+    SP+++A    G+  +    N 
Sbjct: 576 VPTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGN---RSPWILALQSFGLCSLASAFNG 632

Query: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422
           +++   IS  +S+++++ R L S+A     PK+F      G P + ++F   FG+IA+++
Sbjct: 633 VLVFFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYIS 692

Query: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMR----VQGRSLGELGYRANTGA 478
            +      F  LS+IA  +    W  + VS +RF  A++    +  R      YR+    
Sbjct: 693 VAESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQP 752

Query: 479 LGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLW 534
             S+Y +  + +V+I   +        HG      F  +Y      +  Y  YKL+
Sbjct: 753 FLSFYGLIGSGLVVIFMGFTNFL----HGFWSTRSFLSSYGGLIFFITSYFAYKLF 804

>Scas_476.4
          Length = 237

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 87/190 (45%), Gaps = 1/190 (0%)

Query: 66  QTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACC 125
           +T++  +K RH               +     L   GP G +I Y+  +T+ Y V Q+  
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 126 ELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVN 185
           E+   +  +  ++  +    V   FG A   +Y   W     LEL      +++WT +V 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG 245
              +++IF++ L  ++ F  + Y E EF    +KV+ + GF+I    +  GA   G +G 
Sbjct: 134 LAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGF 193

Query: 246 QYWHDPGAFG 255
           +YW  PGAFG
Sbjct: 194 RYWRHPGAFG 203

>Scas_485.4*
          Length = 237

 Score = 91.3 bits (225), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 87/190 (45%), Gaps = 1/190 (0%)

Query: 66  QTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACC 125
           +T++  +K RH               +     L   GP G +I Y+  +T+ Y V Q+  
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 126 ELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVN 185
           E+   +  +  ++  +    V   FG A   +Y   W     LEL      +++WT +V 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG 245
              +++IF++ L  ++ F  + Y E EF    +KV+ + GF+I    +  GA   G +G 
Sbjct: 134 LAAWISIFWMLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPVGF 193

Query: 246 QYWHDPGAFG 255
           +YW  PGAFG
Sbjct: 194 RYWRHPGAFG 203

>Scas_642.22
          Length = 237

 Score = 89.7 bits (221), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 86/190 (45%), Gaps = 1/190 (0%)

Query: 66  QTLKHNIKTRHXXXXXXXXXXXXXXXVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACC 125
           +T++  +K RH               +     L   GP G +I Y+  +T+ Y V Q+  
Sbjct: 15  ETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLG 74

Query: 126 ELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVN 185
           E+   +  +  ++  +    V   FG A   +Y   W     LEL      +++WT +V 
Sbjct: 75  EMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVP 133

Query: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGG 245
              +++IF+V L  ++ F  + Y E EF    +KV+ + GF+I    +  GA   G +  
Sbjct: 134 LAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPMSF 193

Query: 246 QYWHDPGAFG 255
           +YW  PGAFG
Sbjct: 194 RYWRHPGAFG 203

>Scas_682.30
          Length = 845

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 121/304 (39%), Gaps = 41/304 (13%)

Query: 33  AWTRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHXXXXXXXXXXXXXXXV 92
           + T FTD  +R  +    DLE    D G   T+  ++  ++ RH               +
Sbjct: 237 SMTSFTDRERRKSI-LPFDLEKMFNDPG--NTKYYVQRKLRVRHIQMLSIGTCFSVGFFL 293

Query: 93  ASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGF 152
            SG+A    GP G ++G+    +++   + +  EL        G ++   +  V+  FGF
Sbjct: 294 TSGRAFSIAGPFGTLLGFALAGSIVLATLLSFTELSTLIPVSSG-FSGLASRFVEDAFGF 352

Query: 153 AVALVYGLQWATVLPLELVTASMTVKYWTSSVNPDV-----FVAIFYVFLLFIHFFGSRG 207
            +   Y        P E+ +++  + Y+   +N        FV +F  + + I+    R 
Sbjct: 353 GLGWTYWFSCMIAFPSEVASSTFYLSYY-QHLNLTRGAIAGFVTLFSSYSIIINLLDVRI 411

Query: 208 YAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGY-----IGGQYWHDPGAFG------- 255
             EA +I    K+L+    I + + + AG    GY     +G ++W    + G       
Sbjct: 412 LGEATYIIGLSKILITIVIIFVMVIINAG---HGYKIHNQVGFRFWDSSKSVGDLTYGLF 468

Query: 256 ------GD----------RAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299
                 GD           A  RF  +  V + + FA+ G E   + + E  NPR+++P 
Sbjct: 469 RPTFDLGDVGRGSTNGIPGATGRFLAVILVMLISTFAFSGVEMTFMASGEAINPRKTIPS 528

Query: 300 ATKR 303
           + KR
Sbjct: 529 SIKR 532

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 92/197 (46%), Gaps = 8/197 (4%)

Query: 341 ASPFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVD 400
            SP+V+A    G+      +N I++    + G S++Y++ R + +++     P IF   +
Sbjct: 605 TSPWVLALQSFGLCTFASALNGILIFFTSTAGVSSLYNSSRTIYAMSVQRKAPLIFQRCN 664

Query: 401 RQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAM 460
           ++G P V +IF  +F +IA++A +      F  L  I+  S    W+ + +S +RF  A+
Sbjct: 665 KRGVPYVAVIFSGVFYIIAYLAVNVGSSRNFDVLVNISSASTSIIWSGLNISFIRFYFAL 724

Query: 461 RVQ----GRSLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQ 516
           + +     R+     Y++      S+Y +F  +I +I   +    P    G+     FF 
Sbjct: 725 KQRKDLISRNDKTYPYKSPFQPYLSFYGLFGCLIFVIFMGF----PNFIKGQWSTRSFFS 780

Query: 517 NYLAFPVLVVFYLGYKL 533
            Y    +  + Y G+K+
Sbjct: 781 AYGGLFLFAILYAGFKI 797

>YKL209C (STE6) [3066] chr11 complement(42424..46296) Membrane
           transporter responsible for export of a factor mating
           pheromone, member of ATP-binding cassette (ABC)
           superfamily of membrane transporters [3873 bp, 1290 aa]
          Length = 1290

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 17/115 (14%)

Query: 405 PLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQG 464
           P++T  F  +F  +  V +  ++EN     S  +  +QL TW+  A   VR     R++ 
Sbjct: 185 PIITF-FAVVFSRMIHVYS--EKEN-----SETSKAAQLLTWSMNAAQLVRLYCTQRLER 236

Query: 465 RSLGELGYRANTGALGSYYAI--------FFNVIVLIAQFWIAIAPIPKHGELDV 511
           +   E+    NT  + S + +        F  + + +  FW   A I K G+L++
Sbjct: 237 KKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKK-GKLNI 290

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,030,866
Number of extensions: 613772
Number of successful extensions: 2180
Number of sequences better than 10.0: 111
Number of HSP's gapped: 1766
Number of HSP's successfully gapped: 121
Length of query: 575
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 468
Effective length of database: 12,891,983
Effective search space: 6033448044
Effective search space used: 6033448044
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)